NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029603

Metagenome / Metatranscriptome Family F029603

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029603
Family Type Metagenome / Metatranscriptome
Number of Sequences 188
Average Sequence Length 105 residues
Representative Sequence VVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Number of Associated Samples 180
Number of Associated Scaffolds 188

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.81 %
% of genes near scaffold ends (potentially truncated) 55.32 %
% of genes from short scaffolds (< 2000 bps) 76.06 %
Associated GOLD sequencing projects 169
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.617 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(23.936 % of family members)
Environment Ontology (ENVO) Unclassified
(31.915 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(54.787 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.93%    β-sheet: 25.93%    Coil/Unstructured: 73.15%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 188 Family Scaffolds
PF00825Ribonuclease_P 22.87
PF00308Bac_DnaA 19.68
PF00468Ribosomal_L34 9.04
PF01809YidD 8.51
PF0209660KD_IMP 6.38
PF11638DnaA_N 6.38
PF08299Bac_DnaA_C 4.26
PF02527GidB 1.60
PF01424R3H 1.60
PF02195ParBc 1.06
PF02768DNA_pol3_beta_3 0.53
PF05258DciA 0.53
PF13476AAA_23 0.53
PF07992Pyr_redox_2 0.53
PF00712DNA_pol3_beta 0.53
PF02463SMC_N 0.53
PF13614AAA_31 0.53
PF03989DNA_gyraseA_C 0.53
PF13083KH_4 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 188 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 23.94
COG0594RNase P protein componentTranslation, ribosomal structure and biogenesis [J] 22.87
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 19.68
COG0230Ribosomal protein L34Translation, ribosomal structure and biogenesis [J] 9.04
COG0759Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 8.51
COG0706Membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 6.38
COG035716S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)Translation, ribosomal structure and biogenesis [J] 1.60
COG1847Predicted RNA-binding protein Jag (SpoIIIJ-associated), conains KH and R3H domainsGeneral function prediction only [R] 1.60
COG0592DNA polymerase III sliding clamp (beta) subunit, PCNA homologReplication, recombination and repair [L] 1.06
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.53
COG5512Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives)General function prediction only [R] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.62 %
UnclassifiedrootN/A6.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2149837002|Baltic_Sea__contig64995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces4676Open in IMG/M
3300000928|OpTDRAFT_10036399All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300000929|NpDRAFT_10057234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1099Open in IMG/M
3300002133|S2T7BSa_1421055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia13242Open in IMG/M
3300002161|JGI24766J26685_10016224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella1923Open in IMG/M
3300002229|S2T2FKBb102_1504016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6917Open in IMG/M
3300003277|JGI25908J49247_10113523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300005420|Ga0068879_1005702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia839Open in IMG/M
3300005525|Ga0068877_10300633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium928Open in IMG/M
3300005662|Ga0078894_10371227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1294Open in IMG/M
3300005805|Ga0079957_1093460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1660Open in IMG/M
3300006018|Ga0068875_1006276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1069Open in IMG/M
3300006030|Ga0075470_10101768All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300006639|Ga0079301_1014599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2840Open in IMG/M
3300006875|Ga0075473_10010638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3576Open in IMG/M
3300007165|Ga0079302_1086043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia670Open in IMG/M
3300007363|Ga0075458_10120322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia815Open in IMG/M
3300007545|Ga0102873_1020041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2060Open in IMG/M
3300007547|Ga0102875_1125571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia812Open in IMG/M
3300007550|Ga0102880_1006826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3198Open in IMG/M
3300007551|Ga0102881_1023563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1733Open in IMG/M
3300007554|Ga0102820_1033856All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300007560|Ga0102913_1039571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1542Open in IMG/M
3300007562|Ga0102915_1067557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1176Open in IMG/M
3300007590|Ga0102917_1064390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1289Open in IMG/M
3300007606|Ga0102923_1251030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300007617|Ga0102897_1129275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia773Open in IMG/M
3300007618|Ga0102896_1143001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia767Open in IMG/M
3300007625|Ga0102870_1038542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1426Open in IMG/M
3300007630|Ga0102903_1046944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1211Open in IMG/M
3300007653|Ga0102868_1007141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2232Open in IMG/M
3300007670|Ga0102862_1044818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1068Open in IMG/M
3300007692|Ga0102823_1021816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1770Open in IMG/M
3300007708|Ga0102859_1241374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300007863|Ga0105744_1071237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium857Open in IMG/M
3300007956|Ga0105741_1174964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300007962|Ga0102907_1046759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1178Open in IMG/M
3300008107|Ga0114340_1053288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1761Open in IMG/M
3300008108|Ga0114341_10455087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300008110|Ga0114343_1035109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3364Open in IMG/M
3300008111|Ga0114344_1038151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3323Open in IMG/M
3300008111|Ga0114344_1107451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1004Open in IMG/M
3300008114|Ga0114347_1079880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1310Open in IMG/M
3300008114|Ga0114347_1175300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M
3300008119|Ga0114354_1254995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300008261|Ga0114336_1081144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1572Open in IMG/M
3300008950|Ga0102891_1056334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1214Open in IMG/M
3300009049|Ga0102911_1187453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300009080|Ga0102815_10092990All Organisms → cellular organisms → Bacteria1648Open in IMG/M
3300009086|Ga0102812_10059438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2120Open in IMG/M
3300009466|Ga0126448_1000648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10407Open in IMG/M
3300010293|Ga0116204_1088205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1090Open in IMG/M
3300010299|Ga0129342_1075159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1292Open in IMG/M
3300010309|Ga0102890_1014681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1540Open in IMG/M
3300010370|Ga0129336_10094588Not Available1754Open in IMG/M
3300011984|Ga0119931_1009367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1072Open in IMG/M
3300012666|Ga0157498_1048387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300012968|Ga0129337_1067434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1193Open in IMG/M
3300013004|Ga0164293_10032098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4347Open in IMG/M
(restricted) 3300013122|Ga0172374_1161576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia824Open in IMG/M
(restricted) 3300013123|Ga0172368_10248748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia873Open in IMG/M
(restricted) 3300013136|Ga0172370_10071447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2627Open in IMG/M
(restricted) 3300013137|Ga0172375_10110281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2353Open in IMG/M
3300020074|Ga0194113_10006498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria14840Open in IMG/M
3300020083|Ga0194111_10005303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria14840Open in IMG/M
3300020141|Ga0211732_1114478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4645Open in IMG/M
3300020160|Ga0211733_10345923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1490Open in IMG/M
3300020162|Ga0211735_10750439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1150Open in IMG/M
3300020183|Ga0194115_10126261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1374Open in IMG/M
3300020190|Ga0194118_10083354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1995Open in IMG/M
3300020196|Ga0194124_10020592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4694Open in IMG/M
3300020486|Ga0208698_105582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1067Open in IMG/M
3300020487|Ga0208200_108998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia814Open in IMG/M
3300020499|Ga0208084_1008011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1308Open in IMG/M
3300020513|Ga0208090_1001338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4586Open in IMG/M
3300020514|Ga0208202_1000590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7999Open in IMG/M
3300020519|Ga0208223_1004040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2759Open in IMG/M
3300020533|Ga0208364_1054498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300020543|Ga0208089_1002834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3669Open in IMG/M
3300020552|Ga0207940_1003218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3880Open in IMG/M
3300020566|Ga0208222_1023867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1180Open in IMG/M
3300020573|Ga0208485_1007792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2512Open in IMG/M
3300020575|Ga0208053_1039479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia899Open in IMG/M
3300020578|Ga0194129_10150071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1496Open in IMG/M
3300021960|Ga0222715_10210285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1157Open in IMG/M
3300021963|Ga0222712_10105758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1961Open in IMG/M
3300021963|Ga0222712_10263897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1095Open in IMG/M
3300024278|Ga0255215_1001573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4887Open in IMG/M
3300024282|Ga0255217_1027591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium903Open in IMG/M
3300024348|Ga0244776_10248541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1238Open in IMG/M
3300024485|Ga0256318_1080579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia697Open in IMG/M
3300024494|Ga0255194_1000316All Organisms → cellular organisms → Bacteria9584Open in IMG/M
3300024534|Ga0256357_1056009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia765Open in IMG/M
3300024543|Ga0256348_1056490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300024564|Ga0255237_1040131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1094Open in IMG/M
3300024856|Ga0256304_1035343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1053Open in IMG/M
3300025445|Ga0208424_1024360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300025585|Ga0208546_1063592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300025630|Ga0208004_1007279Not Available3839Open in IMG/M
3300025635|Ga0208147_1004877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3921Open in IMG/M
3300025763|Ga0255250_1082239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia700Open in IMG/M
3300026564|Ga0256359_1001088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4472Open in IMG/M
3300026993|Ga0209975_1012497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia765Open in IMG/M
3300027084|Ga0208443_1051478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium865Open in IMG/M
3300027114|Ga0208009_1020062Not Available1508Open in IMG/M
3300027121|Ga0255074_1002851Not Available2501Open in IMG/M
3300027131|Ga0255066_1004766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2236Open in IMG/M
3300027133|Ga0255070_1030708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300027135|Ga0255073_1007744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2052Open in IMG/M
3300027135|Ga0255073_1022463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1116Open in IMG/M
3300027136|Ga0255107_1054865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300027137|Ga0255092_1010558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2004Open in IMG/M
3300027139|Ga0255082_1063356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300027143|Ga0255105_1072205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300027146|Ga0255104_1038808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia825Open in IMG/M
3300027147|Ga0255113_1022180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1349Open in IMG/M
3300027154|Ga0255111_1044890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia885Open in IMG/M
3300027156|Ga0255078_1001604Not Available6171Open in IMG/M
3300027197|Ga0208922_1021956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1150Open in IMG/M
3300027205|Ga0208926_1022353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia953Open in IMG/M
3300027214|Ga0208306_1022419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1171Open in IMG/M
3300027217|Ga0208928_1021901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1032Open in IMG/M
3300027220|Ga0208927_1030037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1039Open in IMG/M
3300027223|Ga0208169_1015950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1468Open in IMG/M
3300027227|Ga0208929_1074856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300027234|Ga0208170_1056969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300027235|Ga0208804_1023660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia580Open in IMG/M
3300027237|Ga0208930_1015983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1083Open in IMG/M
3300027241|Ga0208805_1069770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300027244|Ga0208173_1044267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium818Open in IMG/M
3300027246|Ga0208931_1068955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300027247|Ga0208679_1075786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300027251|Ga0208809_1043137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300027254|Ga0208177_1025487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1106Open in IMG/M
3300027258|Ga0208558_1043083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300027285|Ga0255131_1014035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales1766Open in IMG/M
3300027292|Ga0255134_1034532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia840Open in IMG/M
3300027294|Ga0208441_1010931Not Available2352Open in IMG/M
3300027300|Ga0255140_1055457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300027302|Ga0255096_1017341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1656Open in IMG/M
3300027302|Ga0255096_1059330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300027306|Ga0255220_1034920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia978Open in IMG/M
3300027337|Ga0255087_1001785Not Available7425Open in IMG/M
3300027486|Ga0255086_1002543Not Available4479Open in IMG/M
3300027489|Ga0255095_1003453Not Available4925Open in IMG/M
3300027491|Ga0255097_1035293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia993Open in IMG/M
3300027499|Ga0208788_1044694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1215Open in IMG/M
3300027534|Ga0255125_1053748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium850Open in IMG/M
3300027538|Ga0255085_1065811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300027538|Ga0255085_1091834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300027588|Ga0255101_1019191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1031Open in IMG/M
3300027589|Ga0255123_1040435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia884Open in IMG/M
3300027600|Ga0255117_1109392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300027601|Ga0255079_1058237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia807Open in IMG/M
3300027649|Ga0208960_1069694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1038Open in IMG/M
3300027659|Ga0208975_1182962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300027688|Ga0209553_1107130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1001Open in IMG/M
3300027697|Ga0209033_1076475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1138Open in IMG/M
(restricted) 3300027728|Ga0247836_1012252Not Available7586Open in IMG/M
3300027769|Ga0209770_10086139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1305Open in IMG/M
3300027793|Ga0209972_10098275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1474Open in IMG/M
3300027797|Ga0209107_10249948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia853Open in IMG/M
3300027805|Ga0209229_10103534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales1282Open in IMG/M
3300027806|Ga0209985_10103629Not Available1460Open in IMG/M
3300027892|Ga0209550_10215189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1298Open in IMG/M
3300028100|Ga0256363_1001567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3660Open in IMG/M
3300028101|Ga0256349_1093695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300028252|Ga0256360_1055044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300028269|Ga0255193_1005881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella1836Open in IMG/M
3300031758|Ga0315907_10208524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae1634Open in IMG/M
3300031857|Ga0315909_10011548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus9320Open in IMG/M
3300031857|Ga0315909_10347123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1086Open in IMG/M
3300031951|Ga0315904_10483842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1096Open in IMG/M
3300031963|Ga0315901_10710025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300032092|Ga0315905_10749175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia858Open in IMG/M
3300032093|Ga0315902_10711211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia814Open in IMG/M
3300033816|Ga0334980_0001185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus12151Open in IMG/M
3300033981|Ga0334982_0077532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1785Open in IMG/M
3300034019|Ga0334998_0213493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1191Open in IMG/M
3300034064|Ga0335001_0126656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1452Open in IMG/M
3300034072|Ga0310127_074706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1555Open in IMG/M
3300034094|Ga0335014_0037324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila2591Open in IMG/M
3300034105|Ga0335035_0710209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300034119|Ga0335054_0120745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1611Open in IMG/M
3300034122|Ga0335060_0120468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1558Open in IMG/M
3300034122|Ga0335060_0232011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1035Open in IMG/M
3300034355|Ga0335039_0347878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia772Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater23.94%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine22.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater8.51%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.79%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.79%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.26%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.19%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.13%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.60%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.60%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.06%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.06%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.06%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.06%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.06%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine1.06%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.53%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.53%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water0.53%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.53%
Drinking Water Treatment PlantEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant0.53%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.53%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.53%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.53%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2149837002Marine microbial communities from the Baltic SeaEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300002133Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - S2T7BSa (116f)EnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002229Marine microbial communities from the Baltic Sea - S2t7 FKBb (102N)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006018Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaGEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007165Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007617Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02EnvironmentalOpen in IMG/M
3300007618Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007653Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008950Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300010293Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaGEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011984Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107EnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300013136 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020486Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020487Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020499Freshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020514Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020519Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020533Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020543Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020552Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020573Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020575Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300024278Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8dEnvironmentalOpen in IMG/M
3300024282Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8dEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024485Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024494Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300024534Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024543Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024564Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024856Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025763Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026564Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026993Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027084Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027114Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027133Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300027134Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300027135Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300027136Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027137Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300027139Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300027143Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027146Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027147Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027154Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027197Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes)EnvironmentalOpen in IMG/M
3300027205Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027214Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027220Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027223Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027227Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027234Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027237Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027241Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027244Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027246Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027247Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027251Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027258Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027285Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300027292Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8dEnvironmentalOpen in IMG/M
3300027294Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027300Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300027302Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300027306Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8dEnvironmentalOpen in IMG/M
3300027337Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8dEnvironmentalOpen in IMG/M
3300027486Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027489Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8dEnvironmentalOpen in IMG/M
3300027491Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8dEnvironmentalOpen in IMG/M
3300027499Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027534Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027538Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300027588Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300027589Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027601Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300028100Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028101Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028252Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028269Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034094Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Baltic_Sea_001201402149837002MarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIQIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
OpTDRAFT_1003639913300000928Freshwater And MarineGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLPLRAVFKGVREEDEAYFPAE*
NpDRAFT_1005723413300000929Freshwater And MarineSISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
S2T7BSa_1421055103300002133MarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIQIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
JGI24766J26685_1001622423300002161Freshwater And SedimentVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVFKGVREEDEAYFSAE*
S2T2FKBb102_150401683300002229MarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIQIKASGYPQNLPKGPKCPKKYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
JGI25908J49247_1011352313300003277Freshwater LakeASISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0068879_100570223300005420Freshwater LakeYPQSYPQAVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0068877_1030063313300005525Freshwater LakeVVYTSTLGLISGENNSKTFAPVDRGGNYAFIPIKASGYPQNLPKGPKCPKRYPQFSKLVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGV
Ga0078894_1037122723300005662Freshwater LakeVVYTSTLGLISGEKSLKTCLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0079957_109346023300005805LakeVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVF
Ga0068875_100627623300006018Freshwater LakeVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPNGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0075470_1010176813300006030AqueousEKSLKTFLPVDRGGKYAFIPIKASGYPQNLSKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVFKGVREEDEAYFSAE*
Ga0079301_101459943300006639Deep SubsurfaceVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYVITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0075473_1001063813300006875AqueousVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQS
Ga0079302_108604323300007165Deep SubsurfaceVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYVITSRPDQSRQLPLKAVFKGVREEDEAYFPAENRRRAK
Ga0075458_1012032223300007363AqueousYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLSKGPKYPKRCPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVFKGVREEDEAYFSAE*
Ga0102873_102004113300007545EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0102875_112557113300007547EstuarineGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0102880_100682623300007550EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLPLRAVFKGVREEDEAYFPAE*
Ga0102881_102356343300007551EstuarinePGSAIDITPHLTRYPQSYPQAVVYTSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE*
Ga0102820_103385643300007554EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKNYPQFSKPVGQQIPLPPALVAPNRSYAITSRLDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0102913_103957113300007560EstuarineSISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
Ga0102915_106755713300007562EstuarineEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE*
Ga0102917_106439043300007590EstuarineASISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0102923_125103013300007606EstuarineGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE*
Ga0102897_112927523300007617EstuarineSGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0102896_114300123300007618EstuarineGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
Ga0102870_103854223300007625EstuarineVVYTSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0102903_104694423300007630EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
Ga0102868_100714123300007653EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE*
Ga0102862_104481823300007670EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0102823_102181633300007692EstuarineVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
Ga0102859_124137413300007708EstuarinePGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGHPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0105744_107123723300007863Estuary WaterVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDE
Ga0105741_117496423300007956Estuary WaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKDLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVF
Ga0102907_104675923300007962EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLSLRAVFKGVREEDEAYFPAE*
Ga0114340_105328843300008107Freshwater, PlanktonVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0114341_1045508713300008108Freshwater, PlanktonVVYTSTLGLISGENNSKTFAPVDRGGNYAFIPIKASGYPQNLPKGPKCPKRYPQFSKLVGQQIPLPPALVAPNRSYAITSRPDQSRQLP
Ga0114343_103510973300008110Freshwater, PlanktonRSASISLASRAPGSAIDITPHLTSYPQSYPQAVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0114344_103815113300008111Freshwater, PlanktonVVYTSTLGLISGEKSSKTLAPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0114344_110745113300008111Freshwater, PlanktonVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAK*
Ga0114347_107988013300008114Freshwater, PlanktonVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFK
Ga0114347_117530023300008114Freshwater, PlanktonVVYTSTLGLISGENNSKTFAPVDRGGNYAFIPIKASGYPQNLPKGPKCPKRYPQFSKLVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFK
Ga0114354_125499513300008119Freshwater, PlanktonTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0114336_108114413300008261Freshwater, PlanktonVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVRE
Ga0102891_105633423300008950EstuarineVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKDPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0102911_118745313300009049EstuarineVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0102815_1009299043300009080EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
Ga0102812_1005943843300009086EstuarineVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLPLRAVFKGVREEDEAYFPAE*
Ga0126448_100064833300009466Meromictic PondVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE*
Ga0116204_108820533300010293Anoxic Lake WaterSLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSSKTFVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQHPLRAVFKGVREEDEAYFPAE*
Ga0129342_107515923300010299Freshwater To Marine Saline GradientVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLTQRAVFKGVREEDEAYFPAE*
Ga0102890_101468133300010309EstuarineVVYTSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRLDQSQQLPLRAVFKGVREEDEAYFPAE*
Ga0129336_1009458813300010370Freshwater To Marine Saline GradientVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLLPALVAPNRSYAITSRPDQSRQLPLRAVFKGVREEDEANFPAE*
Ga0119931_100936713300011984Drinking Water Treatment PlantVVYTSTLGLISGEKSSKTLAPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSAGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
Ga0157498_104838713300012666Freshwater, Surface IceVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRSDQSQQLPLGAVFKGVREEDEAYFPAE*
Ga0129337_106743423300012968AqueousVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVFKGVREE
Ga0164293_1003209833300013004FreshwaterVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQTQQLTLRAVFKGVREEDEAYFPAE*
(restricted) Ga0172374_116157613300013122FreshwaterVVYTLTLGLISGEKSSKTFVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
(restricted) Ga0172368_1024874813300013123FreshwaterVVYTSTLGLISGEKSSKTFVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE*
(restricted) Ga0172370_1007144723300013136FreshwaterVVYTSTLGLISGEKSSKTFVLVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLQAVFKGVREEDEAYFPAE*
(restricted) Ga0172375_1011028123300013137FreshwaterVVYTSTLGLISGEKSSKTFVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQHPLRAVFKGVREEDEAYFPAE*
Ga0194113_10006498153300020074Freshwater LakeVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRIYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0194111_1000530353300020083Freshwater LakeVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRIYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0211732_111447873300020141FreshwaterVVYTSTLGLISGEKSSKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLTLRAVFKGVREEDEAYFPAE
Ga0211733_1034592333300020160FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFILIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQHPLRAVFKGVREEDEAYFPAE
Ga0211735_1075043913300020162FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFILIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLTLRAVFKGVREEDEAYFPAE
Ga0194115_1012626123300020183Freshwater LakeVSVDRGGKYALIPVKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDE
Ga0194118_1008335443300020190Freshwater LakeVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQHPLRAVFKGVREEDEAYFPAE
Ga0194124_1002059223300020196Freshwater LakeVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0208698_10558223300020486FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQTQQLTLRAVFKGVREEDEAYFPAE
Ga0208200_10899823300020487FreshwaterVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPINASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208084_100801153300020499FreshwaterLTRYPQSYPQAVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0208090_100133863300020513FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALAAPNRSYAITSRPDQSQQLKL
Ga0208202_100059043300020514FreshwaterVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208223_100404053300020519FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208364_105449813300020533FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFK
Ga0208089_100283423300020543FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0207940_100321823300020552FreshwaterVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208222_102386753300020566FreshwaterRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208485_100779243300020573FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208053_103947913300020575FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0194129_1015007113300020578Freshwater LakeVSVDRGGKYALIPVKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEA
Ga0222715_1021028523300021960Estuarine WaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFILIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0222712_1010575843300021963Estuarine WaterVVYTSTLGLISGEKSSKTLAPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0222712_1026389723300021963Estuarine WaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKSRAVFKGVREEDEAYFPAE
Ga0255215_100157373300024278FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVFKGVREEDEAYFSAE
Ga0255217_102759113300024282FreshwaterVVYTSTLGLISGEKSSKTLAPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQS
Ga0244776_1024854153300024348EstuarineGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0256318_108057913300024485FreshwaterLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPAPVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0255194_100031653300024494FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0256357_105600913300024534FreshwaterVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVFKGVREEDEAYFSAE
Ga0256348_105649023300024543FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0255237_104013113300024564FreshwaterEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0256304_103534323300024856FreshwaterVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208424_102436013300025445AqueousVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLSKGPKYPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAV
Ga0208546_106359213300025585AqueousKRLKTFLPVDRGGKYAFIPIKASGYPQNLSKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVFKGVREEDEAYFSAE
Ga0208004_100727923300025630AqueousVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLSKGPKYPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVFKGVREEDEAYFSAE
Ga0208147_100487713300025635AqueousLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0255250_108223913300025763FreshwaterKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0256359_100108863300026564FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLK
Ga0209975_101249713300026993Freshwater LakeVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPNGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0208443_105147823300027084EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFP
Ga0208009_102006223300027114Deep SubsurfaceVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLTLRAVFKGVREEDEAYFPAE
Ga0255074_100285113300027121FreshwaterIRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255066_100476623300027131FreshwaterVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255070_103070813300027133FreshwaterSISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255069_104486213300027134FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLSPALVAPNRSYAI
Ga0255073_100774433300027135FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREE
Ga0255073_102246313300027135FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE
Ga0255107_105486523300027136FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAV
Ga0255092_101055843300027137FreshwaterLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE
Ga0255082_106335613300027139FreshwaterVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE
Ga0255105_107220513300027143FreshwaterVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0255104_103880813300027146FreshwaterKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255113_102218023300027147FreshwaterVVYTSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255111_104489013300027154FreshwaterKRSASISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLNTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0255078_100160493300027156FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0208922_102195613300027197EstuarineVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPA
Ga0208926_102235323300027205EstuarineVVYTSTLGLISGEKSSKTLAPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208306_102241923300027214EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLPLRAVFKGVREEDEAYFPAE
Ga0208928_102190123300027217EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLTLRAVFKGVREEDEAYFPAE
Ga0208927_103003713300027220EstuarineSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208169_101595013300027223EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLSPALVAPNRSYAITSRPDQSQQLTLRA
Ga0208929_107485623300027227EstuarineISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208170_105696913300027234EstuarineVVYTSTLGLISGEKSLETFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAV
Ga0208804_102366023300027235EstuarineKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208930_101598313300027237EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRA
Ga0208805_106977023300027241EstuarineSLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208173_104426713300027244EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRA
Ga0208931_106895523300027246EstuarineSASISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208679_107578613300027247EstuarineKRSASISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0208809_104313713300027251EstuarineVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQL
Ga0208177_102548713300027254EstuarineVVYTSTLGLISGEKSLETFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQL
Ga0208558_104308313300027258EstuarineREKSLKTFLPVDRGGKYAVIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255131_101403513300027285FreshwaterGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255134_103453223300027292FreshwaterVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKRPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208441_101093153300027294EstuarineLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255140_105545713300027300FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLTLRAVFK
Ga0255096_101734113300027302FreshwaterGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255096_105933013300027302FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREED
Ga0255220_103492013300027306FreshwaterVVYTSTLGLISGEKSSKTLAPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVR
Ga0255087_1001785103300027337FreshwaterSASISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE
Ga0255086_100254313300027486FreshwaterLAPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0255095_100345313300027489FreshwaterLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE
Ga0255097_103529313300027491FreshwaterPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0208788_104469423300027499Deep SubsurfaceVPVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYVITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0255125_105374813300027534FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQ
Ga0255085_106581113300027538FreshwaterVVYTSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLTLRAVFK
Ga0255085_109183423300027538FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVR
Ga0255101_101919123300027588FreshwaterVVYTSTLGLISREKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0255123_104043523300027589FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSIPDQSQQLTLRAVFKGVREEDEAYFPAE
Ga0255117_110939223300027600FreshwaterTIPFQSSRRSASISLASRAPGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLTLRAVFKGVREEDEAYFPAE
Ga0255079_105823723300027601FreshwaterGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQLSLRAVFKGVREEDEAYFPAE
Ga0208960_106969433300027649Freshwater LenticGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0208975_118296223300027659Freshwater LenticVYTSTLGLISGEESSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLTLRAVFKGVREEDEAYFPAE
Ga0209553_110713023300027688Freshwater LakeVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKKYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0209033_107647543300027697Freshwater LakeRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
(restricted) Ga0247836_1012252103300027728FreshwaterVVYTSTLGLISGEKSSKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0209770_1008613933300027769Freshwater LakeVVYTSTLGLISGEKSLKTCLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0209972_1009827513300027793Freshwater LakeVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLGAVF
Ga0209107_1024994833300027797Freshwater And SedimentLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0209229_1010353413300027805Freshwater And SedimentRSASISLASRAPGSAIDITPHLTSYPQSYPQAVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0209985_1010362953300027806Freshwater LakeYPQSYPQAVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0209550_1021518913300027892Freshwater LakeGSAIDITPHLTRYPQSYPQAVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVFKGVREEDEAYFPAE
Ga0256363_100156753300028100FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQFQQL
Ga0256349_109369513300028101FreshwaterDITPHLTSYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0256360_105504413300028252FreshwaterVVYTSTLGLISREKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKL
Ga0255193_100588113300028269FreshwaterVVYTSTLGLISGEKSSKTLAPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQILLPPALVAPNRSYAITSRPDQSR
Ga0315907_1020852433300031758FreshwaterVVYTSTLGLISGENNSKTFVPVDRGGKYAFIPIKASGYPQNLPNGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0315909_1001154813300031857FreshwaterVVYTSTLGLISGENNSKTFAPVDRGGNYAFIPIKASGYPQNLPKGPKCPKRYPQFSKLVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREE
Ga0315909_1034712313300031857FreshwaterVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSR
Ga0315904_1048384213300031951FreshwaterVVYTSTLGLISGENNSKTFAPVDRGGNYAFIPIKASGYPQNLPKGPKCPKRYPQFSKLVGQQIPLPPALVAPNRSYAITSRPDQS
Ga0315901_1071002513300031963FreshwaterVVYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQS
Ga0315905_1074917513300032092FreshwaterYTSTLGLISGEKSSKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0315902_1071121113300032093FreshwaterRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0334980_0001185_11375_117013300033816FreshwaterVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQTQQLTLRAVFKGVREEDEAYFPAE
Ga0334982_0077532_1418_17443300033981FreshwaterVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0334998_0213493_857_11293300034019FreshwaterVVYTSTLGLISGEKSLKAFLPVDRGGKYAFIPIKASGYPQNLPKGLKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKL
Ga0335001_0126656_32_4363300034064FreshwaterLASRAPGSAIDITPHLIRYPQSYPQAVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0310127_074706_602_8653300034072Fracking WaterVDRGGKYALIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYVITSRPDQSRQLPLKAVFKGVREEDEAYFPAE
Ga0335014_0037324_1108_14343300034094FreshwaterVVYTSTLGLISGEKSLKTFVPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQTQQLKLRAVFKGVREEDEAYFPAE
Ga0335035_0710209_222_5123300034105FreshwaterEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0335054_0120745_1215_15413300034119FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQTQQLKLRAVFKGVREEDEAYFPAE
Ga0335060_0120468_1_2943300034122FreshwaterGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLKLRAVFKGVREEDEAYFPAE
Ga0335060_0232011_3_3083300034122FreshwaterGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSVGQQIPLPPALVAPNRSYAITSRPDQSQQLPLRAVSKGVREEDEAYFPAE
Ga0335039_0347878_160_4863300034355FreshwaterVVYTSTLGLISGEKSLKTFLPVDRGGKYAFIPIKASGYPQNLPKGPKCPKRYPQFSKSIGQQIPLPPALVAPNRSYAITSRPDQSQQLTLRAVFKGVREEDEAYFPAE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.