NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029826

Metagenome / Metatranscriptome Family F029826

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029826
Family Type Metagenome / Metatranscriptome
Number of Sequences 187
Average Sequence Length 41 residues
Representative Sequence MGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH
Number of Associated Samples 126
Number of Associated Scaffolds 187

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 85.48 %
% of genes near scaffold ends (potentially truncated) 23.53 %
% of genes from short scaffolds (< 2000 bps) 82.35 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.722 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(21.390 % of family members)
Environment Ontology (ENVO) Unclassified
(40.107 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.497 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.29%    β-sheet: 0.00%    Coil/Unstructured: 45.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 187 Family Scaffolds
PF03176MMPL 50.27
PF00005ABC_tran 32.62
PF13180PDZ_2 1.60
PF13551HTH_29 0.53
PF00106adh_short 0.53
PF02698DUF218 0.53
PF13847Methyltransf_31 0.53
PF10099RskA 0.53
PF09822ABC_transp_aux 0.53
PF02954HTH_8 0.53
PF07044DUF1329 0.53
PF14238DUF4340 0.53
PF06537DHOR 0.53
PF01546Peptidase_M20 0.53
PF12679ABC2_membrane_2 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 187 Family Scaffolds
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 50.27
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 50.27
COG1434Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 familyCell wall/membrane/envelope biogenesis [M] 0.53
COG2949Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycinCell wall/membrane/envelope biogenesis [M] 0.53
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.72 %
UnclassifiedrootN/A4.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002908|JGI25382J43887_10373106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria603Open in IMG/M
3300003152|Ga0052254_1167647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300004025|Ga0055433_10112071All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria630Open in IMG/M
3300004114|Ga0062593_100607612All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300004268|Ga0066398_10095376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M
3300005166|Ga0066674_10043876All Organisms → cellular organisms → Bacteria → Proteobacteria2004Open in IMG/M
3300005166|Ga0066674_10079170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1511Open in IMG/M
3300005166|Ga0066674_10566650All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005172|Ga0066683_10007523All Organisms → cellular organisms → Bacteria → Proteobacteria5495Open in IMG/M
3300005174|Ga0066680_10749331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria594Open in IMG/M
3300005174|Ga0066680_10878105All Organisms → cellular organisms → Bacteria → Proteobacteria533Open in IMG/M
3300005177|Ga0066690_10438861All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300005180|Ga0066685_10012152All Organisms → cellular organisms → Bacteria → Proteobacteria4880Open in IMG/M
3300005180|Ga0066685_10489251All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300005186|Ga0066676_10232108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1198Open in IMG/M
3300005332|Ga0066388_100587971All Organisms → cellular organisms → Bacteria → Proteobacteria1738Open in IMG/M
3300005332|Ga0066388_101880492All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300005332|Ga0066388_102566973All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300005345|Ga0070692_10951996All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300005437|Ga0070710_11535710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300005444|Ga0070694_100964618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium706Open in IMG/M
3300005444|Ga0070694_101745574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria530Open in IMG/M
3300005445|Ga0070708_100099479All Organisms → cellular organisms → Bacteria2661Open in IMG/M
3300005445|Ga0070708_100266452All Organisms → cellular organisms → Bacteria → Proteobacteria1611Open in IMG/M
3300005445|Ga0070708_101157888All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005446|Ga0066686_10328132All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1042Open in IMG/M
3300005446|Ga0066686_11023562Not Available535Open in IMG/M
3300005467|Ga0070706_100121370All Organisms → cellular organisms → Bacteria2436Open in IMG/M
3300005467|Ga0070706_100847938All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300005467|Ga0070706_100962198Not Available788Open in IMG/M
3300005524|Ga0070737_10002656All Organisms → cellular organisms → Bacteria20892Open in IMG/M
3300005529|Ga0070741_10000812All Organisms → cellular organisms → Bacteria104064Open in IMG/M
3300005529|Ga0070741_10003475All Organisms → cellular organisms → Bacteria39090Open in IMG/M
3300005529|Ga0070741_10069730All Organisms → cellular organisms → Bacteria3976Open in IMG/M
3300005533|Ga0070734_10000307All Organisms → cellular organisms → Bacteria116072Open in IMG/M
3300005536|Ga0070697_100176862All Organisms → cellular organisms → Bacteria → Proteobacteria1808Open in IMG/M
3300005536|Ga0070697_100837714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria815Open in IMG/M
3300005536|Ga0070697_101801221All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300005540|Ga0066697_10060272All Organisms → cellular organisms → Bacteria → Proteobacteria2166Open in IMG/M
3300005540|Ga0066697_10162062All Organisms → cellular organisms → Bacteria → Proteobacteria1323Open in IMG/M
3300005540|Ga0066697_10293283All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium957Open in IMG/M
3300005545|Ga0070695_100485070All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300005552|Ga0066701_10345174All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300005552|Ga0066701_10392573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium859Open in IMG/M
3300005555|Ga0066692_11017959All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300005557|Ga0066704_10876470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria556Open in IMG/M
3300005558|Ga0066698_10019904All Organisms → cellular organisms → Bacteria3908Open in IMG/M
3300005586|Ga0066691_10733242All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005598|Ga0066706_11015589All Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
3300005713|Ga0066905_100103533All Organisms → cellular organisms → Bacteria1940Open in IMG/M
3300005713|Ga0066905_101566188All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria602Open in IMG/M
3300005713|Ga0066905_102204501All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria514Open in IMG/M
3300005764|Ga0066903_100702871All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300005985|Ga0081539_10033693All Organisms → cellular organisms → Bacteria3113Open in IMG/M
3300006034|Ga0066656_10129274All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300006034|Ga0066656_10852893All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300006046|Ga0066652_100723995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium948Open in IMG/M
3300006175|Ga0070712_101374493All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria616Open in IMG/M
3300006755|Ga0079222_10339683All Organisms → cellular organisms → Bacteria → Proteobacteria1007Open in IMG/M
3300006755|Ga0079222_12533946Not Available515Open in IMG/M
3300006796|Ga0066665_10054018All Organisms → cellular organisms → Bacteria → Proteobacteria2781Open in IMG/M
3300006797|Ga0066659_10320659All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300006797|Ga0066659_10527870All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300006797|Ga0066659_11455799Not Available573Open in IMG/M
3300006844|Ga0075428_102479622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria531Open in IMG/M
3300006852|Ga0075433_10146145All Organisms → cellular organisms → Bacteria → Proteobacteria2102Open in IMG/M
3300006871|Ga0075434_101932089All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006904|Ga0075424_100021473All Organisms → cellular organisms → Bacteria → Proteobacteria6626Open in IMG/M
3300006914|Ga0075436_100865983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300007258|Ga0099793_10630627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria538Open in IMG/M
3300009012|Ga0066710_100328754All Organisms → cellular organisms → Bacteria2251Open in IMG/M
3300009012|Ga0066710_100860805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1393Open in IMG/M
3300009012|Ga0066710_100887893All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300009012|Ga0066710_102827525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300009038|Ga0099829_11394655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria579Open in IMG/M
3300009089|Ga0099828_10610953All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300009137|Ga0066709_100407863All Organisms → cellular organisms → Bacteria1887Open in IMG/M
3300009137|Ga0066709_100513370All Organisms → cellular organisms → Bacteria1690Open in IMG/M
3300009137|Ga0066709_100536053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1655Open in IMG/M
3300009137|Ga0066709_102642510All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300009137|Ga0066709_103395540All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300009137|Ga0066709_104139322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300009147|Ga0114129_12170902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria669Open in IMG/M
3300010046|Ga0126384_10233978All Organisms → cellular organisms → Bacteria → Proteobacteria1475Open in IMG/M
3300010046|Ga0126384_10732997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria879Open in IMG/M
3300010046|Ga0126384_10922087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium790Open in IMG/M
3300010047|Ga0126382_11179116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300010047|Ga0126382_12485270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300010140|Ga0127456_1017739All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria505Open in IMG/M
3300010303|Ga0134082_10501502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300010329|Ga0134111_10205489All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300010335|Ga0134063_10167785All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300010358|Ga0126370_12141825Not Available550Open in IMG/M
3300010362|Ga0126377_12237530All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR30623Open in IMG/M
3300010391|Ga0136847_10386122All Organisms → cellular organisms → Bacteria2155Open in IMG/M
3300010391|Ga0136847_11494592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium892Open in IMG/M
3300010391|Ga0136847_11578107All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300010391|Ga0136847_12523971All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria590Open in IMG/M
3300010391|Ga0136847_13089060All Organisms → cellular organisms → Bacteria → Proteobacteria1014Open in IMG/M
3300010397|Ga0134124_11360935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria735Open in IMG/M
3300010400|Ga0134122_10564611All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300010400|Ga0134122_11078285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria794Open in IMG/M
3300010400|Ga0134122_11080645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium793Open in IMG/M
3300011271|Ga0137393_10173595All Organisms → cellular organisms → Bacteria1810Open in IMG/M
3300011271|Ga0137393_11127315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300012203|Ga0137399_10739290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria828Open in IMG/M
3300012208|Ga0137376_10073093All Organisms → cellular organisms → Bacteria2858Open in IMG/M
3300012349|Ga0137387_10009146All Organisms → cellular organisms → Bacteria5740Open in IMG/M
3300012349|Ga0137387_10109546All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1934Open in IMG/M
3300012354|Ga0137366_10405768All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300012362|Ga0137361_10489256All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300012374|Ga0134039_1065233All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300012386|Ga0134046_1277099All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300012410|Ga0134060_1296714All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300012469|Ga0150984_111971691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria787Open in IMG/M
3300012685|Ga0137397_10299068All Organisms → cellular organisms → Bacteria1199Open in IMG/M
3300012922|Ga0137394_10340688All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300012922|Ga0137394_10925835Not Available727Open in IMG/M
3300012927|Ga0137416_11993607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300012930|Ga0137407_10095091All Organisms → cellular organisms → Bacteria → Proteobacteria2541Open in IMG/M
3300012930|Ga0137407_10860721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium857Open in IMG/M
3300012930|Ga0137407_11175380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria728Open in IMG/M
3300012948|Ga0126375_11101210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria654Open in IMG/M
3300012957|Ga0164303_11034157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria587Open in IMG/M
3300012971|Ga0126369_13574483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300012972|Ga0134077_10050760All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300014150|Ga0134081_10298689All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300015359|Ga0134085_10302752All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria703Open in IMG/M
3300015374|Ga0132255_101488393All Organisms → cellular organisms → Bacteria → Proteobacteria1024Open in IMG/M
3300017654|Ga0134069_1317747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300017947|Ga0187785_10610611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria561Open in IMG/M
3300017973|Ga0187780_10173313All Organisms → cellular organisms → Bacteria → Proteobacteria1500Open in IMG/M
3300018058|Ga0187766_10498062All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria820Open in IMG/M
3300018058|Ga0187766_11200630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300018431|Ga0066655_10042984All Organisms → cellular organisms → Bacteria2285Open in IMG/M
3300018431|Ga0066655_10194914All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300018431|Ga0066655_10296632All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300018431|Ga0066655_10462514All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium838Open in IMG/M
3300018431|Ga0066655_10652404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria712Open in IMG/M
3300018431|Ga0066655_10748758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300018433|Ga0066667_10008906All Organisms → cellular organisms → Bacteria → Proteobacteria4696Open in IMG/M
3300018433|Ga0066667_10821521All Organisms → cellular organisms → Bacteria → Proteobacteria792Open in IMG/M
3300018468|Ga0066662_12294456All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria567Open in IMG/M
3300018482|Ga0066669_12177918All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300019458|Ga0187892_10137170All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300022724|Ga0242665_10305523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria558Open in IMG/M
3300025324|Ga0209640_11388453All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300025910|Ga0207684_11677366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria513Open in IMG/M
3300025922|Ga0207646_10519485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1072Open in IMG/M
3300025922|Ga0207646_10826126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria824Open in IMG/M
3300026277|Ga0209350_1137244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria550Open in IMG/M
3300026297|Ga0209237_1245228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria550Open in IMG/M
3300026307|Ga0209469_1016454All Organisms → cellular organisms → Bacteria2659Open in IMG/M
3300026308|Ga0209265_1000247All Organisms → cellular organisms → Bacteria14245Open in IMG/M
3300026313|Ga0209761_1152711All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300026318|Ga0209471_1224935All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300026326|Ga0209801_1196036All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300026332|Ga0209803_1149424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium905Open in IMG/M
3300026332|Ga0209803_1231903All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria646Open in IMG/M
3300026334|Ga0209377_1174407All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria767Open in IMG/M
3300026335|Ga0209804_1194525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium856Open in IMG/M
3300026480|Ga0257177_1088750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria506Open in IMG/M
3300026524|Ga0209690_1068109All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300026532|Ga0209160_1229757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria642Open in IMG/M
3300026536|Ga0209058_1047764All Organisms → cellular organisms → Bacteria2467Open in IMG/M
3300027646|Ga0209466_1058193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium780Open in IMG/M
3300027671|Ga0209588_1037203All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300027706|Ga0209581_1011706All Organisms → cellular organisms → Bacteria → Proteobacteria5413Open in IMG/M
3300027826|Ga0209060_10001158All Organisms → cellular organisms → Bacteria31234Open in IMG/M
3300027875|Ga0209283_10959544Not Available513Open in IMG/M
3300028536|Ga0137415_10066961All Organisms → cellular organisms → Bacteria3457Open in IMG/M
3300031114|Ga0308187_10404014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria540Open in IMG/M
3300031720|Ga0307469_10678142All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300031720|Ga0307469_11032723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria769Open in IMG/M
3300031720|Ga0307469_12456933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300031740|Ga0307468_100366156All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300031949|Ga0214473_10211382All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300031949|Ga0214473_10409903All Organisms → cellular organisms → Bacteria1528Open in IMG/M
3300032001|Ga0306922_11284846All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria741Open in IMG/M
3300032180|Ga0307471_102737754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria626Open in IMG/M
3300032782|Ga0335082_10448791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1153Open in IMG/M
3300032829|Ga0335070_10101959All Organisms → cellular organisms → Bacteria3002Open in IMG/M
3300032893|Ga0335069_10025461All Organisms → cellular organisms → Bacteria → Proteobacteria8108Open in IMG/M
3300032893|Ga0335069_11808583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300033433|Ga0326726_10376553All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1344Open in IMG/M
3300033433|Ga0326726_11346724All Organisms → cellular organisms → Bacteria695Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil21.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil12.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment2.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.14%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.07%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.07%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.07%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.53%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.53%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.53%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.53%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300003152Freshwater sediment microbial communities from Loktak Lake, IndiaEnvironmentalOpen in IMG/M
3300004025Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012374Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25382J43887_1037310623300002908Grasslands SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARVGH*
Ga0052254_116764713300003152SedimentVTIPQMSLWESVIIVVVFSIFVVVADEYIHARRRRRHEREDTARRAH*
Ga0055433_1011207123300004025Natural And Restored WetlandsMTLWESVTIVTLFSVGVIVMDEIIHARRRKQREREGGGH*
Ga0062593_10060761223300004114SoilMGLWQSIITVTLFSVAVIVIDEIIHARRRRKREREGTARVGH*
Ga0066398_1009537623300004268Tropical Forest SoilMGLWESVIIVTVFSIGVIVIDEYMHARRRKRREREGAARVGH*
Ga0066674_1004387623300005166SoilMGLWESVIIVTVFSIGVIVIDEFIHARRRKRREREGAARVGH*
Ga0066674_1007917013300005166SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH*
Ga0066674_1056665013300005166SoilMTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH*
Ga0066683_1000752363300005172SoilMTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREGAARVGH*
Ga0066680_1074933123300005174SoilMTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREGATRVGH*
Ga0066680_1087810513300005174SoilMTLWESIIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH*
Ga0066690_1043886123300005177SoilMTLWESIIIVTVFSIAVIVMDEIIHGRRRRRREREGAARVGH*
Ga0066685_1001215263300005180SoilGQQEATMGLWESIAIVVVFSIGVIVADEIIHARRRKRREREGAH*
Ga0066685_1048925123300005180SoilAAMGLWESVAIVVVFSIGVIVADEIIHARRRKRREREGAH*
Ga0066676_1023210813300005186SoilAMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH*
Ga0066388_10058797123300005332Tropical Forest SoilMGLWESVIIVTVFSIAVIVIDEFLHARRRRKREREGAARTGH*
Ga0066388_10188049223300005332Tropical Forest SoilMSLWQSIITVTLFSVAVIVIDEIIHARRRRKREREGTARVGH*
Ga0066388_10256697323300005332Tropical Forest SoilMTIWESIIIVTLFSVAVIVIDEIIHARRRKRREREGGVRAGH*
Ga0070692_1095199623300005345Corn, Switchgrass And Miscanthus RhizosphereMGLWESVIIVTVFSIVVIAADEWMHARRRKRHEREGTARTTH*
Ga0070710_1153571013300005437Corn, Switchgrass And Miscanthus RhizosphereMGLWQSIITVTLFSIAVIVIDEIIHARRRRKREREGTARVGH*
Ga0070694_10096461813300005444Corn, Switchgrass And Miscanthus RhizosphereMGLWESVAIVTVFSIAVIVADEYMHARRRRKREREGAARSGH*
Ga0070694_10174557413300005444Corn, Switchgrass And Miscanthus RhizosphereMGLWQSVIIITLFSIFVIVTDEWLHARRRKKRQREGAARVGH*
Ga0070708_10009947923300005445Corn, Switchgrass And Miscanthus RhizosphereMGLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH*
Ga0070708_10026645223300005445Corn, Switchgrass And Miscanthus RhizosphereMGLWESVVIVTVFSIGVIVMDEIIHARRRRRREREGSTRVGH*
Ga0070708_10115788813300005445Corn, Switchgrass And Miscanthus RhizosphereMTIWESIIIVTLFSVAVIVIDEIIHARRRKKREREGGVRVPGH*
Ga0066686_1032813213300005446SoilATMGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGAH*
Ga0066686_1102356213300005446SoilMTLWTSIIIVTLFSIAVIVVDEIIHARRRKKREREGGVRVGH*
Ga0068867_10059332813300005459Miscanthus RhizosphereMGLWECVITVTIFSIIVIAADEWMHARRRKRHEREGTARTTH*
Ga0070706_10012137033300005467Corn, Switchgrass And Miscanthus RhizosphereMTIWESIIIVTLFSVAVIVIDEIIHARRRRKREREGGVRVPGH*
Ga0070706_10084793823300005467Corn, Switchgrass And Miscanthus RhizosphereMGLWQSIITVTLFSIAVIVIDEIIHARRRKRREREGGARVGH*
Ga0070706_10096219823300005467Corn, Switchgrass And Miscanthus RhizosphereMTLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARVGH*
Ga0070737_10002656213300005524Surface SoilMTLWQSVAIVVLFSIGVIVADEVMHARRRRRREREQAAREGH*
Ga0070741_10000812263300005529Surface SoilMGLWESIAIVTVFSIAVIVIDEIIHARRRKRREGAGAARAGH*
Ga0070741_1000347573300005529Surface SoilMTIPQMGLWESIIIVILFSIGVIAMDEVIHARRRKAKEREGGGRPTN*
Ga0070741_1006973023300005529Surface SoilMGLWESVIIVVVFSIGVIVADEMMHARRRKKREREGAARIGH*
Ga0070734_10000307803300005533Surface SoilMTLWESVTIVVLFSIGVIVADEVIHARRRRRREREQAAREGH*
Ga0070697_10017686233300005536Corn, Switchgrass And Miscanthus RhizosphereMGLWESVIIVTLFSIGVIVIDEYMHARRRKRREREGAARVGH*
Ga0070697_10083771423300005536Corn, Switchgrass And Miscanthus RhizosphereMTLWQSVITVTLFSIAVIVIDEIIHARRRKRREREGGARVGH*
Ga0070697_10180122113300005536Corn, Switchgrass And Miscanthus RhizosphereMTIWESIIIVTLFSVAVIVIDEIIHARRRKRREREGGVRVGH*
Ga0066697_1006027223300005540SoilMGLWESIAIVVVFSIGVIVADEIIHARRRKRREREGAH*
Ga0066697_1016206223300005540SoilMGLWESIAIVVLFSIGVIVTDEIIHARRRKRREREGAH*
Ga0066697_1029328323300005540SoilMGLWESVAIVVVFSIGVIVADELIHARRRKRREREGAH*
Ga0070695_10048507023300005545Corn, Switchgrass And Miscanthus RhizosphereMSLWESVIIVSLFSVAVIVIDEIIHARRRKRREREGVTRVAH*
Ga0066701_1034517423300005552SoilMTLWESIIIVTLFSVAVIVMDEIIHARRRKRREREGAARVGH*
Ga0066701_1039257323300005552SoilMGLWESVAIVVVFSIGVIVADEIIHARRRKRREREGAH*
Ga0066692_1101795913300005555SoilMGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGAH*
Ga0066704_1087647023300005557SoilMGLWESVAIVVVFSIGVIVADEIMHARRRKRREREGAH*
Ga0066698_1001990423300005558SoilMGLWESIAIVVVFSIGVIVTDEIIHARRRKRREREGAH*
Ga0066691_1073324223300005586SoilMGLWDSIIIVTLFSIFVIVTDEIIHARRRKRREREGAARVGH*
Ga0066706_1101558923300005598SoilMGLWESIIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH*
Ga0066905_10010353323300005713Tropical Forest SoilMTIWESIIIVTLFSVAVIVIDEIIHARRRKKREQEGGVRAGH*
Ga0066905_10156618823300005713Tropical Forest SoilMGLWQSIITVTLFSIAVIVIDEIIHARRRRRREREGTARVGH*
Ga0066905_10220450113300005713Tropical Forest SoilMGLWESVVIVVLFSIGVIVMDEVIHARRRKRREREGGA
Ga0066903_10070287123300005764Tropical Forest SoilMTIWESIIIVTLFSVAVVVIDEIIHARRRKRREREGGVRAGH*
Ga0081539_1003369323300005985Tabebuia Heterophylla RhizosphereMGLWESVIIVTVFSILVIVADEVIHARRRRKREQEGVARLPH*
Ga0066656_1012927413300006034SoilLMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH*
Ga0066656_1085289323300006034SoilMTLWTSIIIVTLFSIAVIVVDEIIHARRRKTREREGGVRVGH*
Ga0066652_10072399523300006046SoilMGLWESIAIVVLFSIGVIVTDEIIHARRRKRRERE
Ga0070712_10137449313300006175Corn, Switchgrass And Miscanthus RhizosphereMTIWESIIIVTLFSVAVIVIDEIIHARRRKKREREGGLRVPGH*
Ga0079222_1033968323300006755Agricultural SoilMGLWSSIITVTVFSIAVIVIDEIIHARRRKRREREGAARVGH*
Ga0079222_1253394613300006755Agricultural SoilMTIWESIIIVTLFSVAVIVIDEIIHARRRKKREREGGVRVGGH*
Ga0066665_1005401823300006796SoilMGLWESIAIVVVFSIGVIITDEIIHARRRKRREREGAH*
Ga0066659_1032065923300006797SoilMGLWESIAIVVLFSIGVIVADEIIHARRRKRREREGAH*
Ga0066659_1052787023300006797SoilMTLWESVIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH*
Ga0066659_1145579913300006797SoilMTIWESIIIVTLFSVAVIVIDEIIHARRRRKREREGVRVPGH*
Ga0075428_10247962213300006844Populus RhizosphereMGLWESVIIVTIFSIIVIAADEWMHARRRKRHEREGTARTTH*
Ga0075433_1014614523300006852Populus RhizosphereMGLWQSVITVTLFSVAVIVIDEIIHARRRRKREREGTARVGH*
Ga0075434_10193208923300006871Populus RhizosphereMGLWSSIITVTLFSIAVIVIDEIIHARRRKRRAREGAARVGH*
Ga0075424_10002147363300006904Populus RhizosphereMGLWQSVITVTLFSIAVIVIDEIIHARRRRKREREGTARVGH*
Ga0075436_10086598323300006914Populus RhizosphereMGLWSSIITVTLFSIAVIVIDEIIHARRRRKREREGTARVGH*
Ga0099793_1063062723300007258Vadose Zone SoilMMGLWESIGIVVLFSIGVIVTDEIIHARRRKRREREGAH*
Ga0066710_10032875423300009012Grasslands SoilMGLWESVIIVTVFSIGVIVIDEFIHARRRKRREREASACVGH
Ga0066710_10086080533300009012Grasslands SoilMTLWTSIIIVTLFSIAVIVVDEIIHARRRKTREREGGVRVGGH
Ga0066710_10088789313300009012Grasslands SoilMGLWESVAIVVVFSIGVIVADELIHARRRKRREREGAH
Ga0066710_10282752523300009012Grasslands SoilMGLWESIIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH
Ga0099829_1139465513300009038Vadose Zone SoilMTLWESIIIVTLFSIAVIVMDEVIHARRRKRREREGAARVGH*
Ga0099828_1061095323300009089Vadose Zone SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGA
Ga0066709_10040786313300009137Grasslands SoilMGLWESVIIVTVFSIGVIVIDEFIHARRRKRREREGAARV
Ga0066709_10051337013300009137Grasslands SoilMGLWESIAIVVVFSIGVIVMDEIIHARRRKRREREGAH*
Ga0066709_10053605333300009137Grasslands SoilESVIIVTVFSIGVIVIDEFIHARRRKRREREGAARVGH*
Ga0066709_10264251013300009137Grasslands SoilMTLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH*
Ga0066709_10339554023300009137Grasslands SoilMGLWQSVVIVTLFSIFVIVTDEIIHARRRKRREREGAARVGH*
Ga0066709_10413932223300009137Grasslands SoilLWESIIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH*
Ga0114129_1217090223300009147Populus RhizosphereMGLWQSVITVTLFSIAVIVIDEIIHARRRRKREREGTARVG
Ga0126384_1023397823300010046Tropical Forest SoilMTMWESIIIVTLFSIGVIVADEIMHARRRRAKERQQGARQGH*
Ga0126384_1073299723300010046Tropical Forest SoilMTIWESIIIVTLFSVAVIVIDEIIHARRRRKREREGGVRVGGH*
Ga0126384_1092208713300010046Tropical Forest SoilIIIVTLFSVAVIVIDEIIDARRRKKREQEGGVRAGH*
Ga0126382_1117911623300010047Tropical Forest SoilMPQMTMWESIIIVTLFSIGVIVADEIMHARRRRAKERQQGARQGH*
Ga0126382_1248527023300010047Tropical Forest SoilMGLWSSIITVTVFSIAVIVIDEIIHARRRKRRAREGAARVGH*
Ga0127456_101773923300010140Grasslands SoilMTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVG
Ga0134082_1050150223300010303Grasslands SoilAMGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARVGH*
Ga0134111_1020548923300010329Grasslands SoilMTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREG
Ga0134063_1016778523300010335Grasslands SoilAAMTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH*
Ga0126370_1214182513300010358Tropical Forest SoilMTIWESIIIVTLFSVAVIVIDEIIHARRRKKREREGGVRVGH*
Ga0126377_1223753013300010362Tropical Forest SoilGPPMGLWESVIIVTVFSIGVIVIDEYMHARRRKRREREGAARVGH*
Ga0136847_1038612223300010391Freshwater SedimentMGLWESIIIVVLFSVGVIIMDEIIHARRRKRREREGAARVGH*
Ga0136847_1149459223300010391Freshwater SedimentMGLWDSIVIVLVFSVVVIVADEIFHARRRRRREREHATHEGH*
Ga0136847_1157810713300010391Freshwater SedimentMGLWESVVIVVLFSIGVIVMDEIIHARRRKRREREGTGH*
Ga0136847_1252397123300010391Freshwater SedimentMGLWDSVIIVVVFSIAVIVMDEIIHARRRKRREREGTGH*
Ga0136847_1308906023300010391Freshwater SedimentMSLWESVIIVTVFSIVVIVADEYMHARRRKRREREGAARVSH*
Ga0134124_1136093513300010397Terrestrial SoilMTIWESIIIVTLFSVAVIVIDEIIHARRRKQREREGGLRVGGH*
Ga0134122_1056461113300010400Terrestrial SoilMGLWESVIIVTVFSIVVIVADEFMHARRRKRRGGAL
Ga0134122_1107828513300010400Terrestrial SoilMSLWESVIIVSLFSVAVIVIDEIIHARRRKRREREGAVRVGH*
Ga0134122_1108064523300010400Terrestrial SoilMTLWESVIITVLFSVGVIVMDEVIHARRRKRKEREGQGHPGH*
Ga0137393_1017359513300011271Vadose Zone SoilMGLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVG
Ga0137393_1112731523300011271Vadose Zone SoilMTLWESIIICTLFSIAVIVMDEIIHARRRRRREREGAARVGH*
Ga0137399_1073929023300012203Vadose Zone SoilMGLWSSIITVTLFSIAVIVIDEIIHARRRKRREREGAARVGH*
Ga0137376_1007309313300012208Vadose Zone SoilMTLWESIIIVTLFSIAVIVMDEIIHARRRRRREREG
Ga0137387_1000914623300012349Vadose Zone SoilMTLWESIIIVTLFSIAVIVMDEIIHARRRRRRERGGAARVGH*
Ga0137387_1010954633300012349Vadose Zone SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREG
Ga0137366_1040576823300012354Vadose Zone SoilMGLWESIIIVTLFSIAVIVMDEIIHARRRKRREREG
Ga0137361_1048925613300012362Vadose Zone SoilMTLWESIIIVTLFSVAVIVMDEIIHARRRRRREREGAARVGH*
Ga0134039_106523323300012374Grasslands SoilMTLWESVIIITVFSIAVIVMDEIIHARRRKRREREGAARVG
Ga0134046_127709913300012386Grasslands SoilMGLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVG
Ga0134060_129671423300012410Grasslands SoilMGLWESVIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH*
Ga0150984_11197169123300012469Avena Fatua RhizosphereMTLWESVIIVTVFSIGVIVMDELIHARRRKRREREGTGH*
Ga0137397_1029906813300012685Vadose Zone SoilMGLWSSIITVTLFSIAVIVIDEIIHARRRKRREREGITRVAH*
Ga0137394_1034068823300012922Vadose Zone SoilMGLWSSIITVTLFSIAVIVIDEIIHARRRRRREREGAARVGH*
Ga0137394_1092583523300012922Vadose Zone SoilMGLWESVIIVTVFSIVVIVIDEFIHARRRKRREREGAVRVSH*
Ga0137416_1199360713300012927Vadose Zone SoilMGLWESVIIVTVFSIGVIVIDEFMHARRRKRREREGAARVGH*
Ga0137407_1009509123300012930Vadose Zone SoilMGLWESIGIVVLFSIGVIVTDEIIHARRRKRREREGAH*
Ga0137407_1086072113300012930Vadose Zone SoilIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH*
Ga0137407_1117538023300012930Vadose Zone SoilMGLWESVIIVSVFSVAVIVIDEFIHARRRKRREREGITHVAH*
Ga0126375_1110121023300012948Tropical Forest SoilMGLWESVTIVVVFSIGVIVMDEIIHARRRKRREREGAARVGH*
Ga0164303_1103415723300012957SoilMGLWSSIITVTLFSIAVIVIDVIIHARRRKRREREGAVRVGH*
Ga0126369_1357448323300012971Tropical Forest SoilMPQMTMWESIVIVTLFSIGVIVADEIMHAQRRRAKERQHGARQGH*
Ga0134077_1005076033300012972Grasslands SoilIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH*
Ga0134081_1029868913300014150Grasslands SoilSVIIVTVFSIGVIVMDELIHARRRKRREREGTGH*
Ga0134085_1030275213300015359Grasslands SoilMGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGA
Ga0132255_10148839323300015374Arabidopsis RhizosphereMTIWESIIIVTLFSVAVIVIDEIIHARRRRKREREGTARVGH*
Ga0134069_131774713300017654Grasslands SoilEALMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH
Ga0187785_1061061123300017947Tropical PeatlandMGLWESVVIVVVFSIGVIVADEIIHARRHRRRERQ
Ga0187780_1017331333300017973Tropical PeatlandMTIPQMGLWESLIIVVAFSIFVVVADEYIHARRKRQHEREDAARRGH
Ga0187766_1049806213300018058Tropical PeatlandMGLWSSIITVTVFSIAVIVIDEIIHARRRKRREREGAARAGH
Ga0187766_1120063023300018058Tropical PeatlandMGLWSSIITVTVFSIAVIVIDEIIHARRRKRREREGGARAGH
Ga0066655_1004298423300018431Grasslands SoilMTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREGAARVGH
Ga0066655_1019491423300018431Grasslands SoilMGLWESIAIVVVFSIGVIVTDEIIHARRRKRREREGAH
Ga0066655_1029663223300018431Grasslands SoilMGLWESVIIVTVFSIGVIVIDEFIHARRRKRREREGAARVGH
Ga0066655_1046251423300018431Grasslands SoilTMGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGAH
Ga0066655_1065240413300018431Grasslands SoilMTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH
Ga0066655_1074875823300018431Grasslands SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH
Ga0066667_1000890623300018433Grasslands SoilMGLWESIAIVVVFSIGVIITDEIIHARRRKRREREGAH
Ga0066667_1082152123300018433Grasslands SoilMTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREGATRVGH
Ga0066662_1229445613300018468Grasslands SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAAR
Ga0066669_1217791813300018482Grasslands SoilSIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH
Ga0187892_1013717023300019458Bio-OozeMGLWDSVVIVVVFSIAVIVIDEMIHARRRKRRERERGAASGH
Ga0242665_1030552323300022724SoilMGLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH
Ga0209640_1138845313300025324SoilMLEQWGLWESIIVVLGFSIIVIVADEWLHARRRKRREREGAARAGH
Ga0207684_1167736623300025910Corn, Switchgrass And Miscanthus RhizosphereMGLWQSIITVTLFSIAVIVIDEIIHARRRRKREREG
Ga0207646_1051948523300025922Corn, Switchgrass And Miscanthus RhizosphereMGLWESVAIVVVFSIGVIVADEIMHARRRKRREREGAH
Ga0207646_1082612623300025922Corn, Switchgrass And Miscanthus RhizosphereMGLWESVVIVTLFSIGVIVMDEIIHARRRRRREREGSTRVGH
Ga0209350_113724413300026277Grasslands SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRKRRERE
Ga0209237_124522813300026297Grasslands SoilMTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAAR
Ga0209469_101645443300026307SoilMTLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH
Ga0209265_100024723300026308SoilMGLWESIAIVVVFSIGVIVADEIIHARRRKRREREGAH
Ga0209761_115271113300026313Grasslands SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREG
Ga0209471_122493523300026318SoilMGLWESIAIVVLFSIGVIVADEIIHARRRKRREREGAH
Ga0209801_119603623300026326SoilMTLWESVIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH
Ga0209803_114942423300026332SoilTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH
Ga0209803_123190313300026332SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGA
Ga0209377_117440723300026334SoilMGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGAH
Ga0209804_119452523300026335SoilMGLWESIAIVVVFSIGVIVMDEIIHARRRKRREREGAH
Ga0257177_108875013300026480SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARV
Ga0209690_106810923300026524SoilMTLWESIIIVTLFSVAVIVMDEIIHARRRKRREREGAARVGH
Ga0209160_122975723300026532SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVG
Ga0209058_104776423300026536SoilMGLWESVIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH
Ga0209466_105819313300027646Tropical Forest SoilMPQMTMWESIVIVTLFSVGVIVADEIMHARRRRAKERQQGARQGH
Ga0209588_103720323300027671Vadose Zone SoilMGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARVGH
Ga0209581_101170663300027706Surface SoilMTLWQSVAIVVLFSIGVIVADEVMHARRRRRREREQAAREGH
Ga0209060_10001158293300027826Surface SoilMTLWESVTIVVLFSIGVIVADEVIHARRRRRREREQAAREGH
Ga0209283_1095954413300027875Vadose Zone SoilMGLWSSIITVTLFSIAVIVIDEIIHARRRKRRAPG
Ga0137415_1006696123300028536Vadose Zone SoilMGLWESVIIVTVFSIGVIVIDEFMHARRRKRREREGAARVGH
Ga0308187_1040401423300031114SoilMGLWESVIIVTVFSVIVIVADEIIHARRRKRREREGAVR
Ga0307469_1067814223300031720Hardwood Forest SoilMGLWDSVIIVLVFSVAVIVADEIFHARRRRRREREHATHEGH
Ga0307469_1103272313300031720Hardwood Forest SoilMTLWTSIITVTLFSIAVIVIDEIIHTRRRKRREREGGMRVGH
Ga0307469_1245693313300031720Hardwood Forest SoilMGLWESVIIVTVFSIGVIVMDEIIHARRRKRREREGAARVGH
Ga0307468_10036615613300031740Hardwood Forest SoilMGLWESVIIVTVFSIVVIVADEFMHARRRKRREREGAVRVSH
Ga0214473_1021138223300031949SoilMGLWESIIIVVLFSAGVIIMDEIIHARRRKRREREGAARVGH
Ga0214473_1040990323300031949SoilMGLWESVIIVTVFSIVVIAADEYIHARRRKRRAREGAVRVSH
Ga0306922_1128484613300032001SoilMTIPQMGLWESVIIVVAFSIFVVVADEYIHARRKRQHEREDAARRGH
Ga0307471_10273775423300032180Hardwood Forest SoilMGLWESVVIVVLFSIGVIVMDEVIHARRRKRREREGSH
Ga0335082_1044879123300032782SoilVTIPQMSLWESVIIVVVFSIFVVVADEYIHARRRRRHEREDTARRAH
Ga0335070_1010195923300032829SoilVTIPQMSLWESVSIVVVFSIFVVVADEYIHARRRRRHEREDTARRAH
Ga0335069_1002546163300032893SoilVTIPQMSLWESVIIVLVFSIFVVVADEYIHARRRRKHEREDTARRAH
Ga0335069_1180858313300032893SoilMTIPQMGLWESVIIVLAFSLFVIVADEYIHARRKRRHEREDAARRGH
Ga0326726_1037655323300033433Peat SoilMGLWDSVVIVLVFSVAVIVADEIFHARRRRRREREQATHEGH
Ga0326726_1134672423300033433Peat SoilMGLWESVAIVTLFSIGVIVMDEIIHARRRKRREREGTGH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.