Basic Information | |
---|---|
Family ID | F029947 |
Family Type | Metagenome |
Number of Sequences | 186 |
Average Sequence Length | 46 residues |
Representative Sequence | ACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG |
Number of Associated Samples | 58 |
Number of Associated Scaffolds | 186 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 10.76 % |
% of genes near scaffold ends (potentially truncated) | 79.57 % |
% of genes from short scaffolds (< 2000 bps) | 84.41 % |
Associated GOLD sequencing projects | 58 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (59.677 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (98.925 % of family members) |
Environment Ontology (ENVO) | Unclassified (98.925 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (98.925 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.16% β-sheet: 0.00% Coil/Unstructured: 43.84% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 186 Family Scaffolds |
---|---|---|
PF08224 | DUF1719 | 0.54 |
PF00230 | MIP | 0.54 |
PF13960 | DUF4218 | 0.54 |
PF00241 | Cofilin_ADF | 0.54 |
PF01694 | Rhomboid | 0.54 |
PF00274 | Glycolytic | 0.54 |
COG ID | Name | Functional Category | % Frequency in 186 Family Scaffolds |
---|---|---|---|
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.54 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.54 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 59.68 % |
All Organisms | root | All Organisms | 40.32 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005718|Ga0068866_11446933 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 504 | Open in IMG/M |
3300013297|Ga0157378_13258776 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 504 | Open in IMG/M |
3300015267|Ga0182122_1028027 | Not Available | 655 | Open in IMG/M |
3300015267|Ga0182122_1034224 | Not Available | 620 | Open in IMG/M |
3300015269|Ga0182113_1001089 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1832 | Open in IMG/M |
3300015269|Ga0182113_1012875 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 903 | Open in IMG/M |
3300015269|Ga0182113_1092162 | Not Available | 511 | Open in IMG/M |
3300015274|Ga0182188_1006518 | Not Available | 898 | Open in IMG/M |
3300015274|Ga0182188_1047066 | Not Available | 543 | Open in IMG/M |
3300015277|Ga0182128_1039439 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 616 | Open in IMG/M |
3300015277|Ga0182128_1048922 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 580 | Open in IMG/M |
3300015283|Ga0182156_1072691 | Not Available | 533 | Open in IMG/M |
3300015285|Ga0182186_1080960 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 507 | Open in IMG/M |
3300015287|Ga0182171_1037411 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 647 | Open in IMG/M |
3300015289|Ga0182138_1006124 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1062 | Open in IMG/M |
3300015289|Ga0182138_1083459 | Not Available | 513 | Open in IMG/M |
3300015294|Ga0182126_1087990 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 517 | Open in IMG/M |
3300015294|Ga0182126_1089024 | Not Available | 515 | Open in IMG/M |
3300015295|Ga0182175_1088271 | Not Available | 520 | Open in IMG/M |
3300015296|Ga0182157_1073607 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 558 | Open in IMG/M |
3300015298|Ga0182106_1044819 | Not Available | 647 | Open in IMG/M |
3300015298|Ga0182106_1055188 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 609 | Open in IMG/M |
3300015298|Ga0182106_1061940 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 588 | Open in IMG/M |
3300015298|Ga0182106_1063684 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 583 | Open in IMG/M |
3300015299|Ga0182107_1016342 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 864 | Open in IMG/M |
3300015299|Ga0182107_1018994 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 828 | Open in IMG/M |
3300015300|Ga0182108_1053025 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 623 | Open in IMG/M |
3300015302|Ga0182143_1025173 | Not Available | 763 | Open in IMG/M |
3300015302|Ga0182143_1062443 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 590 | Open in IMG/M |
3300015302|Ga0182143_1079507 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 547 | Open in IMG/M |
3300015302|Ga0182143_1101638 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 507 | Open in IMG/M |
3300015303|Ga0182123_1024627 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 746 | Open in IMG/M |
3300015303|Ga0182123_1055353 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 596 | Open in IMG/M |
3300015304|Ga0182112_1095782 | Not Available | 519 | Open in IMG/M |
3300015307|Ga0182144_1033904 | Not Available | 712 | Open in IMG/M |
3300015308|Ga0182142_1097219 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 531 | Open in IMG/M |
3300015314|Ga0182140_1044570 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 673 | Open in IMG/M |
3300015314|Ga0182140_1075211 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 576 | Open in IMG/M |
3300015314|Ga0182140_1087770 | Not Available | 549 | Open in IMG/M |
3300015321|Ga0182127_1065201 | Not Available | 618 | Open in IMG/M |
3300015321|Ga0182127_1102207 | Not Available | 536 | Open in IMG/M |
3300015322|Ga0182110_1024090 | Not Available | 824 | Open in IMG/M |
3300015322|Ga0182110_1052656 | Not Available | 657 | Open in IMG/M |
3300015322|Ga0182110_1115701 | Not Available | 514 | Open in IMG/M |
3300015322|Ga0182110_1123427 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 503 | Open in IMG/M |
3300015323|Ga0182129_1017561 | Not Available | 875 | Open in IMG/M |
3300015341|Ga0182187_1001826 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2168 | Open in IMG/M |
3300015341|Ga0182187_1109973 | Not Available | 625 | Open in IMG/M |
3300015341|Ga0182187_1133447 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 584 | Open in IMG/M |
3300015341|Ga0182187_1141811 | Not Available | 571 | Open in IMG/M |
3300015341|Ga0182187_1173554 | Not Available | 530 | Open in IMG/M |
3300015342|Ga0182109_1029931 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1034 | Open in IMG/M |
3300015342|Ga0182109_1067449 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 783 | Open in IMG/M |
3300015342|Ga0182109_1071340 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 767 | Open in IMG/M |
3300015342|Ga0182109_1076596 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 748 | Open in IMG/M |
3300015342|Ga0182109_1169107 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 559 | Open in IMG/M |
3300015343|Ga0182155_1005335 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1667 | Open in IMG/M |
3300015343|Ga0182155_1008464 | Not Available | 1469 | Open in IMG/M |
3300015343|Ga0182155_1072087 | Not Available | 757 | Open in IMG/M |
3300015343|Ga0182155_1147901 | Not Available | 588 | Open in IMG/M |
3300015343|Ga0182155_1168674 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 560 | Open in IMG/M |
3300015344|Ga0182189_1026890 | Not Available | 1072 | Open in IMG/M |
3300015344|Ga0182189_1045670 | Not Available | 900 | Open in IMG/M |
3300015344|Ga0182189_1156661 | Not Available | 582 | Open in IMG/M |
3300015344|Ga0182189_1219980 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 510 | Open in IMG/M |
3300015344|Ga0182189_1221866 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 508 | Open in IMG/M |
3300015345|Ga0182111_1052476 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 894 | Open in IMG/M |
3300015345|Ga0182111_1116070 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 670 | Open in IMG/M |
3300015345|Ga0182111_1146261 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 614 | Open in IMG/M |
3300015345|Ga0182111_1170512 | Not Available | 579 | Open in IMG/M |
3300015345|Ga0182111_1197388 | Not Available | 547 | Open in IMG/M |
3300015345|Ga0182111_1215026 | Not Available | 529 | Open in IMG/M |
3300015346|Ga0182139_1011945 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1440 | Open in IMG/M |
3300015346|Ga0182139_1076370 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 783 | Open in IMG/M |
3300015346|Ga0182139_1089009 | Not Available | 740 | Open in IMG/M |
3300015346|Ga0182139_1120528 | Not Available | 662 | Open in IMG/M |
3300015346|Ga0182139_1132572 | Not Available | 638 | Open in IMG/M |
3300015346|Ga0182139_1148261 | Not Available | 612 | Open in IMG/M |
3300015347|Ga0182177_1045010 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 949 | Open in IMG/M |
3300015347|Ga0182177_1091838 | Not Available | 734 | Open in IMG/M |
3300015347|Ga0182177_1130651 | Not Available | 644 | Open in IMG/M |
3300015347|Ga0182177_1154139 | Not Available | 605 | Open in IMG/M |
3300015347|Ga0182177_1154906 | Not Available | 604 | Open in IMG/M |
3300015351|Ga0182161_1005479 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1933 | Open in IMG/M |
3300015351|Ga0182161_1055778 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 923 | Open in IMG/M |
3300015351|Ga0182161_1059938 | Not Available | 899 | Open in IMG/M |
3300015351|Ga0182161_1124788 | Not Available | 681 | Open in IMG/M |
3300015351|Ga0182161_1197416 | Not Available | 568 | Open in IMG/M |
3300015351|Ga0182161_1205529 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 559 | Open in IMG/M |
3300015355|Ga0182159_1020162 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales | 1543 | Open in IMG/M |
3300015355|Ga0182159_1032245 | Not Available | 1318 | Open in IMG/M |
3300015355|Ga0182159_1039194 | Not Available | 1229 | Open in IMG/M |
3300015355|Ga0182159_1086006 | Not Available | 912 | Open in IMG/M |
3300015355|Ga0182159_1094223 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 879 | Open in IMG/M |
3300015355|Ga0182159_1168146 | Not Available | 692 | Open in IMG/M |
3300015355|Ga0182159_1223272 | Not Available | 613 | Open in IMG/M |
3300015355|Ga0182159_1235863 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 599 | Open in IMG/M |
3300015355|Ga0182159_1274729 | Not Available | 560 | Open in IMG/M |
3300015355|Ga0182159_1275762 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 559 | Open in IMG/M |
3300015355|Ga0182159_1322977 | Not Available | 521 | Open in IMG/M |
3300015361|Ga0182145_1015837 | Not Available | 1119 | Open in IMG/M |
3300015361|Ga0182145_1024904 | Not Available | 979 | Open in IMG/M |
3300015361|Ga0182145_1040440 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 844 | Open in IMG/M |
3300015361|Ga0182145_1064566 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 727 | Open in IMG/M |
3300015361|Ga0182145_1080702 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 675 | Open in IMG/M |
3300015361|Ga0182145_1121354 | Not Available | 589 | Open in IMG/M |
3300015361|Ga0182145_1133785 | Not Available | 570 | Open in IMG/M |
3300015361|Ga0182145_1182193 | Not Available | 514 | Open in IMG/M |
3300017404|Ga0182203_1116923 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 563 | Open in IMG/M |
3300017407|Ga0182220_1020153 | Not Available | 796 | Open in IMG/M |
3300017409|Ga0182204_1079565 | Not Available | 571 | Open in IMG/M |
3300017409|Ga0182204_1096640 | Not Available | 538 | Open in IMG/M |
3300017410|Ga0182207_1063228 | Not Available | 708 | Open in IMG/M |
3300017410|Ga0182207_1136373 | Not Available | 550 | Open in IMG/M |
3300017410|Ga0182207_1167513 | Not Available | 511 | Open in IMG/M |
3300017411|Ga0182208_1008330 | Not Available | 1133 | Open in IMG/M |
3300017411|Ga0182208_1017902 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 910 | Open in IMG/M |
3300017411|Ga0182208_1025282 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 823 | Open in IMG/M |
3300017411|Ga0182208_1099309 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 547 | Open in IMG/M |
3300017415|Ga0182202_1110566 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 542 | Open in IMG/M |
3300017424|Ga0182219_1102971 | Not Available | 555 | Open in IMG/M |
3300017425|Ga0182224_1017041 | Not Available | 1008 | Open in IMG/M |
3300017425|Ga0182224_1082599 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 629 | Open in IMG/M |
3300017425|Ga0182224_1120497 | Not Available | 558 | Open in IMG/M |
3300017425|Ga0182224_1139788 | Not Available | 531 | Open in IMG/M |
3300017427|Ga0182190_1011613 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1203 | Open in IMG/M |
3300017427|Ga0182190_1131622 | Not Available | 544 | Open in IMG/M |
3300017430|Ga0182192_1015312 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1135 | Open in IMG/M |
3300017430|Ga0182192_1061188 | Not Available | 720 | Open in IMG/M |
3300017430|Ga0182192_1090883 | Not Available | 629 | Open in IMG/M |
3300017433|Ga0182206_1035491 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 805 | Open in IMG/M |
3300017433|Ga0182206_1101370 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 581 | Open in IMG/M |
3300017433|Ga0182206_1104395 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 576 | Open in IMG/M |
3300017436|Ga0182209_1049637 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 749 | Open in IMG/M |
3300017436|Ga0182209_1055875 | Not Available | 722 | Open in IMG/M |
3300017436|Ga0182209_1128191 | Not Available | 556 | Open in IMG/M |
3300017436|Ga0182209_1149552 | Not Available | 528 | Open in IMG/M |
3300017436|Ga0182209_1166896 | Not Available | 509 | Open in IMG/M |
3300017438|Ga0182191_1049610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 775 | Open in IMG/M |
3300017438|Ga0182191_1091832 | Not Available | 634 | Open in IMG/M |
3300017442|Ga0182221_1044840 | Not Available | 758 | Open in IMG/M |
3300017443|Ga0182193_1010390 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1267 | Open in IMG/M |
3300017443|Ga0182193_1019581 | Not Available | 1061 | Open in IMG/M |
3300017443|Ga0182193_1021618 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1031 | Open in IMG/M |
3300017443|Ga0182193_1025687 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 979 | Open in IMG/M |
3300017683|Ga0182218_1010467 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales | 1103 | Open in IMG/M |
3300017683|Ga0182218_1054834 | Not Available | 689 | Open in IMG/M |
3300017683|Ga0182218_1065815 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 653 | Open in IMG/M |
3300017683|Ga0182218_1099789 | Not Available | 575 | Open in IMG/M |
3300017683|Ga0182218_1148657 | Not Available | 508 | Open in IMG/M |
3300017684|Ga0182225_1102851 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 559 | Open in IMG/M |
3300017684|Ga0182225_1124490 | Not Available | 527 | Open in IMG/M |
3300017684|Ga0182225_1133453 | Not Available | 515 | Open in IMG/M |
3300017685|Ga0182227_1045582 | Not Available | 773 | Open in IMG/M |
3300017685|Ga0182227_1094960 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 575 | Open in IMG/M |
3300017685|Ga0182227_1111906 | Not Available | 541 | Open in IMG/M |
3300017690|Ga0182223_1063775 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 606 | Open in IMG/M |
3300017690|Ga0182223_1105120 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 527 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 98.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068866_114469331 | 3300005718 | Miscanthus Rhizosphere | ACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKQIG* |
Ga0157378_132587762 | 3300013297 | Miscanthus Rhizosphere | ILRTYWMVKRYSACSVGWFVLLLVREEVLLAGLCERKILFRLEIYDRLR* |
Ga0182122_10280271 | 3300015267 | Miscanthus Phyllosphere | ACSVGWFVSLLIREEVLLAGLRERKIMFWLKIYDRLRQATAKRTG* |
Ga0182122_10342241 | 3300015267 | Miscanthus Phyllosphere | MCLFDEWQSACSFGWFVSLLVREDVLLAGLCEKKILFWLKIYNHLRQATAKQTG* |
Ga0182122_10561571 | 3300015267 | Miscanthus Phyllosphere | VDPVRCLGWFVSLLVYEEILLAGLCERKILFRLEIYDRLRQATAKRTG |
Ga0182113_10010892 | 3300015269 | Miscanthus Phyllosphere | SLLVHEEVLLAGLYKRKLLFRLEIYDRLRQATAKRTGC* |
Ga0182113_10031471 | 3300015269 | Miscanthus Phyllosphere | TWRQSACSVGWFVSLLIREEVLLTDLCERKILFRLEISDRLRQATAKRTG* |
Ga0182113_10128751 | 3300015269 | Miscanthus Phyllosphere | CSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTGGVSTSLQVSF* |
Ga0182113_10921621 | 3300015269 | Miscanthus Phyllosphere | VGWFVSLLVREEVLLAGLCKRKILFWLKIYDHLRQATAKLTGCVA* |
Ga0182188_10065182 | 3300015274 | Miscanthus Phyllosphere | MSFLACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLQQATSKRTG* |
Ga0182188_10470662 | 3300015274 | Miscanthus Phyllosphere | SACSVDWFVSLLVREEVLLAGLCEGKILFQLKIYDRLR* |
Ga0182128_10394391 | 3300015277 | Miscanthus Phyllosphere | MAFVSLLVREEILLAGLCKRKILFWLEIYDRLRQATAKQTD* |
Ga0182128_10489221 | 3300015277 | Miscanthus Phyllosphere | MLKHTACSFGWFISLLVREEVLLAGLCERKILFRLEIYDRLRQ |
Ga0182124_10001614 | 3300015282 | Miscanthus Phyllosphere | LLVCEEVLLVGLCEKKILFRLKIYDRLRQATTKRTGCMTL* |
Ga0182156_10726911 | 3300015283 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLAGLCERKILFWLEIYDRLQHATAKRTG* |
Ga0182186_10809601 | 3300015285 | Miscanthus Phyllosphere | MYAACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG* |
Ga0182176_10233171 | 3300015286 | Miscanthus Phyllosphere | MACSVGWFVSLLVRKEVLLAGLCEKKILFRLEIYDRLRQV |
Ga0182171_10374111 | 3300015287 | Miscanthus Phyllosphere | SVGWFVSLLVRKEVLLAGLCERKILFRLEIYDRLRQVTAKRTG* |
Ga0182138_10061242 | 3300015289 | Miscanthus Phyllosphere | MEERHAVCSVGWFVSLLVHEEVLLADLCERKILFWLEIYDRLRQATAKRTG |
Ga0182138_10834591 | 3300015289 | Miscanthus Phyllosphere | DGWFVSLLVREEVRLSGLCKRQILFRLEIYDHLRQATAKRTDYK* |
Ga0182126_10064371 | 3300015294 | Miscanthus Phyllosphere | SACLVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAKRTCCFDIV* |
Ga0182126_10879902 | 3300015294 | Miscanthus Phyllosphere | DDLHTACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLQQATAKRTG* |
Ga0182126_10890241 | 3300015294 | Miscanthus Phyllosphere | MHRIHLNQQSACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQA |
Ga0182175_10882711 | 3300015295 | Miscanthus Phyllosphere | QSQRSARSVGWFVLLLVHEEILLADLCERKILFQLKIHDCLRQITAKRTG* |
Ga0182157_10736071 | 3300015296 | Miscanthus Phyllosphere | LLGWFVSSLVRKKILLAGLCERKILFRLEIYDRLRQATAKRTG* |
Ga0182106_10178581 | 3300015298 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLTDLCERKILFRLEISDRLRQATAKRTG* |
Ga0182106_10448191 | 3300015298 | Miscanthus Phyllosphere | FVLLLVRKEVLLAGLYERKILFQLKIYDRIRQAQAKRTGYRFF* |
Ga0182106_10551881 | 3300015298 | Miscanthus Phyllosphere | VPTTPTACSVGWFVLSLVREEVLLAGLYERKILFRLEIYDRLQQAMAK* |
Ga0182106_10619401 | 3300015298 | Miscanthus Phyllosphere | MQKSACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAKRTG |
Ga0182106_10636841 | 3300015298 | Miscanthus Phyllosphere | SSSACSVGWFISLLVREEVLLAGLCERKILFRLEIYDRLRQVTVKRTG* |
Ga0182106_10889511 | 3300015298 | Miscanthus Phyllosphere | VPPPLVDPVRCLGWFVSLLGREEILLADLCERKILFQLKIYDRLREAMAKRTG* |
Ga0182107_10163422 | 3300015299 | Miscanthus Phyllosphere | SVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQDTAKRTG* |
Ga0182107_10189942 | 3300015299 | Miscanthus Phyllosphere | VGWFVSLLVREEVLLAGLCERKILFRLEIFDRLRQATAKRTG* |
Ga0182108_10530251 | 3300015300 | Miscanthus Phyllosphere | WFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG* |
Ga0182143_10251731 | 3300015302 | Miscanthus Phyllosphere | LLLFSVCSVGWFVLLLVREEQLLAGLCERKILFRLKIYDRLRQATAKRTGC |
Ga0182143_10624431 | 3300015302 | Miscanthus Phyllosphere | SLLVREEVLLAGLCERKILFRLEIYDRLRQATAKQIG* |
Ga0182143_10795071 | 3300015302 | Miscanthus Phyllosphere | VCSVGWFVSLLVREEVLLADLRERKILFRLEIYDCLRQATAKRTD* |
Ga0182143_11016381 | 3300015302 | Miscanthus Phyllosphere | SLLVREEVLLAGLCERKILFRLEIYDRLRQATAKPTG* |
Ga0182123_10246272 | 3300015303 | Miscanthus Phyllosphere | WFVSLLVREEVLLAGLCERKTLFRLEIYDRLRQATAKRTG* |
Ga0182123_10553531 | 3300015303 | Miscanthus Phyllosphere | VSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG* |
Ga0182112_10957821 | 3300015304 | Miscanthus Phyllosphere | MDSRQTYAACSVGWFVSLLVREEVLLADLCEKKILIQLEIYDRLRRAT |
Ga0182158_10463551 | 3300015305 | Miscanthus Phyllosphere | CSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAKRTG* |
Ga0182144_10339041 | 3300015307 | Miscanthus Phyllosphere | MKLACSVGWFVSLLVREEVLLAGLCERKILFWLKIYDRLRQATAKQTGYG* |
Ga0182142_10972192 | 3300015308 | Miscanthus Phyllosphere | CSVGWFISLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG* |
Ga0182140_10445701 | 3300015314 | Miscanthus Phyllosphere | CISKLPIACSVGWFVSLLVREEVLLVGMCERKILFRLEIYDRLRQATAKRTGC* |
Ga0182140_10752112 | 3300015314 | Miscanthus Phyllosphere | SVGWFISLLVREEVLLAGLCERKILFRLEIYDRLRQATVKRTD* |
Ga0182140_10877702 | 3300015314 | Miscanthus Phyllosphere | SVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTGC* |
Ga0182140_11165581 | 3300015314 | Miscanthus Phyllosphere | AACSVGWFISLLVCEEVLLADLCERKILFRLKIYDRLR* |
Ga0182127_10652011 | 3300015321 | Miscanthus Phyllosphere | SACSVGWFVSLLIREEVLLADLCERKILFWLKIYDRLRQTTAK* |
Ga0182127_11022071 | 3300015321 | Miscanthus Phyllosphere | VGWFVSLLVCEEVLLAGLYERKILFQLKIYDHLRQATAKLTGCVA* |
Ga0182110_10240903 | 3300015322 | Miscanthus Phyllosphere | QLRAYAACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAKRTG* |
Ga0182110_10526561 | 3300015322 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLVGLCERKILFRLKIYDRLR* |
Ga0182110_11157012 | 3300015322 | Miscanthus Phyllosphere | VGRFVSLLVREEVLLADLCERKIPFQLEIYDRLRQATAKQTGYCV* |
Ga0182110_11234271 | 3300015322 | Miscanthus Phyllosphere | HTACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG* |
Ga0182129_10175611 | 3300015323 | Miscanthus Phyllosphere | SSACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAKRTDCNRM* |
Ga0182187_10018264 | 3300015341 | Miscanthus Phyllosphere | DWFVSLLVREEVLLAGLRERKILFRLKIYDRLRQATAKRTGGRG* |
Ga0182187_11099731 | 3300015341 | Miscanthus Phyllosphere | YEATACSVGWFISWLIRAKVLLARLCERKILFQLKIYDHLRRATAKRNML* |
Ga0182187_11334472 | 3300015341 | Miscanthus Phyllosphere | CSVGWFVSLLVRKEVLLAGLCERKILFQLEIYDRLRQAIAKRTG* |
Ga0182187_11418111 | 3300015341 | Miscanthus Phyllosphere | LLRANNTACSVGWFVTLLVHEEVLLAGLCERKIFFRLKIYYHLRQATAKRTG* |
Ga0182187_11735542 | 3300015341 | Miscanthus Phyllosphere | SVGWFVSLLVREEVLLAGLYERKILFWLKIYDRLRQATTKRTC* |
Ga0182109_10299311 | 3300015342 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLAGLCERKIPFRLEIYDRLRQATGPTG* |
Ga0182109_10674491 | 3300015342 | Miscanthus Phyllosphere | MTAYHTACSVGWFVSLLVREEVLLPGLCMRKILFRLKIYDRLRQATAKRTG |
Ga0182109_10713402 | 3300015342 | Miscanthus Phyllosphere | CSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRSD* |
Ga0182109_10765961 | 3300015342 | Miscanthus Phyllosphere | SACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATSKRTG* |
Ga0182109_11691071 | 3300015342 | Miscanthus Phyllosphere | VNRLQSACSFGWFVSLLVHEEILLSGLCERKILSRLEIYDRLRQATAKQTG* |
Ga0182155_10053352 | 3300015343 | Miscanthus Phyllosphere | FVSLLVREEVLLADLCERKIPFQLEIYDRLRQATAKQTGYILVGQHPVQ* |
Ga0182155_10084641 | 3300015343 | Miscanthus Phyllosphere | SVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQPTTKRTG* |
Ga0182155_10720871 | 3300015343 | Miscanthus Phyllosphere | HQPQSACSVGWFVSLLIRKEVLLAGLCERKILFWLKIYDRLRHVTAKRTG* |
Ga0182155_11411703 | 3300015343 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDQLR* |
Ga0182155_11479012 | 3300015343 | Miscanthus Phyllosphere | VSLLVREEVLLAGLCERKILFWLEIYDRLRQATAKQTG* |
Ga0182155_11686742 | 3300015343 | Miscanthus Phyllosphere | MSAYSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAK |
Ga0182189_10268902 | 3300015344 | Miscanthus Phyllosphere | DRRNGVLGWFVSSLVREKVLLVSLRERKILFRLKIYDRLRQAIVKRTG* |
Ga0182189_10456701 | 3300015344 | Miscanthus Phyllosphere | AYSVGWFVSLLVREEVLLADLYEREILFRLKIYDHLRQATTKRTGCKK* |
Ga0182189_10775041 | 3300015344 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLAGLCERKILFQLKIYDRLR* |
Ga0182189_11566611 | 3300015344 | Miscanthus Phyllosphere | DKTWPSACSVGWFVSLLVREEILLAGLCERKILFRLKIYDRLRQATAKRTG* |
Ga0182189_12199802 | 3300015344 | Miscanthus Phyllosphere | SVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTGCLECLY* |
Ga0182189_12218661 | 3300015344 | Miscanthus Phyllosphere | MPLKLACSVGWFVSLLVREEVLLAGLCERKILFWLEIYDRLRQATAKRTG* |
Ga0182111_10323012 | 3300015345 | Miscanthus Phyllosphere | LVREEVLLASLCERKILFQLEIYDRLRQATAKQTG* |
Ga0182111_10524763 | 3300015345 | Miscanthus Phyllosphere | MGVNLALACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRIRQAQAKR |
Ga0182111_10767641 | 3300015345 | Miscanthus Phyllosphere | ACSVGWFVSLLVREKVPLADLCEREILFRLEIYDRLRQATAKRTG* |
Ga0182111_11160701 | 3300015345 | Miscanthus Phyllosphere | GWFVSLLVHEEILLSGLCERKILSRLEIYDRLRQATAKQTG* |
Ga0182111_11462611 | 3300015345 | Miscanthus Phyllosphere | TACSVGWFVSLLVREEVPLVGLCERKILLRLEIYDRLRQATAKRAAK* |
Ga0182111_11705121 | 3300015345 | Miscanthus Phyllosphere | CLVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG* |
Ga0182111_11973881 | 3300015345 | Miscanthus Phyllosphere | SVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATTKRTGIHPLQGSL* |
Ga0182111_12150261 | 3300015345 | Miscanthus Phyllosphere | AACSVGWFVSLLVREEVPLAGLCKIKILFRLEIYDRLRQATANVSFVTRL* |
Ga0182139_10119451 | 3300015346 | Miscanthus Phyllosphere | GWFISLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTEQ* |
Ga0182139_10763702 | 3300015346 | Miscanthus Phyllosphere | LACSVDWFISLLVREEVLLAGLCERKIPFRLEIYDCLRQATAKRTG* |
Ga0182139_10890091 | 3300015346 | Miscanthus Phyllosphere | CSVGWFVSLLVRKEVLLAGLCERKKLFRLKIYDRLRQATGKRTDYL* |
Ga0182139_11205281 | 3300015346 | Miscanthus Phyllosphere | WFVSLLVREEVLLADLYERKILFRLKIYDHLRQAIVKRTGC* |
Ga0182139_11325721 | 3300015346 | Miscanthus Phyllosphere | MYWLKTLNHHQSACSVGWFVSLLVRKEVLLTGLCERKILFRLKIYDRLRQATAK |
Ga0182139_11482612 | 3300015346 | Miscanthus Phyllosphere | ACSACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLR* |
Ga0182139_11561122 | 3300015346 | Miscanthus Phyllosphere | SLLVREEVLLAGLCERKILFRLKIYDRLRQATAKQTGF* |
Ga0182177_10450101 | 3300015347 | Miscanthus Phyllosphere | LDWIQLDVKTSACSVGWFVSLLVCEEVLLADLCERKILFRLEIYDRLRQATAKRTG* |
Ga0182177_10918382 | 3300015347 | Miscanthus Phyllosphere | MAARKSSQQTAYSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAK |
Ga0182177_11306512 | 3300015347 | Miscanthus Phyllosphere | ACSVGWFISLLVREEVLLAGLCERKILFRLEIYDRLR* |
Ga0182177_11541391 | 3300015347 | Miscanthus Phyllosphere | GAACSVGWFVSLLVREEVRLAGLCERKILFRLKIYDRLRQATAKRTG* |
Ga0182177_11549062 | 3300015347 | Miscanthus Phyllosphere | MLQDGRGIACSVGWFVSLLVHEEVRLAGLCERKILFQLKIYDRLRQATAKRTG |
Ga0182161_10054792 | 3300015351 | Miscanthus Phyllosphere | MRKNKQPVRSLLVREEVLLADLCERKILFQLEIYDRLRRATVKRTG* |
Ga0182161_10557781 | 3300015351 | Miscanthus Phyllosphere | AACSVGWFVSLLVREEVLLAGLCERKILFRLKIYYRIRQAQAKRI* |
Ga0182161_10599382 | 3300015351 | Miscanthus Phyllosphere | FVSLLVRKEVLLAGLCERKILIRLKIYDHLRQAIAKRTG* |
Ga0182161_11247882 | 3300015351 | Miscanthus Phyllosphere | AACSAGWFVSLLVREKVLLIGLCERKILFQLEIYYRLRQATAKRT* |
Ga0182161_11974161 | 3300015351 | Miscanthus Phyllosphere | MKYCHRIIGSLSVCSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRL |
Ga0182161_12055291 | 3300015351 | Miscanthus Phyllosphere | MFDQIAKLSVCSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAK |
Ga0182159_10201625 | 3300015355 | Miscanthus Phyllosphere | DIRQQSTACSVGWFVSLLVREEVPLVGLCERKILLRLEIYDRLRQATAKRAAK* |
Ga0182159_10322451 | 3300015355 | Miscanthus Phyllosphere | ACSVGWFVSLLVHEEVLLAGLCERKILFRLKIYDHLQATAKRTGCV* |
Ga0182159_10391942 | 3300015355 | Miscanthus Phyllosphere | VRWYLACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAKRTG* |
Ga0182159_10860061 | 3300015355 | Miscanthus Phyllosphere | LVGWFVSLLVHKEVLLAGLCEEKILFWLKIYDRLRQATAKRTG |
Ga0182159_10942233 | 3300015355 | Miscanthus Phyllosphere | SVGWFVLLLVREEVLLAGLCERKIPFRLKIYDRLRQATAKRTG* |
Ga0182159_11681462 | 3300015355 | Miscanthus Phyllosphere | CSVGWFVSLLVREEVLLAGLYERKILFQLKIYDRIRQAQAKRTGYRFF* |
Ga0182159_12232721 | 3300015355 | Miscanthus Phyllosphere | AYSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAKRIGCIV* |
Ga0182159_12358631 | 3300015355 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLASLCERKILFQLEIYDRLRQATAKQTG* |
Ga0182159_12747291 | 3300015355 | Miscanthus Phyllosphere | APTACSVGWFVLLLLREEILLTSLRERKILFQLKIYDRLRRATAKRTG* |
Ga0182159_12757621 | 3300015355 | Miscanthus Phyllosphere | MACSVGWFISLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG |
Ga0182159_13229771 | 3300015355 | Miscanthus Phyllosphere | SKLAACSVGWFISLPVREEVLLANLYERKILFQLKIYDRLRQAIAKRTGY* |
Ga0182145_10083851 | 3300015361 | Miscanthus Phyllosphere | RQSACSVGWFVSLLVREEVLLTDLCERKILFRLEISDRLRQATAKRTG* |
Ga0182145_10158372 | 3300015361 | Miscanthus Phyllosphere | SVGWFVSLLVREEVLLAGLCERKILFWLKIYDRLRQATAKRPC* |
Ga0182145_10212873 | 3300015361 | Miscanthus Phyllosphere | GWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATTKRTGLAFKC* |
Ga0182145_10249042 | 3300015361 | Miscanthus Phyllosphere | WFVSLLVREEVLLASLCERKILFQLKIYDRLRQATAKRTGCMTLSSC* |
Ga0182145_10404402 | 3300015361 | Miscanthus Phyllosphere | LAINKAACSVGWFVSLLVREEVLLAGLCERKILFWLEIYDRLRQATA |
Ga0182145_10645661 | 3300015361 | Miscanthus Phyllosphere | LFVGWFVSLLVREEVLLTGLIERKILFQLEIYDHLRQATAKRYCSA* |
Ga0182145_10807021 | 3300015361 | Miscanthus Phyllosphere | SACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATVKRTD* |
Ga0182145_11213541 | 3300015361 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLAGLYERKILFRLKIYDRLRQTTAKRTSSIS* |
Ga0182145_11337851 | 3300015361 | Miscanthus Phyllosphere | SACSVGWFVSLLVREEVLLAGLCERKIMFRLKIYDRLRQATAKQTGCWIKYVE* |
Ga0182145_11821931 | 3300015361 | Miscanthus Phyllosphere | MRRPTACSVGWFISLLVREEVLLTDLCERKILFRLEIYDRIR |
Ga0182203_11169231 | 3300017404 | Miscanthus Phyllosphere | WFISLLVREKVLLAGLCERKILFRLEIYDRLRQATVKRTG |
Ga0182220_10201533 | 3300017407 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLADLCERKILFWLEIYNHLQHATAKRTG |
Ga0182220_10704981 | 3300017407 | Miscanthus Phyllosphere | AACSVGWFVSLLVREEVLLAGLCERKTLFQLKIYDRLR |
Ga0182220_10843271 | 3300017407 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLADLHERKILFRLEIYDRLRQATAKRTGC |
Ga0182204_10514861 | 3300017409 | Miscanthus Phyllosphere | VGWFVSLLVREEVLLAGLYERKILFWLKIYDRLRQATTKRTC |
Ga0182204_10795651 | 3300017409 | Miscanthus Phyllosphere | AGWFVSLLVREKVLLIGLCERKILFQLEIYYRLRQATAKRT |
Ga0182204_10966401 | 3300017409 | Miscanthus Phyllosphere | MVTCYTSVCSVGWFKSLLVREEILLAGLCERKILFRLKIYDRLRQATAK |
Ga0182204_10987851 | 3300017409 | Miscanthus Phyllosphere | CSVGRFILLLVREEVLLADLCERKILFRLEIYDRLRQVTAKRTG |
Ga0182207_10632282 | 3300017410 | Miscanthus Phyllosphere | PMEQHCSVGWFVSLLVREEVLLAGLCERKILFRLKIYDHLRQATAKRTG |
Ga0182207_11363731 | 3300017410 | Miscanthus Phyllosphere | MDHVKWWESACSVGRFVSLLVREEVLLADLCERKILFWLKIYDRLRQATAK |
Ga0182207_11675131 | 3300017410 | Miscanthus Phyllosphere | SVGWFVLLLVREEVLLTGLCEKKILFQLKIYDRLRQATAKQTGCMSL |
Ga0182208_10023402 | 3300017411 | Miscanthus Phyllosphere | VGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRG |
Ga0182208_10083301 | 3300017411 | Miscanthus Phyllosphere | MAARKSSQQTAYSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQATAKRTG |
Ga0182208_10179021 | 3300017411 | Miscanthus Phyllosphere | MPLKLACSVGWFVSLLVREEVLLAGLCERKILFWLEIYDRLRQATAK |
Ga0182208_10252821 | 3300017411 | Miscanthus Phyllosphere | VGWFVSLLVREKVLLAGLCERKILFRLEIYDRLRQATAKQIG |
Ga0182208_10993091 | 3300017411 | Miscanthus Phyllosphere | SLLVREEVLLAGLCERKILFRLEIYDRLRQATAKQIG |
Ga0182202_11105661 | 3300017415 | Miscanthus Phyllosphere | CSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTGC |
Ga0182228_11199121 | 3300017420 | Miscanthus Phyllosphere | LLVREEVLLTDLCERKILFRLEISDRLRQATAKRTG |
Ga0182219_11029711 | 3300017424 | Miscanthus Phyllosphere | KQLAACSVGWFVSLLVREEVLLVGLYERKIMFRLEIYDRLRQATAKRTG |
Ga0182224_10170411 | 3300017425 | Miscanthus Phyllosphere | MVNPLSACSVGWFVSLLVREEVLLVDLCEKKILFRLKIYDRLRQATAKRTG |
Ga0182224_10825991 | 3300017425 | Miscanthus Phyllosphere | VNISDPSACSVGWFVSLLVRDEVLLADLCERKILFRLEIYDRLRQAT |
Ga0182224_11204971 | 3300017425 | Miscanthus Phyllosphere | HTAYSVGWFVSLLVREEVLLAGLCERKILFWLKIYDRIQQTQAKRTG |
Ga0182224_11397881 | 3300017425 | Miscanthus Phyllosphere | WFVSLLVREEVLLAGLCERKILFWLKIYDRLATAKRTG |
Ga0182190_10116132 | 3300017427 | Miscanthus Phyllosphere | SACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDHLRQATAKRTGCLIINF |
Ga0182190_11316222 | 3300017427 | Miscanthus Phyllosphere | FISLLVREEVLLAGLCEGKILFWLKIYDRLRQSTAKRTG |
Ga0182192_10153122 | 3300017430 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG |
Ga0182192_10611881 | 3300017430 | Miscanthus Phyllosphere | MEIVAVVCYQSACSVGWFVSLLVREEVLLADLCERKILFWLKIYDRLRQATAKRTG |
Ga0182192_10908832 | 3300017430 | Miscanthus Phyllosphere | FCALVASMDCSVGWFVSLLIREEVLLAGLYERKILFRLKIYDRLQQATAKRTG |
Ga0182206_10354911 | 3300017433 | Miscanthus Phyllosphere | CSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTGCRALA |
Ga0182206_11013701 | 3300017433 | Miscanthus Phyllosphere | SACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDCLRQATAKRTGCLT |
Ga0182206_11043952 | 3300017433 | Miscanthus Phyllosphere | NKGLYTAYSVGWVVSLLVCEEILLAGLCERKILFRLEIYDRLRQATAKRTG |
Ga0182209_10263701 | 3300017436 | Miscanthus Phyllosphere | GWFVLLLVREEVLLADLCKRKILFWLEIYDRLRQATAKRTGLRCI |
Ga0182209_10496373 | 3300017436 | Miscanthus Phyllosphere | GWFVSLLVREEVLLAGLCERKILFWLKIYDRLRQAMAKRTG |
Ga0182209_10558751 | 3300017436 | Miscanthus Phyllosphere | SSTQTYTACSVGWFVSLLVREEVLLVGLCERKILFRLKIYDRLR |
Ga0182209_11281911 | 3300017436 | Miscanthus Phyllosphere | ACSVGWFVSLLVREKVLLAGLCERKILFRLKIYDRLRQATAKRTG |
Ga0182209_11495522 | 3300017436 | Miscanthus Phyllosphere | MCSDPACSVDWFVSLLVHEEVLLDGLGEKKILFRLEIYDRLRQATPKR |
Ga0182209_11668961 | 3300017436 | Miscanthus Phyllosphere | ACSVGWFVLLLVREEVLLAGFCEKKILFQLKIYDRLRQATSKRTGCSLEESNN |
Ga0182191_10032591 | 3300017438 | Miscanthus Phyllosphere | SACSVGWFVSLLVRKEVLLAGLCERKILFQLEIYDRLR |
Ga0182191_10496102 | 3300017438 | Miscanthus Phyllosphere | MDPDHYYSACSVRWFVSLLVLEEVLLAGLCERKILFRLKIYDRLRQATAKRTG |
Ga0182191_10918321 | 3300017438 | Miscanthus Phyllosphere | FISLLVHEEVLLADLCERKILFRLKIYNRLRQATAKQTGY |
Ga0182221_10448401 | 3300017442 | Miscanthus Phyllosphere | TACSVGWFVSLLVREEVLLIGLCERKILFRLKIYDRLRRATAERTGCQK |
Ga0182193_10103901 | 3300017443 | Miscanthus Phyllosphere | SLLVREEVLLASLCERKIPFWLEIYDRLRQVTAKRTGYRALSCS |
Ga0182193_10133451 | 3300017443 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLTDLCERKILFRLEISDRLRQATAKRTG |
Ga0182193_10195812 | 3300017443 | Miscanthus Phyllosphere | MKLACSVGWFVSLLVREEVLLAGLCERKILFWLKIYDRLRQATAKQ |
Ga0182193_10216181 | 3300017443 | Miscanthus Phyllosphere | GWFVSLLVREEVLLAGLCERKILFRMEIYDRLRQATAK |
Ga0182193_10256872 | 3300017443 | Miscanthus Phyllosphere | CSVGWFVSLLVREEVLLASLCEGKILFRLEIYDRLRQATAKRTG |
Ga0182193_11815131 | 3300017443 | Miscanthus Phyllosphere | ACLVGWFVSLLVREKILLAGLCERKIIFRLEIYDRLR |
Ga0182218_10104671 | 3300017683 | Miscanthus Phyllosphere | LSACSVGWFVSLLVREEVLLVGLCERKILFQLKIYDRLRQATAKRAGCM |
Ga0182218_10548342 | 3300017683 | Miscanthus Phyllosphere | HIIACSFGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG |
Ga0182218_10658151 | 3300017683 | Miscanthus Phyllosphere | LSAGSVGWFVSLLVREEVLLAGLCERKIQFRLKIYDRLRQATAKQTGC |
Ga0182218_10997892 | 3300017683 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLADLCERKILFRLKIYDRLRQATAKRTG |
Ga0182218_11043151 | 3300017683 | Miscanthus Phyllosphere | MIACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQAT |
Ga0182218_11486572 | 3300017683 | Miscanthus Phyllosphere | ACSVGWFVSLLVREEVLLAGLCERKILFWLKIYDRLRQATAKRTG |
Ga0182225_11028511 | 3300017684 | Miscanthus Phyllosphere | LGQLIDSACSVGWFVSLLVHEEVLLAGLCERKILFRLEIYDRLRQATAKRTGCR |
Ga0182225_11244901 | 3300017684 | Miscanthus Phyllosphere | THSPCLVDWFISLLVREEVLLAGLCERKILFWLEIYDRLQQATDKQIG |
Ga0182225_11334531 | 3300017684 | Miscanthus Phyllosphere | HRIHLNQQSACSVGWFVSLLVREEVLLAGLCERKILFRLKIYDRLRQAKAKQTG |
Ga0182227_10455821 | 3300017685 | Miscanthus Phyllosphere | GREEHQQTVRLLVREEVLLAGLCERKILLRLKIYDRLRQATAKRTGC |
Ga0182227_10949602 | 3300017685 | Miscanthus Phyllosphere | VKAISYQSACSVGSFVSLLVREEVLLAGLYERKILFRLEIYDRLQQATAKRT |
Ga0182227_11119063 | 3300017685 | Miscanthus Phyllosphere | WFVSLLVREEVLLVGLCERKILFRLEIYDRLRQATAKRTG |
Ga0182223_10487511 | 3300017690 | Miscanthus Phyllosphere | PTGTLACSVGWFVSLLVRQEILLAGLCESKILFQLEIYDRLRQATAKRTG |
Ga0182223_10637751 | 3300017690 | Miscanthus Phyllosphere | QSDGPSACSVRWFVSLLVREEVLLAGLCERKILFRLEIYDRLRQATAKRTG |
Ga0182223_11051203 | 3300017690 | Miscanthus Phyllosphere | TACSVGWFVSLLVREEVLLAGLCERKILFRLEIYDHLRQATAKRAGC |
⦗Top⦘ |