Basic Information | |
---|---|
Family ID | F029826 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 187 |
Average Sequence Length | 41 residues |
Representative Sequence | MGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 187 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.48 % |
% of genes near scaffold ends (potentially truncated) | 23.53 % |
% of genes from short scaffolds (< 2000 bps) | 82.35 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.722 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.390 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.107 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.497 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 187 Family Scaffolds |
---|---|---|
PF03176 | MMPL | 50.27 |
PF00005 | ABC_tran | 32.62 |
PF13180 | PDZ_2 | 1.60 |
PF13551 | HTH_29 | 0.53 |
PF00106 | adh_short | 0.53 |
PF02698 | DUF218 | 0.53 |
PF13847 | Methyltransf_31 | 0.53 |
PF10099 | RskA | 0.53 |
PF09822 | ABC_transp_aux | 0.53 |
PF02954 | HTH_8 | 0.53 |
PF07044 | DUF1329 | 0.53 |
PF14238 | DUF4340 | 0.53 |
PF06537 | DHOR | 0.53 |
PF01546 | Peptidase_M20 | 0.53 |
PF12679 | ABC2_membrane_2 | 0.53 |
COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
---|---|---|---|
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 50.27 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 50.27 |
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.72 % |
Unclassified | root | N/A | 4.28 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002908|JGI25382J43887_10373106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 603 | Open in IMG/M |
3300003152|Ga0052254_1167647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
3300004025|Ga0055433_10112071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 630 | Open in IMG/M |
3300004114|Ga0062593_100607612 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300004268|Ga0066398_10095376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
3300005166|Ga0066674_10043876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2004 | Open in IMG/M |
3300005166|Ga0066674_10079170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1511 | Open in IMG/M |
3300005166|Ga0066674_10566650 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005172|Ga0066683_10007523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5495 | Open in IMG/M |
3300005174|Ga0066680_10749331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 594 | Open in IMG/M |
3300005174|Ga0066680_10878105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
3300005177|Ga0066690_10438861 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300005180|Ga0066685_10012152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4880 | Open in IMG/M |
3300005180|Ga0066685_10489251 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300005186|Ga0066676_10232108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1198 | Open in IMG/M |
3300005332|Ga0066388_100587971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1738 | Open in IMG/M |
3300005332|Ga0066388_101880492 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300005332|Ga0066388_102566973 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300005345|Ga0070692_10951996 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300005437|Ga0070710_11535710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
3300005444|Ga0070694_100964618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 706 | Open in IMG/M |
3300005444|Ga0070694_101745574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 530 | Open in IMG/M |
3300005445|Ga0070708_100099479 | All Organisms → cellular organisms → Bacteria | 2661 | Open in IMG/M |
3300005445|Ga0070708_100266452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1611 | Open in IMG/M |
3300005445|Ga0070708_101157888 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300005446|Ga0066686_10328132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1042 | Open in IMG/M |
3300005446|Ga0066686_11023562 | Not Available | 535 | Open in IMG/M |
3300005467|Ga0070706_100121370 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
3300005467|Ga0070706_100847938 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005467|Ga0070706_100962198 | Not Available | 788 | Open in IMG/M |
3300005524|Ga0070737_10002656 | All Organisms → cellular organisms → Bacteria | 20892 | Open in IMG/M |
3300005529|Ga0070741_10000812 | All Organisms → cellular organisms → Bacteria | 104064 | Open in IMG/M |
3300005529|Ga0070741_10003475 | All Organisms → cellular organisms → Bacteria | 39090 | Open in IMG/M |
3300005529|Ga0070741_10069730 | All Organisms → cellular organisms → Bacteria | 3976 | Open in IMG/M |
3300005533|Ga0070734_10000307 | All Organisms → cellular organisms → Bacteria | 116072 | Open in IMG/M |
3300005536|Ga0070697_100176862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1808 | Open in IMG/M |
3300005536|Ga0070697_100837714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 815 | Open in IMG/M |
3300005536|Ga0070697_101801221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
3300005540|Ga0066697_10060272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2166 | Open in IMG/M |
3300005540|Ga0066697_10162062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1323 | Open in IMG/M |
3300005540|Ga0066697_10293283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 957 | Open in IMG/M |
3300005545|Ga0070695_100485070 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300005552|Ga0066701_10345174 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300005552|Ga0066701_10392573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 859 | Open in IMG/M |
3300005555|Ga0066692_11017959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300005557|Ga0066704_10876470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 556 | Open in IMG/M |
3300005558|Ga0066698_10019904 | All Organisms → cellular organisms → Bacteria | 3908 | Open in IMG/M |
3300005586|Ga0066691_10733242 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300005598|Ga0066706_11015589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
3300005713|Ga0066905_100103533 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
3300005713|Ga0066905_101566188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 602 | Open in IMG/M |
3300005713|Ga0066905_102204501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 514 | Open in IMG/M |
3300005764|Ga0066903_100702871 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
3300005985|Ga0081539_10033693 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
3300006034|Ga0066656_10129274 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300006034|Ga0066656_10852893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
3300006046|Ga0066652_100723995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 948 | Open in IMG/M |
3300006175|Ga0070712_101374493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 616 | Open in IMG/M |
3300006755|Ga0079222_10339683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
3300006755|Ga0079222_12533946 | Not Available | 515 | Open in IMG/M |
3300006796|Ga0066665_10054018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2781 | Open in IMG/M |
3300006797|Ga0066659_10320659 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300006797|Ga0066659_10527870 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300006797|Ga0066659_11455799 | Not Available | 573 | Open in IMG/M |
3300006844|Ga0075428_102479622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 531 | Open in IMG/M |
3300006852|Ga0075433_10146145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2102 | Open in IMG/M |
3300006871|Ga0075434_101932089 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300006904|Ga0075424_100021473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6626 | Open in IMG/M |
3300006914|Ga0075436_100865983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 675 | Open in IMG/M |
3300007258|Ga0099793_10630627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 538 | Open in IMG/M |
3300009012|Ga0066710_100328754 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
3300009012|Ga0066710_100860805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1393 | Open in IMG/M |
3300009012|Ga0066710_100887893 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300009012|Ga0066710_102827525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
3300009038|Ga0099829_11394655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 579 | Open in IMG/M |
3300009089|Ga0099828_10610953 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300009137|Ga0066709_100407863 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
3300009137|Ga0066709_100513370 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300009137|Ga0066709_100536053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1655 | Open in IMG/M |
3300009137|Ga0066709_102642510 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300009137|Ga0066709_103395540 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300009137|Ga0066709_104139322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
3300009147|Ga0114129_12170902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
3300010046|Ga0126384_10233978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1475 | Open in IMG/M |
3300010046|Ga0126384_10732997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 879 | Open in IMG/M |
3300010046|Ga0126384_10922087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 790 | Open in IMG/M |
3300010047|Ga0126382_11179116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 684 | Open in IMG/M |
3300010047|Ga0126382_12485270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
3300010140|Ga0127456_1017739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 505 | Open in IMG/M |
3300010303|Ga0134082_10501502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
3300010329|Ga0134111_10205489 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300010335|Ga0134063_10167785 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300010358|Ga0126370_12141825 | Not Available | 550 | Open in IMG/M |
3300010362|Ga0126377_12237530 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR30 | 623 | Open in IMG/M |
3300010391|Ga0136847_10386122 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300010391|Ga0136847_11494592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 892 | Open in IMG/M |
3300010391|Ga0136847_11578107 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300010391|Ga0136847_12523971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 590 | Open in IMG/M |
3300010391|Ga0136847_13089060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
3300010397|Ga0134124_11360935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 735 | Open in IMG/M |
3300010400|Ga0134122_10564611 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300010400|Ga0134122_11078285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 794 | Open in IMG/M |
3300010400|Ga0134122_11080645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 793 | Open in IMG/M |
3300011271|Ga0137393_10173595 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300011271|Ga0137393_11127315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 666 | Open in IMG/M |
3300012203|Ga0137399_10739290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 828 | Open in IMG/M |
3300012208|Ga0137376_10073093 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
3300012349|Ga0137387_10009146 | All Organisms → cellular organisms → Bacteria | 5740 | Open in IMG/M |
3300012349|Ga0137387_10109546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1934 | Open in IMG/M |
3300012354|Ga0137366_10405768 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300012362|Ga0137361_10489256 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
3300012374|Ga0134039_1065233 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300012386|Ga0134046_1277099 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300012410|Ga0134060_1296714 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300012469|Ga0150984_111971691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 787 | Open in IMG/M |
3300012685|Ga0137397_10299068 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300012922|Ga0137394_10340688 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300012922|Ga0137394_10925835 | Not Available | 727 | Open in IMG/M |
3300012927|Ga0137416_11993607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300012930|Ga0137407_10095091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2541 | Open in IMG/M |
3300012930|Ga0137407_10860721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 857 | Open in IMG/M |
3300012930|Ga0137407_11175380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 728 | Open in IMG/M |
3300012948|Ga0126375_11101210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 654 | Open in IMG/M |
3300012957|Ga0164303_11034157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 587 | Open in IMG/M |
3300012971|Ga0126369_13574483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
3300012972|Ga0134077_10050760 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
3300014150|Ga0134081_10298689 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300015359|Ga0134085_10302752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 703 | Open in IMG/M |
3300015374|Ga0132255_101488393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
3300017654|Ga0134069_1317747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
3300017947|Ga0187785_10610611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 561 | Open in IMG/M |
3300017973|Ga0187780_10173313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1500 | Open in IMG/M |
3300018058|Ga0187766_10498062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 820 | Open in IMG/M |
3300018058|Ga0187766_11200630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
3300018431|Ga0066655_10042984 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
3300018431|Ga0066655_10194914 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300018431|Ga0066655_10296632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
3300018431|Ga0066655_10462514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 838 | Open in IMG/M |
3300018431|Ga0066655_10652404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 712 | Open in IMG/M |
3300018431|Ga0066655_10748758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
3300018433|Ga0066667_10008906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4696 | Open in IMG/M |
3300018433|Ga0066667_10821521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
3300018468|Ga0066662_12294456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 567 | Open in IMG/M |
3300018482|Ga0066669_12177918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300019458|Ga0187892_10137170 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300022724|Ga0242665_10305523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 558 | Open in IMG/M |
3300025324|Ga0209640_11388453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300025910|Ga0207684_11677366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 513 | Open in IMG/M |
3300025922|Ga0207646_10519485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1072 | Open in IMG/M |
3300025922|Ga0207646_10826126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 824 | Open in IMG/M |
3300026277|Ga0209350_1137244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 550 | Open in IMG/M |
3300026297|Ga0209237_1245228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 550 | Open in IMG/M |
3300026307|Ga0209469_1016454 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
3300026308|Ga0209265_1000247 | All Organisms → cellular organisms → Bacteria | 14245 | Open in IMG/M |
3300026313|Ga0209761_1152711 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300026318|Ga0209471_1224935 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300026326|Ga0209801_1196036 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300026332|Ga0209803_1149424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 905 | Open in IMG/M |
3300026332|Ga0209803_1231903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 646 | Open in IMG/M |
3300026334|Ga0209377_1174407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 767 | Open in IMG/M |
3300026335|Ga0209804_1194525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 856 | Open in IMG/M |
3300026480|Ga0257177_1088750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 506 | Open in IMG/M |
3300026524|Ga0209690_1068109 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
3300026532|Ga0209160_1229757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 642 | Open in IMG/M |
3300026536|Ga0209058_1047764 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
3300027646|Ga0209466_1058193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
3300027671|Ga0209588_1037203 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
3300027706|Ga0209581_1011706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5413 | Open in IMG/M |
3300027826|Ga0209060_10001158 | All Organisms → cellular organisms → Bacteria | 31234 | Open in IMG/M |
3300027875|Ga0209283_10959544 | Not Available | 513 | Open in IMG/M |
3300028536|Ga0137415_10066961 | All Organisms → cellular organisms → Bacteria | 3457 | Open in IMG/M |
3300031114|Ga0308187_10404014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 540 | Open in IMG/M |
3300031720|Ga0307469_10678142 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300031720|Ga0307469_11032723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 769 | Open in IMG/M |
3300031720|Ga0307469_12456933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
3300031740|Ga0307468_100366156 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300031949|Ga0214473_10211382 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
3300031949|Ga0214473_10409903 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300032001|Ga0306922_11284846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 741 | Open in IMG/M |
3300032180|Ga0307471_102737754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 626 | Open in IMG/M |
3300032782|Ga0335082_10448791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1153 | Open in IMG/M |
3300032829|Ga0335070_10101959 | All Organisms → cellular organisms → Bacteria | 3002 | Open in IMG/M |
3300032893|Ga0335069_10025461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8108 | Open in IMG/M |
3300032893|Ga0335069_11808583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 649 | Open in IMG/M |
3300033433|Ga0326726_10376553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1344 | Open in IMG/M |
3300033433|Ga0326726_11346724 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.39% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.83% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.23% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.81% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.21% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 2.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.67% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.14% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.14% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.07% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.07% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.07% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.53% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.53% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.53% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J43887_103731062 | 3300002908 | Grasslands Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARVGH* |
Ga0052254_11676471 | 3300003152 | Sediment | VTIPQMSLWESVIIVVVFSIFVVVADEYIHARRRRRHEREDTARRAH* |
Ga0055433_101120712 | 3300004025 | Natural And Restored Wetlands | MTLWESVTIVTLFSVGVIVMDEIIHARRRKQREREGGGH* |
Ga0062593_1006076122 | 3300004114 | Soil | MGLWQSIITVTLFSVAVIVIDEIIHARRRRKREREGTARVGH* |
Ga0066398_100953762 | 3300004268 | Tropical Forest Soil | MGLWESVIIVTVFSIGVIVIDEYMHARRRKRREREGAARVGH* |
Ga0066674_100438762 | 3300005166 | Soil | MGLWESVIIVTVFSIGVIVIDEFIHARRRKRREREGAARVGH* |
Ga0066674_100791701 | 3300005166 | Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH* |
Ga0066674_105666501 | 3300005166 | Soil | MTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH* |
Ga0066683_100075236 | 3300005172 | Soil | MTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREGAARVGH* |
Ga0066680_107493312 | 3300005174 | Soil | MTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREGATRVGH* |
Ga0066680_108781051 | 3300005174 | Soil | MTLWESIIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH* |
Ga0066690_104388612 | 3300005177 | Soil | MTLWESIIIVTVFSIAVIVMDEIIHGRRRRRREREGAARVGH* |
Ga0066685_100121526 | 3300005180 | Soil | GQQEATMGLWESIAIVVVFSIGVIVADEIIHARRRKRREREGAH* |
Ga0066685_104892512 | 3300005180 | Soil | AAMGLWESVAIVVVFSIGVIVADEIIHARRRKRREREGAH* |
Ga0066676_102321081 | 3300005186 | Soil | AMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH* |
Ga0066388_1005879712 | 3300005332 | Tropical Forest Soil | MGLWESVIIVTVFSIAVIVIDEFLHARRRRKREREGAARTGH* |
Ga0066388_1018804922 | 3300005332 | Tropical Forest Soil | MSLWQSIITVTLFSVAVIVIDEIIHARRRRKREREGTARVGH* |
Ga0066388_1025669732 | 3300005332 | Tropical Forest Soil | MTIWESIIIVTLFSVAVIVIDEIIHARRRKRREREGGVRAGH* |
Ga0070692_109519962 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWESVIIVTVFSIVVIAADEWMHARRRKRHEREGTARTTH* |
Ga0070710_115357101 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWQSIITVTLFSIAVIVIDEIIHARRRRKREREGTARVGH* |
Ga0070694_1009646181 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWESVAIVTVFSIAVIVADEYMHARRRRKREREGAARSGH* |
Ga0070694_1017455741 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWQSVIIITLFSIFVIVTDEWLHARRRKKRQREGAARVGH* |
Ga0070708_1000994792 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH* |
Ga0070708_1002664522 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWESVVIVTVFSIGVIVMDEIIHARRRRRREREGSTRVGH* |
Ga0070708_1011578881 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIWESIIIVTLFSVAVIVIDEIIHARRRKKREREGGVRVPGH* |
Ga0066686_103281321 | 3300005446 | Soil | ATMGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGAH* |
Ga0066686_110235621 | 3300005446 | Soil | MTLWTSIIIVTLFSIAVIVVDEIIHARRRKKREREGGVRVGH* |
Ga0068867_1005933281 | 3300005459 | Miscanthus Rhizosphere | MGLWECVITVTIFSIIVIAADEWMHARRRKRHEREGTARTTH* |
Ga0070706_1001213703 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIWESIIIVTLFSVAVIVIDEIIHARRRRKREREGGVRVPGH* |
Ga0070706_1008479382 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWQSIITVTLFSIAVIVIDEIIHARRRKRREREGGARVGH* |
Ga0070706_1009621982 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARVGH* |
Ga0070737_1000265621 | 3300005524 | Surface Soil | MTLWQSVAIVVLFSIGVIVADEVMHARRRRRREREQAAREGH* |
Ga0070741_1000081226 | 3300005529 | Surface Soil | MGLWESIAIVTVFSIAVIVIDEIIHARRRKRREGAGAARAGH* |
Ga0070741_100034757 | 3300005529 | Surface Soil | MTIPQMGLWESIIIVILFSIGVIAMDEVIHARRRKAKEREGGGRPTN* |
Ga0070741_100697302 | 3300005529 | Surface Soil | MGLWESVIIVVVFSIGVIVADEMMHARRRKKREREGAARIGH* |
Ga0070734_1000030780 | 3300005533 | Surface Soil | MTLWESVTIVVLFSIGVIVADEVIHARRRRRREREQAAREGH* |
Ga0070697_1001768623 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWESVIIVTLFSIGVIVIDEYMHARRRKRREREGAARVGH* |
Ga0070697_1008377142 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLWQSVITVTLFSIAVIVIDEIIHARRRKRREREGGARVGH* |
Ga0070697_1018012211 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIWESIIIVTLFSVAVIVIDEIIHARRRKRREREGGVRVGH* |
Ga0066697_100602722 | 3300005540 | Soil | MGLWESIAIVVVFSIGVIVADEIIHARRRKRREREGAH* |
Ga0066697_101620622 | 3300005540 | Soil | MGLWESIAIVVLFSIGVIVTDEIIHARRRKRREREGAH* |
Ga0066697_102932832 | 3300005540 | Soil | MGLWESVAIVVVFSIGVIVADELIHARRRKRREREGAH* |
Ga0070695_1004850702 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLWESVIIVSLFSVAVIVIDEIIHARRRKRREREGVTRVAH* |
Ga0066701_103451742 | 3300005552 | Soil | MTLWESIIIVTLFSVAVIVMDEIIHARRRKRREREGAARVGH* |
Ga0066701_103925732 | 3300005552 | Soil | MGLWESVAIVVVFSIGVIVADEIIHARRRKRREREGAH* |
Ga0066692_110179591 | 3300005555 | Soil | MGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGAH* |
Ga0066704_108764702 | 3300005557 | Soil | MGLWESVAIVVVFSIGVIVADEIMHARRRKRREREGAH* |
Ga0066698_100199042 | 3300005558 | Soil | MGLWESIAIVVVFSIGVIVTDEIIHARRRKRREREGAH* |
Ga0066691_107332422 | 3300005586 | Soil | MGLWDSIIIVTLFSIFVIVTDEIIHARRRKRREREGAARVGH* |
Ga0066706_110155892 | 3300005598 | Soil | MGLWESIIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH* |
Ga0066905_1001035332 | 3300005713 | Tropical Forest Soil | MTIWESIIIVTLFSVAVIVIDEIIHARRRKKREQEGGVRAGH* |
Ga0066905_1015661882 | 3300005713 | Tropical Forest Soil | MGLWQSIITVTLFSIAVIVIDEIIHARRRRRREREGTARVGH* |
Ga0066905_1022045011 | 3300005713 | Tropical Forest Soil | MGLWESVVIVVLFSIGVIVMDEVIHARRRKRREREGGA |
Ga0066903_1007028712 | 3300005764 | Tropical Forest Soil | MTIWESIIIVTLFSVAVVVIDEIIHARRRKRREREGGVRAGH* |
Ga0081539_100336932 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MGLWESVIIVTVFSILVIVADEVIHARRRRKREQEGVARLPH* |
Ga0066656_101292741 | 3300006034 | Soil | LMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH* |
Ga0066656_108528932 | 3300006034 | Soil | MTLWTSIIIVTLFSIAVIVVDEIIHARRRKTREREGGVRVGH* |
Ga0066652_1007239952 | 3300006046 | Soil | MGLWESIAIVVLFSIGVIVTDEIIHARRRKRRERE |
Ga0070712_1013744931 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIWESIIIVTLFSVAVIVIDEIIHARRRKKREREGGLRVPGH* |
Ga0079222_103396832 | 3300006755 | Agricultural Soil | MGLWSSIITVTVFSIAVIVIDEIIHARRRKRREREGAARVGH* |
Ga0079222_125339461 | 3300006755 | Agricultural Soil | MTIWESIIIVTLFSVAVIVIDEIIHARRRKKREREGGVRVGGH* |
Ga0066665_100540182 | 3300006796 | Soil | MGLWESIAIVVVFSIGVIITDEIIHARRRKRREREGAH* |
Ga0066659_103206592 | 3300006797 | Soil | MGLWESIAIVVLFSIGVIVADEIIHARRRKRREREGAH* |
Ga0066659_105278702 | 3300006797 | Soil | MTLWESVIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH* |
Ga0066659_114557991 | 3300006797 | Soil | MTIWESIIIVTLFSVAVIVIDEIIHARRRRKREREGVRVPGH* |
Ga0075428_1024796221 | 3300006844 | Populus Rhizosphere | MGLWESVIIVTIFSIIVIAADEWMHARRRKRHEREGTARTTH* |
Ga0075433_101461452 | 3300006852 | Populus Rhizosphere | MGLWQSVITVTLFSVAVIVIDEIIHARRRRKREREGTARVGH* |
Ga0075434_1019320892 | 3300006871 | Populus Rhizosphere | MGLWSSIITVTLFSIAVIVIDEIIHARRRKRRAREGAARVGH* |
Ga0075424_1000214736 | 3300006904 | Populus Rhizosphere | MGLWQSVITVTLFSIAVIVIDEIIHARRRRKREREGTARVGH* |
Ga0075436_1008659832 | 3300006914 | Populus Rhizosphere | MGLWSSIITVTLFSIAVIVIDEIIHARRRRKREREGTARVGH* |
Ga0099793_106306272 | 3300007258 | Vadose Zone Soil | MMGLWESIGIVVLFSIGVIVTDEIIHARRRKRREREGAH* |
Ga0066710_1003287542 | 3300009012 | Grasslands Soil | MGLWESVIIVTVFSIGVIVIDEFIHARRRKRREREASACVGH |
Ga0066710_1008608053 | 3300009012 | Grasslands Soil | MTLWTSIIIVTLFSIAVIVVDEIIHARRRKTREREGGVRVGGH |
Ga0066710_1008878931 | 3300009012 | Grasslands Soil | MGLWESVAIVVVFSIGVIVADELIHARRRKRREREGAH |
Ga0066710_1028275252 | 3300009012 | Grasslands Soil | MGLWESIIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH |
Ga0099829_113946551 | 3300009038 | Vadose Zone Soil | MTLWESIIIVTLFSIAVIVMDEVIHARRRKRREREGAARVGH* |
Ga0099828_106109532 | 3300009089 | Vadose Zone Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGA |
Ga0066709_1004078631 | 3300009137 | Grasslands Soil | MGLWESVIIVTVFSIGVIVIDEFIHARRRKRREREGAARV |
Ga0066709_1005133701 | 3300009137 | Grasslands Soil | MGLWESIAIVVVFSIGVIVMDEIIHARRRKRREREGAH* |
Ga0066709_1005360533 | 3300009137 | Grasslands Soil | ESVIIVTVFSIGVIVIDEFIHARRRKRREREGAARVGH* |
Ga0066709_1026425101 | 3300009137 | Grasslands Soil | MTLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH* |
Ga0066709_1033955402 | 3300009137 | Grasslands Soil | MGLWQSVVIVTLFSIFVIVTDEIIHARRRKRREREGAARVGH* |
Ga0066709_1041393222 | 3300009137 | Grasslands Soil | LWESIIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH* |
Ga0114129_121709022 | 3300009147 | Populus Rhizosphere | MGLWQSVITVTLFSIAVIVIDEIIHARRRRKREREGTARVG |
Ga0126384_102339782 | 3300010046 | Tropical Forest Soil | MTMWESIIIVTLFSIGVIVADEIMHARRRRAKERQQGARQGH* |
Ga0126384_107329972 | 3300010046 | Tropical Forest Soil | MTIWESIIIVTLFSVAVIVIDEIIHARRRRKREREGGVRVGGH* |
Ga0126384_109220871 | 3300010046 | Tropical Forest Soil | IIIVTLFSVAVIVIDEIIDARRRKKREQEGGVRAGH* |
Ga0126382_111791162 | 3300010047 | Tropical Forest Soil | MPQMTMWESIIIVTLFSIGVIVADEIMHARRRRAKERQQGARQGH* |
Ga0126382_124852702 | 3300010047 | Tropical Forest Soil | MGLWSSIITVTVFSIAVIVIDEIIHARRRKRRAREGAARVGH* |
Ga0127456_10177392 | 3300010140 | Grasslands Soil | MTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVG |
Ga0134082_105015022 | 3300010303 | Grasslands Soil | AMGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARVGH* |
Ga0134111_102054892 | 3300010329 | Grasslands Soil | MTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREG |
Ga0134063_101677852 | 3300010335 | Grasslands Soil | AAMTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH* |
Ga0126370_121418251 | 3300010358 | Tropical Forest Soil | MTIWESIIIVTLFSVAVIVIDEIIHARRRKKREREGGVRVGH* |
Ga0126377_122375301 | 3300010362 | Tropical Forest Soil | GPPMGLWESVIIVTVFSIGVIVIDEYMHARRRKRREREGAARVGH* |
Ga0136847_103861222 | 3300010391 | Freshwater Sediment | MGLWESIIIVVLFSVGVIIMDEIIHARRRKRREREGAARVGH* |
Ga0136847_114945922 | 3300010391 | Freshwater Sediment | MGLWDSIVIVLVFSVVVIVADEIFHARRRRRREREHATHEGH* |
Ga0136847_115781071 | 3300010391 | Freshwater Sediment | MGLWESVVIVVLFSIGVIVMDEIIHARRRKRREREGTGH* |
Ga0136847_125239712 | 3300010391 | Freshwater Sediment | MGLWDSVIIVVVFSIAVIVMDEIIHARRRKRREREGTGH* |
Ga0136847_130890602 | 3300010391 | Freshwater Sediment | MSLWESVIIVTVFSIVVIVADEYMHARRRKRREREGAARVSH* |
Ga0134124_113609351 | 3300010397 | Terrestrial Soil | MTIWESIIIVTLFSVAVIVIDEIIHARRRKQREREGGLRVGGH* |
Ga0134122_105646111 | 3300010400 | Terrestrial Soil | MGLWESVIIVTVFSIVVIVADEFMHARRRKRRGGAL |
Ga0134122_110782851 | 3300010400 | Terrestrial Soil | MSLWESVIIVSLFSVAVIVIDEIIHARRRKRREREGAVRVGH* |
Ga0134122_110806452 | 3300010400 | Terrestrial Soil | MTLWESVIITVLFSVGVIVMDEVIHARRRKRKEREGQGHPGH* |
Ga0137393_101735951 | 3300011271 | Vadose Zone Soil | MGLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVG |
Ga0137393_111273152 | 3300011271 | Vadose Zone Soil | MTLWESIIICTLFSIAVIVMDEIIHARRRRRREREGAARVGH* |
Ga0137399_107392902 | 3300012203 | Vadose Zone Soil | MGLWSSIITVTLFSIAVIVIDEIIHARRRKRREREGAARVGH* |
Ga0137376_100730931 | 3300012208 | Vadose Zone Soil | MTLWESIIIVTLFSIAVIVMDEIIHARRRRRREREG |
Ga0137387_100091462 | 3300012349 | Vadose Zone Soil | MTLWESIIIVTLFSIAVIVMDEIIHARRRRRRERGGAARVGH* |
Ga0137387_101095463 | 3300012349 | Vadose Zone Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREG |
Ga0137366_104057682 | 3300012354 | Vadose Zone Soil | MGLWESIIIVTLFSIAVIVMDEIIHARRRKRREREG |
Ga0137361_104892561 | 3300012362 | Vadose Zone Soil | MTLWESIIIVTLFSVAVIVMDEIIHARRRRRREREGAARVGH* |
Ga0134039_10652332 | 3300012374 | Grasslands Soil | MTLWESVIIITVFSIAVIVMDEIIHARRRKRREREGAARVG |
Ga0134046_12770991 | 3300012386 | Grasslands Soil | MGLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVG |
Ga0134060_12967142 | 3300012410 | Grasslands Soil | MGLWESVIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH* |
Ga0150984_1119716912 | 3300012469 | Avena Fatua Rhizosphere | MTLWESVIIVTVFSIGVIVMDELIHARRRKRREREGTGH* |
Ga0137397_102990681 | 3300012685 | Vadose Zone Soil | MGLWSSIITVTLFSIAVIVIDEIIHARRRKRREREGITRVAH* |
Ga0137394_103406882 | 3300012922 | Vadose Zone Soil | MGLWSSIITVTLFSIAVIVIDEIIHARRRRRREREGAARVGH* |
Ga0137394_109258352 | 3300012922 | Vadose Zone Soil | MGLWESVIIVTVFSIVVIVIDEFIHARRRKRREREGAVRVSH* |
Ga0137416_119936071 | 3300012927 | Vadose Zone Soil | MGLWESVIIVTVFSIGVIVIDEFMHARRRKRREREGAARVGH* |
Ga0137407_100950912 | 3300012930 | Vadose Zone Soil | MGLWESIGIVVLFSIGVIVTDEIIHARRRKRREREGAH* |
Ga0137407_108607211 | 3300012930 | Vadose Zone Soil | IIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH* |
Ga0137407_111753802 | 3300012930 | Vadose Zone Soil | MGLWESVIIVSVFSVAVIVIDEFIHARRRKRREREGITHVAH* |
Ga0126375_111012102 | 3300012948 | Tropical Forest Soil | MGLWESVTIVVVFSIGVIVMDEIIHARRRKRREREGAARVGH* |
Ga0164303_110341572 | 3300012957 | Soil | MGLWSSIITVTLFSIAVIVIDVIIHARRRKRREREGAVRVGH* |
Ga0126369_135744832 | 3300012971 | Tropical Forest Soil | MPQMTMWESIVIVTLFSIGVIVADEIMHAQRRRAKERQHGARQGH* |
Ga0134077_100507603 | 3300012972 | Grasslands Soil | IVTLFSIAVIVMDEIIHARRRKRREREGAARVGH* |
Ga0134081_102986891 | 3300014150 | Grasslands Soil | SVIIVTVFSIGVIVMDELIHARRRKRREREGTGH* |
Ga0134085_103027521 | 3300015359 | Grasslands Soil | MGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGA |
Ga0132255_1014883932 | 3300015374 | Arabidopsis Rhizosphere | MTIWESIIIVTLFSVAVIVIDEIIHARRRRKREREGTARVGH* |
Ga0134069_13177471 | 3300017654 | Grasslands Soil | EALMGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH |
Ga0187785_106106112 | 3300017947 | Tropical Peatland | MGLWESVVIVVVFSIGVIVADEIIHARRHRRRERQ |
Ga0187780_101733133 | 3300017973 | Tropical Peatland | MTIPQMGLWESLIIVVAFSIFVVVADEYIHARRKRQHEREDAARRGH |
Ga0187766_104980621 | 3300018058 | Tropical Peatland | MGLWSSIITVTVFSIAVIVIDEIIHARRRKRREREGAARAGH |
Ga0187766_112006302 | 3300018058 | Tropical Peatland | MGLWSSIITVTVFSIAVIVIDEIIHARRRKRREREGGARAGH |
Ga0066655_100429842 | 3300018431 | Grasslands Soil | MTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREGAARVGH |
Ga0066655_101949142 | 3300018431 | Grasslands Soil | MGLWESIAIVVVFSIGVIVTDEIIHARRRKRREREGAH |
Ga0066655_102966322 | 3300018431 | Grasslands Soil | MGLWESVIIVTVFSIGVIVIDEFIHARRRKRREREGAARVGH |
Ga0066655_104625142 | 3300018431 | Grasslands Soil | TMGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGAH |
Ga0066655_106524041 | 3300018431 | Grasslands Soil | MTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH |
Ga0066655_107487582 | 3300018431 | Grasslands Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH |
Ga0066667_100089062 | 3300018433 | Grasslands Soil | MGLWESIAIVVVFSIGVIITDEIIHARRRKRREREGAH |
Ga0066667_108215212 | 3300018433 | Grasslands Soil | MTLWESVIIVTVFSIAVIVMDEIIHARRRKRREREGATRVGH |
Ga0066662_122944561 | 3300018468 | Grasslands Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAAR |
Ga0066669_121779181 | 3300018482 | Grasslands Soil | SIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVGH |
Ga0187892_101371702 | 3300019458 | Bio-Ooze | MGLWDSVVIVVVFSIAVIVIDEMIHARRRKRRERERGAASGH |
Ga0242665_103055232 | 3300022724 | Soil | MGLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH |
Ga0209640_113884531 | 3300025324 | Soil | MLEQWGLWESIIVVLGFSIIVIVADEWLHARRRKRREREGAARAGH |
Ga0207684_116773662 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWQSIITVTLFSIAVIVIDEIIHARRRRKREREG |
Ga0207646_105194852 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWESVAIVVVFSIGVIVADEIMHARRRKRREREGAH |
Ga0207646_108261262 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLWESVVIVTLFSIGVIVMDEIIHARRRRRREREGSTRVGH |
Ga0209350_11372441 | 3300026277 | Grasslands Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRKRRERE |
Ga0209237_12452281 | 3300026297 | Grasslands Soil | MTLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAAR |
Ga0209469_10164544 | 3300026307 | Soil | MTLWESVIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH |
Ga0209265_10002472 | 3300026308 | Soil | MGLWESIAIVVVFSIGVIVADEIIHARRRKRREREGAH |
Ga0209761_11527111 | 3300026313 | Grasslands Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREG |
Ga0209471_12249352 | 3300026318 | Soil | MGLWESIAIVVLFSIGVIVADEIIHARRRKRREREGAH |
Ga0209801_11960362 | 3300026326 | Soil | MTLWESVIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH |
Ga0209803_11494242 | 3300026332 | Soil | TLWESIIIVTLFSIAVIVMDEIIHARRRKRREREGAARVGH |
Ga0209803_12319031 | 3300026332 | Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGA |
Ga0209377_11744072 | 3300026334 | Soil | MGLWESIGIVVIFSIGVIVADEIIHARRRKRREREGAH |
Ga0209804_11945252 | 3300026335 | Soil | MGLWESIAIVVVFSIGVIVMDEIIHARRRKRREREGAH |
Ga0257177_10887501 | 3300026480 | Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARV |
Ga0209690_10681092 | 3300026524 | Soil | MTLWESIIIVTLFSVAVIVMDEIIHARRRKRREREGAARVGH |
Ga0209160_12297572 | 3300026532 | Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRKRREREGAARVG |
Ga0209058_10477642 | 3300026536 | Soil | MGLWESVIIVTLFSIAVIVMDEIIHARRRRRREREGAARVGH |
Ga0209466_10581931 | 3300027646 | Tropical Forest Soil | MPQMTMWESIVIVTLFSVGVIVADEIMHARRRRAKERQQGARQGH |
Ga0209588_10372032 | 3300027671 | Vadose Zone Soil | MGLWESIIIVTLFSIGVIVMDEIIHARRRRRREREGAARVGH |
Ga0209581_10117066 | 3300027706 | Surface Soil | MTLWQSVAIVVLFSIGVIVADEVMHARRRRRREREQAAREGH |
Ga0209060_1000115829 | 3300027826 | Surface Soil | MTLWESVTIVVLFSIGVIVADEVIHARRRRRREREQAAREGH |
Ga0209283_109595441 | 3300027875 | Vadose Zone Soil | MGLWSSIITVTLFSIAVIVIDEIIHARRRKRRAPG |
Ga0137415_100669612 | 3300028536 | Vadose Zone Soil | MGLWESVIIVTVFSIGVIVIDEFMHARRRKRREREGAARVGH |
Ga0308187_104040142 | 3300031114 | Soil | MGLWESVIIVTVFSVIVIVADEIIHARRRKRREREGAVR |
Ga0307469_106781422 | 3300031720 | Hardwood Forest Soil | MGLWDSVIIVLVFSVAVIVADEIFHARRRRRREREHATHEGH |
Ga0307469_110327231 | 3300031720 | Hardwood Forest Soil | MTLWTSIITVTLFSIAVIVIDEIIHTRRRKRREREGGMRVGH |
Ga0307469_124569331 | 3300031720 | Hardwood Forest Soil | MGLWESVIIVTVFSIGVIVMDEIIHARRRKRREREGAARVGH |
Ga0307468_1003661561 | 3300031740 | Hardwood Forest Soil | MGLWESVIIVTVFSIVVIVADEFMHARRRKRREREGAVRVSH |
Ga0214473_102113822 | 3300031949 | Soil | MGLWESIIIVVLFSAGVIIMDEIIHARRRKRREREGAARVGH |
Ga0214473_104099032 | 3300031949 | Soil | MGLWESVIIVTVFSIVVIAADEYIHARRRKRRAREGAVRVSH |
Ga0306922_112848461 | 3300032001 | Soil | MTIPQMGLWESVIIVVAFSIFVVVADEYIHARRKRQHEREDAARRGH |
Ga0307471_1027377542 | 3300032180 | Hardwood Forest Soil | MGLWESVVIVVLFSIGVIVMDEVIHARRRKRREREGSH |
Ga0335082_104487912 | 3300032782 | Soil | VTIPQMSLWESVIIVVVFSIFVVVADEYIHARRRRRHEREDTARRAH |
Ga0335070_101019592 | 3300032829 | Soil | VTIPQMSLWESVSIVVVFSIFVVVADEYIHARRRRRHEREDTARRAH |
Ga0335069_100254616 | 3300032893 | Soil | VTIPQMSLWESVIIVLVFSIFVVVADEYIHARRRRKHEREDTARRAH |
Ga0335069_118085831 | 3300032893 | Soil | MTIPQMGLWESVIIVLAFSLFVIVADEYIHARRKRRHEREDAARRGH |
Ga0326726_103765532 | 3300033433 | Peat Soil | MGLWDSVVIVLVFSVAVIVADEIFHARRRRRREREQATHEGH |
Ga0326726_113467242 | 3300033433 | Peat Soil | MGLWESVAIVTLFSIGVIVMDEIIHARRRKRREREGTGH |
⦗Top⦘ |