Basic Information | |
---|---|
Family ID | F029547 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 188 |
Average Sequence Length | 44 residues |
Representative Sequence | MDYLDRRQEDLARVVTHRFPLDRIAEAFETIRSGTGLKMVIVP |
Number of Associated Samples | 173 |
Number of Associated Scaffolds | 188 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.60 % |
% of genes near scaffold ends (potentially truncated) | 95.74 % |
% of genes from short scaffolds (< 2000 bps) | 90.96 % |
Associated GOLD sequencing projects | 167 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.957 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.064 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.681 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 11.27% Coil/Unstructured: 54.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 188 Family Scaffolds |
---|---|---|
PF00370 | FGGY_N | 77.66 |
PF02782 | FGGY_C | 15.43 |
PF00120 | Gln-synt_C | 0.53 |
PF00582 | Usp | 0.53 |
PF13561 | adh_short_C2 | 0.53 |
PF07722 | Peptidase_C26 | 0.53 |
PF13847 | Methyltransf_31 | 0.53 |
PF09250 | Prim-Pol | 0.53 |
PF00107 | ADH_zinc_N | 0.53 |
PF00005 | ABC_tran | 0.53 |
PF00903 | Glyoxalase | 0.53 |
PF01872 | RibD_C | 0.53 |
COG ID | Name | Functional Category | % Frequency in 188 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.53 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309009|GPKNP_GG3DY5402F0C5V | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
3300000858|JGI10213J12805_10869394 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300000891|JGI10214J12806_12547602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 519 | Open in IMG/M |
3300000956|JGI10216J12902_111047694 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300000956|JGI10216J12902_112615424 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300002908|JGI25382J43887_10495643 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300002916|JGI25389J43894_1039228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 815 | Open in IMG/M |
3300003373|JGI25407J50210_10020158 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300004061|Ga0055487_10002436 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
3300004114|Ga0062593_101074935 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300004156|Ga0062589_101573879 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300004157|Ga0062590_101032474 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300004281|Ga0066397_10137524 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005171|Ga0066677_10142466 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300005177|Ga0066690_10430371 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005180|Ga0066685_10668994 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300005186|Ga0066676_10991555 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300005187|Ga0066675_10902833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300005206|Ga0068995_10124033 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005332|Ga0066388_105919692 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005441|Ga0070700_101254700 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005446|Ga0066686_10357942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 996 | Open in IMG/M |
3300005446|Ga0066686_11136199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300005451|Ga0066681_10803019 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300005456|Ga0070678_100282016 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300005518|Ga0070699_101655201 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005537|Ga0070730_10940685 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300005546|Ga0070696_100194762 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300005547|Ga0070693_100422392 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300005553|Ga0066695_10590740 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005556|Ga0066707_10875511 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005569|Ga0066705_10323180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 976 | Open in IMG/M |
3300005576|Ga0066708_10351429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 946 | Open in IMG/M |
3300005586|Ga0066691_10831209 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005614|Ga0068856_100199194 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
3300005618|Ga0068864_100152054 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
3300005764|Ga0066903_105752287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
3300005841|Ga0068863_100979357 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300005873|Ga0075287_1034083 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005874|Ga0075288_1064576 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005981|Ga0081538_10014636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 6133 | Open in IMG/M |
3300005981|Ga0081538_10057098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2279 | Open in IMG/M |
3300006034|Ga0066656_10234943 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300006169|Ga0082029_1791916 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300006173|Ga0070716_101621215 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300006573|Ga0074055_10977503 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300006577|Ga0074050_10020880 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006800|Ga0066660_10086430 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
3300006806|Ga0079220_10702551 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300006844|Ga0075428_100168388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2376 | Open in IMG/M |
3300006844|Ga0075428_101779275 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300006854|Ga0075425_100780160 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300006880|Ga0075429_100063804 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
3300006904|Ga0075424_100477943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1330 | Open in IMG/M |
3300006904|Ga0075424_102359710 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300006918|Ga0079216_10920409 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300006969|Ga0075419_10481963 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300006969|Ga0075419_11161633 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300007070|Ga0073929_1014871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1748 | Open in IMG/M |
3300009012|Ga0066710_103774221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300009038|Ga0099829_10169857 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
3300009081|Ga0105098_10769213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
3300009087|Ga0105107_10802281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
3300009090|Ga0099827_10939133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 750 | Open in IMG/M |
3300009100|Ga0075418_13137469 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300009137|Ga0066709_104090768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
3300009809|Ga0105089_1017310 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300009840|Ga0126313_11018221 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300010038|Ga0126315_11155555 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010042|Ga0126314_10551433 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300010166|Ga0126306_11679733 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300010333|Ga0134080_10094518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1223 | Open in IMG/M |
3300010362|Ga0126377_11838173 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300010371|Ga0134125_12263395 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300010397|Ga0134124_11168684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 788 | Open in IMG/M |
3300010398|Ga0126383_10120811 | All Organisms → cellular organisms → Bacteria | 2387 | Open in IMG/M |
3300011000|Ga0138513_100050118 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300011107|Ga0151490_1692315 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300011412|Ga0137424_1020978 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300012022|Ga0120191_10161621 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300012200|Ga0137382_10027367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3362 | Open in IMG/M |
3300012203|Ga0137399_10218987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1552 | Open in IMG/M |
3300012355|Ga0137369_10132017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2005 | Open in IMG/M |
3300012359|Ga0137385_10291690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1405 | Open in IMG/M |
3300012363|Ga0137390_11791109 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300012897|Ga0157285_10286198 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012907|Ga0157283_10302441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
3300012915|Ga0157302_10214518 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012930|Ga0137407_12135422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
3300012960|Ga0164301_10915172 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300013297|Ga0157378_10025989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5160 | Open in IMG/M |
3300013297|Ga0157378_12266545 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300013307|Ga0157372_13429437 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300014487|Ga0182000_10101314 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300015052|Ga0137411_1024933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 804 | Open in IMG/M |
3300015372|Ga0132256_101250497 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300015374|Ga0132255_101391165 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300017654|Ga0134069_1213156 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300017656|Ga0134112_10128498 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300018028|Ga0184608_10007177 | All Organisms → cellular organisms → Bacteria | 3674 | Open in IMG/M |
3300018028|Ga0184608_10085389 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300018029|Ga0187787_10273744 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300018031|Ga0184634_10132824 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300018056|Ga0184623_10420046 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300018071|Ga0184618_10404068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
3300018077|Ga0184633_10204473 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300018078|Ga0184612_10436396 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300018081|Ga0184625_10177496 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300018422|Ga0190265_12822912 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300018431|Ga0066655_10120849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1505 | Open in IMG/M |
3300018433|Ga0066667_10876413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 770 | Open in IMG/M |
3300018466|Ga0190268_10166254 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300018468|Ga0066662_12695150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
3300018481|Ga0190271_13770536 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300019361|Ga0173482_10441871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
3300019362|Ga0173479_10339181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
3300019377|Ga0190264_10854203 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300019377|Ga0190264_12097260 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300020003|Ga0193739_1012464 | All Organisms → cellular organisms → Bacteria | 2227 | Open in IMG/M |
3300022694|Ga0222623_10380571 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300023263|Ga0247800_1051549 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300025160|Ga0209109_10238739 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300025312|Ga0209321_10460876 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300025313|Ga0209431_10220998 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
3300025920|Ga0207649_10424340 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300025938|Ga0207704_11393961 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300025944|Ga0207661_12110830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300025957|Ga0210089_1024029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
3300026050|Ga0208293_1016072 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300026088|Ga0207641_11019336 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300026118|Ga0207675_100897000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 903 | Open in IMG/M |
3300026298|Ga0209236_1172700 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300026318|Ga0209471_1266791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
3300026535|Ga0256867_10271252 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300026537|Ga0209157_1262629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 662 | Open in IMG/M |
3300026552|Ga0209577_10827352 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300027056|Ga0209879_1022064 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300027324|Ga0209845_1023661 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300027456|Ga0207482_105692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
3300027671|Ga0209588_1224834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
3300027821|Ga0209811_10401261 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300027880|Ga0209481_10074033 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
3300027961|Ga0209853_1034972 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300028380|Ga0268265_12153937 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300028536|Ga0137415_10904050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 693 | Open in IMG/M |
3300028578|Ga0272482_10326378 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300028597|Ga0247820_11360790 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300028705|Ga0307276_10197692 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300028715|Ga0307313_10198028 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300028717|Ga0307298_10039191 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300028722|Ga0307319_10337686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300028791|Ga0307290_10183125 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300028799|Ga0307284_10007768 | All Organisms → cellular organisms → Bacteria | 3100 | Open in IMG/M |
3300028814|Ga0307302_10055981 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
3300028828|Ga0307312_10432828 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300028881|Ga0307277_10010350 | All Organisms → cellular organisms → Bacteria | 3590 | Open in IMG/M |
3300028881|Ga0307277_10165556 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300028881|Ga0307277_10292670 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300028884|Ga0307308_10510386 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300028885|Ga0307304_10125971 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300030336|Ga0247826_11626343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
3300030516|Ga0268255_10226450 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300030620|Ga0302046_10328789 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300031228|Ga0299914_10577371 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300031548|Ga0307408_100339801 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300031731|Ga0307405_10000670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13228 | Open in IMG/M |
3300031824|Ga0307413_10296855 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300031824|Ga0307413_10698688 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300031824|Ga0307413_11804853 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300031847|Ga0310907_10054928 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300031901|Ga0307406_12140088 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031965|Ga0326597_10654206 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300031965|Ga0326597_12054507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300031995|Ga0307409_100326398 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300031995|Ga0307409_102957600 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300032002|Ga0307416_103243746 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300032005|Ga0307411_10986648 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300032013|Ga0310906_10939389 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300032075|Ga0310890_10917261 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300032080|Ga0326721_10470584 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300032126|Ga0307415_102161539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
3300032159|Ga0268251_10385102 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300032164|Ga0315283_11054576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
3300033417|Ga0214471_10900189 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300033811|Ga0364924_074782 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300034114|Ga0364938_083087 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300034150|Ga0364933_181750 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300034172|Ga0334913_010763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2189 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.70% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.32% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.66% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.13% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.13% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.60% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.60% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.06% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.06% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.06% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.06% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.06% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.06% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.06% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.53% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.53% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.53% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.53% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.53% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.53% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.53% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.53% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.53% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.53% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007070 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC2 2012 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026050 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027456 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-E (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKNP_04603090 | 2070309009 | Soil | ITMDYLDRRQDDLARVVTHRFPLDRIAEAFETIRAGTGLKMVILP |
JGI10213J12805_108693942 | 3300000858 | Soil | YRITMDYLNRRRDELAAVVTHRFPLDGIAEAFETIRSGAGLKMVIVP* |
JGI10214J12806_125476021 | 3300000891 | Soil | HRQYRITMDYLARRQDELARVVTHRFPLEQIGEAFDTIRSGTGLKMVIVP* |
JGI10216J12902_1110476941 | 3300000956 | Soil | DYLDRKQDVLAAVVTHRWPLEQIGEAFETIRSGSGLKMVIVP* |
JGI10216J12902_1126154241 | 3300000956 | Soil | RQYRITMDYLDRKQDELAAVVTHRWPLDRIGEAFETIRAGTGLKMVIVP* |
JGI25382J43887_104956431 | 3300002908 | Grasslands Soil | LRRRRDELAAVVTHRFPLDQIGDAFETIRSGAGLKIVMLP* |
JGI25389J43894_10392281 | 3300002916 | Grasslands Soil | MDYLERRRDELASVVTHRFPLDRIDEAFNTIRSGSGLKVVIVQ* |
JGI25407J50210_100201582 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MDYLNRRRKELAPVVTHQFPLERIDEAFETIRSGTGLKMVVVP* |
Ga0055487_100024361 | 3300004061 | Natural And Restored Wetlands | ITMDYLDRKQELLAAVVTHRWPLEQIAEAFETIRSGSGLKMVIVP* |
Ga0062593_1010749352 | 3300004114 | Soil | THRQYRITMDYLDRRQEELARVVTHRFSLDHIAEGFSTIREGTGLKVVILP* |
Ga0062589_1015738792 | 3300004156 | Soil | TMDYLDRKQEALARVVTHRFPLERIGEAFETIRAGTGLKMVIVP* |
Ga0062590_1010324741 | 3300004157 | Soil | ITMDYLARRRDDLAAVVTHRFPLDRIEEAFETIRAGAGLKMVILP* |
Ga0066397_101375241 | 3300004281 | Tropical Forest Soil | MDYLNRRRDELGAVVTHRFPLAEVAEAFETIRSGAGLKMVILP* |
Ga0066677_101424662 | 3300005171 | Soil | DYLDRRQDDLARVVTHRFPLDRIAEAFETIRSGTGLKMVILP* |
Ga0066690_104303711 | 3300005177 | Soil | MDYLERRRDELASVVTHRFPLAKIGEAFNTIRSGSGLKVVIVQ* |
Ga0066685_106689942 | 3300005180 | Soil | DRRQEELGRVVTHRFPLEGIAEAFETIRTGSGLKMVIVP* |
Ga0066676_109915551 | 3300005186 | Soil | MDYLDRRQEDLARVVTHRFPLDRIAEAFETIRSGTGLKMVIVP* |
Ga0066675_109028331 | 3300005187 | Soil | ITMDYLRRRRDQLAAVVTHRFPLDRIGDAFETIRSGTGLKVVMLP* |
Ga0068995_101240332 | 3300005206 | Natural And Restored Wetlands | MDYLNRRREDLEGVVTHRFPLEQIADAFETIRSGAGLKMVIVP* |
Ga0066388_1059196922 | 3300005332 | Tropical Forest Soil | GAYGATHRQYRITMDYLDRKQDQLAAVVTHRWPLERIAEAFETIRDGTGLKMVIVP* |
Ga0070700_1012547001 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TMDYLDRRQEDLARVVTHRFPLEDIAEAFETIRSGSGLKTVILP* |
Ga0066686_103579421 | 3300005446 | Soil | DYLERRRDELASVVTHRFPLERIGEAFNTIRSGSGLKVVIVQ* |
Ga0066686_111361992 | 3300005446 | Soil | YLRRRRDELAAVVTHRFPLDRIGDAFETIRSGAGLKVVMLP* |
Ga0066681_108030192 | 3300005451 | Soil | GATHRQYRITMDYLRRRRDELAAVVTHRFPLDQIGVAFETIRSGAGLKVVMLP* |
Ga0070678_1002820162 | 3300005456 | Miscanthus Rhizosphere | THRQYRITMDYLDRKQDVLASVVTHRFPLDRIAEAFETIRAGTGLKMVIIP* |
Ga0070699_1016552011 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RITMDYLNRRRDDLTAVVTHRFPLERIGDAFETIRSGAGLKMVILP* |
Ga0070730_109406852 | 3300005537 | Surface Soil | RDELGGVVTHRFPLEQIEEAFSTIRSGGGLNLVIEP* |
Ga0070696_1001947621 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | QYRITMDYLNRRRPDLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIIP* |
Ga0070693_1004223921 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | TMDYLNRRRAELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP* |
Ga0066695_105907402 | 3300005553 | Soil | QYRITMDYLERRRDELASVVTHRFPLDKIDEAFNTIRSGSGLKVVIVQ* |
Ga0066707_108755112 | 3300005556 | Soil | MDYLERRRDELASVVTHRFPLERIGEAFNTIRSGSGLKVVIVQ* |
Ga0066705_103231802 | 3300005569 | Soil | RQDDLARVVTHRFPLDRIAEAFETIRSGTGLKMVILP* |
Ga0066708_103514291 | 3300005576 | Soil | RDELASVVTHRFPLEKIDEAFNTIRSGSGLKVVIVQ* |
Ga0066691_108312092 | 3300005586 | Soil | QYRITMDYLRRRRDELAAVVTHRFPLDRIGDAFETIRSGAGLKVVMLP* |
Ga0068856_1001991943 | 3300005614 | Corn Rhizosphere | MDYLNRRRAELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP* |
Ga0068864_1001520543 | 3300005618 | Switchgrass Rhizosphere | DRRQEELARVVTHRFPLEDIAQAFETIRSGTGLKTVIVP* |
Ga0066903_1057522871 | 3300005764 | Tropical Forest Soil | QYRITMDYLNRRRDDLAPVVTHRFGLDRIAEAFETIRSGTGLKTVVIP* |
Ga0068863_1009793571 | 3300005841 | Switchgrass Rhizosphere | DLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIIP* |
Ga0075287_10340832 | 3300005873 | Rice Paddy Soil | DLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIVP* |
Ga0075288_10645761 | 3300005874 | Rice Paddy Soil | TMDYLDRRRDELAPVVTHRFPLGEIEQAFETIRSGAGLKAVIEP* |
Ga0081538_100146361 | 3300005981 | Tabebuia Heterophylla Rhizosphere | RQYRITMDYLNRRRKELAPVVTHQFPLERIDEAFETIRSGTGLKMVVVP* |
Ga0081538_100570983 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MDYLHRRRDTLAPVVTHQFPLDKVGEAFETIRSGAGLKLVVVP* |
Ga0066656_102349432 | 3300006034 | Soil | QYRITMDYLERRRDELASVVTHRFPLERIGEAFNTIRSGSGLKVVIVQ* |
Ga0082029_17919161 | 3300006169 | Termite Nest | RQYRITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGAGLKMVVVP* |
Ga0070716_1016212151 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HRQYRITMDYLNRRRDDLAPVVTHRFELDRIAEAFETIRSGTGLKTVVIP* |
Ga0074055_109775032 | 3300006573 | Soil | NRRRPDLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIIP* |
Ga0074050_100208801 | 3300006577 | Soil | EDLARVVTHRFPLEEIAQAFETIRSGAGLKTVILP* |
Ga0066660_100864301 | 3300006800 | Soil | RRDELASVVTHRFPLERIGEAFNTIRSGSGLKVVIVQ* |
Ga0079220_107025513 | 3300006806 | Agricultural Soil | LNRRRDELGAVVTHRFPLAHIAEAFDTIRSGAGLKMVILP* |
Ga0075428_1001683884 | 3300006844 | Populus Rhizosphere | GAYGATHRQYRITMGYLDRRRDELAPVVTHQFPLERIDEAFETIRSGAGLKMVVVP* |
Ga0075428_1017792751 | 3300006844 | Populus Rhizosphere | THRQYRITMDYLARKQDELAKVVTHRWPLEKIAEAFETIRAGNGLKMVVMP* |
Ga0075425_1007801601 | 3300006854 | Populus Rhizosphere | TMDYLNRRRDELGAVVTHRFPLARIAEAFDTIRSGAGLKMVILP* |
Ga0075429_1000638041 | 3300006880 | Populus Rhizosphere | DRRQEDLARVVTHRFPLEDIAEAFETIRSGSGLKTVILP* |
Ga0075424_1004779431 | 3300006904 | Populus Rhizosphere | YGATHRQYRITMGYLNRRRHELAPVVTHQFPLDRIDEAFETIRSGAGLKTVVVP* |
Ga0075424_1023597102 | 3300006904 | Populus Rhizosphere | RRDELASVVTHRFPLERIDEAFNTIRSGSGLKVVIVQ* |
Ga0079216_109204091 | 3300006918 | Agricultural Soil | ATHRQYRITMDYLARKQEELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVLP* |
Ga0075419_104819632 | 3300006969 | Populus Rhizosphere | ITMDYLDRRQEDLARVVTHRFPLDDIAQAFETIRSGAGLKMVILP* |
Ga0075419_111616332 | 3300006969 | Populus Rhizosphere | ELGAVVTHRFPLSQIAEAFDTIRSGAGLKMVILP* |
Ga0073929_10148711 | 3300007070 | Hot Spring Sediment | QYRITMDYLARRREELAGVVTHRLPLERIGEGFEAIRSGAALKVVIEP* |
Ga0066710_1037742211 | 3300009012 | Grasslands Soil | RRDELASVVTHRFPLDKIDEAFNTIRSGSGLKVVIVQ |
Ga0099829_101698571 | 3300009038 | Vadose Zone Soil | RDDLAPVVTHRFPLEKIEDAFNTIRSGSGLKVVIIP* |
Ga0105098_107692131 | 3300009081 | Freshwater Sediment | THRQYRITMDYLDRRQEDLARVVTHRFQLEEIAQAFETIRSGSGLKTVIVP* |
Ga0105107_108022811 | 3300009087 | Freshwater Sediment | RITMDYLDRKQEVLAAVVTHRWPLEQIADAFETIRSGSGLKMVIVP* |
Ga0099827_109391331 | 3300009090 | Vadose Zone Soil | LGRRRDELAAVVTHRFPLDRIGEAFETIRSGSGLKMVVVP* |
Ga0075418_131374691 | 3300009100 | Populus Rhizosphere | ELAPVVTHQFPLDKIGEAFETIRSGAGLKMVVVP* |
Ga0066709_1040907681 | 3300009137 | Grasslands Soil | ATHRQYRITMDYLDRKQEELARVVTHRFPLDGIAEAFETIRNGTGLKMVIVP* |
Ga0105089_10173101 | 3300009809 | Groundwater Sand | ELAAVVTHRFPLDRIGEAFQTIRSGAGLKMVILP* |
Ga0126313_110182212 | 3300009840 | Serpentine Soil | TTRQYRITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGTGLKMVVVP* |
Ga0126315_111555552 | 3300010038 | Serpentine Soil | YLDRRRDELAPVVTHQFPLDRIDEAFETIRSGSGLKTVVVP* |
Ga0126314_105514332 | 3300010042 | Serpentine Soil | YRITMEYLNRRRKELVPVVTHQFPLERISEAFETIRSGTGLKMVVVP* |
Ga0126306_116797331 | 3300010166 | Serpentine Soil | RQEDLARVVTHRFPLEEIAQAFETIRSGSGLKTVILP* |
Ga0134080_100945181 | 3300010333 | Grasslands Soil | ITMDYLERRRDELASVVTHRFPLAKIGEAFNTIRSGSGLKVVIVQ* |
Ga0126377_118381731 | 3300010362 | Tropical Forest Soil | RRRDELGAVVTHRFPLARIAEAFDTIRSGAGLKMVILP* |
Ga0134125_122633952 | 3300010371 | Terrestrial Soil | YLDRKQDVLASVVTHRFPLDRIAEAFETIRAGTGLKMVIIP* |
Ga0134124_111686842 | 3300010397 | Terrestrial Soil | YLERRRDELAAVVTHRFRLDQIGEAFNTIRSGSGLKVVIVQ* |
Ga0126383_101208111 | 3300010398 | Tropical Forest Soil | ATRRQYRLTMDYLNRRRDELGAVVTHRFPLAEVAEAFETIRSGAGLKMVILP* |
Ga0138513_1000501182 | 3300011000 | Soil | YGATRRQYRITMAYLNRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP* |
Ga0151490_16923152 | 3300011107 | Soil | QDDLARVVTHRFPLDKIAEAFETIRSGTGLKMVILP* |
Ga0137424_10209781 | 3300011412 | Soil | ELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP* |
Ga0120191_101616211 | 3300012022 | Terrestrial | MDYLDRRQEDLARVVTHRFPLEEIAQAFETIRSGSGLKTVILP* |
Ga0137382_100273673 | 3300012200 | Vadose Zone Soil | YLNRRRDELGAVVTHRFPLAQIAEGFDTIRSGAGLKIVIMP* |
Ga0137399_102189871 | 3300012203 | Vadose Zone Soil | DELAAVVTHRFPLDKIGEAFETIRSGSGLKMVVVP* |
Ga0137369_101320171 | 3300012355 | Vadose Zone Soil | RRDELAAVVTHRFPLDGIGEAFQTIRSGAGLKMVILP* |
Ga0137385_102916902 | 3300012359 | Vadose Zone Soil | YRITMDYLERRRKELASVVTHRFPLEKIGEAFNTIRSGAGLKVVIVQ* |
Ga0137390_117911091 | 3300012363 | Vadose Zone Soil | ELAAVVTHRFPLEKIGEAFETIRSGSGLKMVVIP* |
Ga0157285_102861982 | 3300012897 | Soil | DRKQDVLASVVTHRFPLDRIAEAFETIRAGTGLKMVIIP* |
Ga0157283_103024412 | 3300012907 | Soil | DYLARRQDELARVVTHRFPLEQIGEAFDTIRSGTGLKMVIVP* |
Ga0157302_102145181 | 3300012915 | Soil | ELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP* |
Ga0137407_121354222 | 3300012930 | Vadose Zone Soil | YLERRRKELASVVTHRFPLEKIGEAFNTIRSGAGLKVVIVQ* |
Ga0164301_109151722 | 3300012960 | Soil | DELAAVVTHRFPLEKIGEAFETIRSGSGLKMVVIP* |
Ga0157378_100259895 | 3300013297 | Miscanthus Rhizosphere | MDYLDRKQDVLASVVTHRFPLDRIAEAFETIRAGTGLKMVIIP* |
Ga0157378_122665451 | 3300013297 | Miscanthus Rhizosphere | RRRPDLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIIP* |
Ga0157372_134294371 | 3300013307 | Corn Rhizosphere | QYRLTMDYLNRRRDELGAVVTHRFPLAHIAEAFDTIRSGAGLKMVILP* |
Ga0182000_101013142 | 3300014487 | Soil | ITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGTGLKMVVVP* |
Ga0137411_10249331 | 3300015052 | Vadose Zone Soil | MDYLERRRNELAAVVTHRFPLDRIGEAFETIRSGSGLKMVVVP* |
Ga0132256_1012504972 | 3300015372 | Arabidopsis Rhizosphere | AELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP* |
Ga0132255_1013911652 | 3300015374 | Arabidopsis Rhizosphere | YGATHRQYKITMDYLDRRQEELARVVTHRFSLDHIADGFSTIREGTGLKVVILP* |
Ga0134069_12131561 | 3300017654 | Grasslands Soil | RQEELGRVVTHRFPLEGIAEAFETIRTGSGLKMVIVP |
Ga0134112_101284981 | 3300017656 | Grasslands Soil | TMGYLERRRDDLAAVVTHRFPLGAIAEAFETIRSGTGLKMVIEP |
Ga0184608_100071771 | 3300018028 | Groundwater Sediment | ATRRQYRITMAYLNRRRDELAPVVTHLFPLDKIGEAFETIHSGEGLKMVVVP |
Ga0184608_100853891 | 3300018028 | Groundwater Sediment | KEDLARVVTHRFPLEDIAEAFETIRSGSGLKTVILP |
Ga0187787_102737442 | 3300018029 | Tropical Peatland | LNRRRIDLEGVVTHRFSLEHIAEAFETIRSGTGLKMVILP |
Ga0184634_101328241 | 3300018031 | Groundwater Sediment | RQYRITMDYLNRRRDDLGRIVTHRFPLDRIAEAFATIRAGTGLKMVIEPGATA |
Ga0184623_104200461 | 3300018056 | Groundwater Sediment | QYRITMDYLARKQEELAKVVTHRWPLEKIAEAFETIRSGTGLKMVIVP |
Ga0184618_104040681 | 3300018071 | Groundwater Sediment | MAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0184633_102044731 | 3300018077 | Groundwater Sediment | ATRRQYRITMAYLNRRRDELAPVVTHLFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0184612_104363962 | 3300018078 | Groundwater Sediment | ITMDYLDRRRDDLAGVVTHRYPLDRIQEAFETIRQGTGLKMVILP |
Ga0184625_101774962 | 3300018081 | Groundwater Sediment | RDDLGRIVTHRFPLDRIAEAFATIRAGTGLKMVIEPGASA |
Ga0190265_128229121 | 3300018422 | Soil | KQDELASVVTHRWPLEKIAEAFETIRAGTGLKMVVMP |
Ga0066655_101208492 | 3300018431 | Grasslands Soil | LERRRDELASVVTHRFPLDRIDEAFKTIRSGSGLKVVIVQ |
Ga0066667_108764131 | 3300018433 | Grasslands Soil | RDELASVVTHRFPLDRIDEAFNTIRSGSGLKVVIVQ |
Ga0190268_101662542 | 3300018466 | Soil | ATRRHYRTTMAYLARRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0066662_126951502 | 3300018468 | Grasslands Soil | TMDYLERRRDELASVVTHRFPLDRIDEAFNTIRSGSGLKVVIVQ |
Ga0190271_137705361 | 3300018481 | Soil | RGAYGATHRQYRITMDYLDRKQALLAAVVTHRWPLEQIGEAFETIRSGSGLKMVIVP |
Ga0173482_104418711 | 3300019361 | Soil | HMDYLARRRDDLAGVVTHRFPLDRIAEAFETIRSGAGLKMVIVP |
Ga0173479_103391812 | 3300019362 | Soil | TMDYLARRQDELARVVTHRFPLERIGEAFDTIRSGTGLKMVIVP |
Ga0190264_108542031 | 3300019377 | Soil | YLSRRRGALAPVVTHRFPLDKIDEAFETIRSGAGLKTVVVP |
Ga0190264_120972601 | 3300019377 | Soil | QYRITMDYLDRKQDELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP |
Ga0193739_10124643 | 3300020003 | Soil | RRQEELARVVTHLFPLDDIAQAFETIRSGAGLKVVILP |
Ga0222623_103805711 | 3300022694 | Groundwater Sediment | TRRQYQITMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0247800_10515492 | 3300023263 | Soil | RITMDYLDRRQEDLARVVTHRFPLEDIAQAFETIRSGSGLKTVIVP |
Ga0209109_102387391 | 3300025160 | Soil | MGYLYRRQDELGQVVTHRFSLEHIAEAFETIHSGAGLKMVILP |
Ga0209321_104608763 | 3300025312 | Soil | QYRITMGYLDRRQDELGQVVTHRFSLEHIAEAFETIHSGAGLKMVILP |
Ga0209431_102209981 | 3300025313 | Soil | QEELAKVVTHRWPLERIAEAFETIRAGTGLKMVIVP |
Ga0207649_104243401 | 3300025920 | Corn Rhizosphere | DRRQEDLARVVTHRFPLEDIAQAFETIRSGTGLKTVIVP |
Ga0207704_113939612 | 3300025938 | Miscanthus Rhizosphere | RRQEELARMVTHRFGLDGIAEAFETIRSGTGLKVVVVP |
Ga0207661_121108302 | 3300025944 | Corn Rhizosphere | MDYLDRKQEALARVVTHRFPLERIGEAFETIRAGTGLKMVIVP |
Ga0210089_10240292 | 3300025957 | Natural And Restored Wetlands | RQYRITMDYLDRKQDELAAVVTHRWPLEHIADAFETIRAGTGLKMVIVP |
Ga0208293_10160722 | 3300026050 | Natural And Restored Wetlands | YKELDIRGAYGATHRQYRITMDYLDRKQELLAAVVTHRWPLEQIAEAFETIRSGSGLKMVIVP |
Ga0207641_110193362 | 3300026088 | Switchgrass Rhizosphere | TRRQYRLTMDYLNRRRDELGAVVTHRFPLAHIAEAFDTIRSGAGLKMVILP |
Ga0207675_1008970001 | 3300026118 | Switchgrass Rhizosphere | RITMDYLDRRQDDLARVVTHRFPLDKIAEAFETIRSGTGLKMVILP |
Ga0209236_11727001 | 3300026298 | Grasslands Soil | RRRRDELAAVVTHRFPLDRIGDAFETIRSGAGLKVVMLP |
Ga0209471_12667912 | 3300026318 | Soil | LRRRRDQLAAVVTHRFPLDRIGDAFETIRSGTGLKVVMLP |
Ga0256867_102712522 | 3300026535 | Soil | RQEDLARVVTHRFPLDDIAQAFETIRSGAGLKMVILP |
Ga0209157_12626291 | 3300026537 | Soil | YRITMDYLERRRDELASVVTHRFPLAKIGEAFNTIRSGSGLKVVIVQ |
Ga0209577_108273522 | 3300026552 | Soil | GATHRQYGITMGYLDRRQDELGRIVTHRLPLEEIPRAFETIRSGTGLKVVVLP |
Ga0209879_10220642 | 3300027056 | Groundwater Sand | RDQLAAVVTHRFPLERIGEAFETIRSGAGLKMVIQP |
Ga0209845_10236611 | 3300027324 | Groundwater Sand | TRAERIVTHRFPLERIAEGFDTIRDGSGLKVVIRP |
Ga0207482_1056921 | 3300027456 | Soil | RQDDLARVVTHRFPLDKIAEAFETIRSGTGLKMVILP |
Ga0209588_12248342 | 3300027671 | Vadose Zone Soil | THRQYRITMDYLRRRRDELAAVVTHRFPLDQIGDAFETIRSGAGLKIVMLP |
Ga0209811_104012612 | 3300027821 | Surface Soil | THRQYGITMDYLDRKQDELAKVVTNRWPLEKIAEAFETIRAGTGLKMVIVP |
Ga0209481_100740331 | 3300027880 | Populus Rhizosphere | AYGATHRQYRITMDYLDRRQEELARVVTHRFSLDHIAQAFETIRDGSGLKMVILP |
Ga0209853_10349722 | 3300027961 | Groundwater Sand | RRDQLAAVVTHRFPLDGIAEAFETIRSGAGLKMVIQP |
Ga0268265_121539371 | 3300028380 | Switchgrass Rhizosphere | YGATRRQYRITMAYLNRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0137415_109040502 | 3300028536 | Vadose Zone Soil | NRRRDDLAAVVTHRFPLDRIGEAFETIRSGSGLKMVVVP |
Ga0272482_103263782 | 3300028578 | Soil | RITMDYLHRRRQELAPVVTHRFQLDEIDDAFETIRGGTGLKAVVVP |
Ga0247820_113607901 | 3300028597 | Soil | TELAPVVTHQFPLDKIGEAFETIRSGAGLKMVVVP |
Ga0307276_101976921 | 3300028705 | Soil | AYGATRRQYRITMAYLNRRRDELAPVVTHQFPLERIDEAFETIRSGAGLKMVVVP |
Ga0307313_101980281 | 3300028715 | Soil | ATRRHYRITMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0307298_100391911 | 3300028717 | Soil | ITMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0307319_103376861 | 3300028722 | Soil | LDRRQEDLARVVTHRFPLEEIAQAFETIRSGSGLKTVIVP |
Ga0307290_101831252 | 3300028791 | Soil | LGAYGATHRQYRITMDYLARKQEELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP |
Ga0307284_100077681 | 3300028799 | Soil | DYLDRRQDDLARVVTHRFPLDKIAEAFETIRSGTGLKMVILP |
Ga0307302_100559813 | 3300028814 | Soil | RRRNELAAVVTHRFPLEAIGEAFETIRSGAGLKMVILP |
Ga0307312_104328281 | 3300028828 | Soil | LDRRQEDLARVVTHRFPLEEIAQAFETIRSGSGLKTVILP |
Ga0307277_100103504 | 3300028881 | Soil | YGATTRQYRITMDYLNRRRKELAPVVTHQFPLDRIGEAFETIRAGTGLKMVVVP |
Ga0307277_101655562 | 3300028881 | Soil | ITMDYLARRQDELARVVTHRFPLERIGEAFDTIRSGTGLKMVIVP |
Ga0307277_102926702 | 3300028881 | Soil | QYRITMDYLNRRRKELAPVVTHQFPLERIGEAFETIRAGTGLKMVVVP |
Ga0307308_105103862 | 3300028884 | Soil | RREDLQGVVTHRFPLERIAEAFETIRSGAGLKMVIIP |
Ga0307304_101259712 | 3300028885 | Soil | AELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP |
Ga0247826_116263432 | 3300030336 | Soil | QYRITMDYLDRRQEDLARVVTHRFPLEDIAQAFETIRSGSGLKAVILP |
Ga0268255_102264501 | 3300030516 | Agave | MAYLNRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0302046_103287891 | 3300030620 | Soil | KEDLAPVVTHRFPLERIDEAFGTIRAGTGLKMVIVP |
Ga0299914_105773712 | 3300031228 | Soil | DYLHRRRQELAPVVTHRFQLDEIGDAFETIRSGTGLKAVVVP |
Ga0307408_1003398012 | 3300031548 | Rhizosphere | LDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0307405_100006701 | 3300031731 | Rhizosphere | YLNRRRKELAPVVTHQFPLERIGEAFETIRSGTGLKMVVVP |
Ga0307413_102968551 | 3300031824 | Rhizosphere | RRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP |
Ga0307413_106986881 | 3300031824 | Rhizosphere | YGATTRQYRITMEYLNRRRKELAPVVTHQFPLERISEAFETIRSGTGLKMVVVP |
Ga0307413_118048531 | 3300031824 | Rhizosphere | GATTRQYRITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGAGLKMVVVP |
Ga0310907_100549282 | 3300031847 | Soil | TMDYLDRKQDELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP |
Ga0307406_121400882 | 3300031901 | Rhizosphere | EDLARVVTHRFPLEEIGQAFETIRSGSGLKTVILP |
Ga0326597_106542061 | 3300031965 | Soil | EDLEGVVTHRFPLEQIADAFETIRSGAGLKIVIVP |
Ga0326597_120545071 | 3300031965 | Soil | MDYLDRKQEELARVVTHRWPLEQIGEAFETIRAGTGLKMVIVP |
Ga0307409_1003263981 | 3300031995 | Rhizosphere | GATTRQYRITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGTGLKMVVVP |
Ga0307409_1029576002 | 3300031995 | Rhizosphere | AYGATHRQYRITMDYLDRKQDQLARVVTHRWPLEKIAEAFETIRAGTGLKMVIVP |
Ga0307416_1032437461 | 3300032002 | Rhizosphere | ELDILGAYGATHRQYRITMDYLDRKQDVLAAVVTHRWPLDQIADAFETIRSGTGLKMVIV |
Ga0307411_109866482 | 3300032005 | Rhizosphere | YLDRRRDELAPVVTHQFPLDKIGEAFETLRSGEGLKMVVVP |
Ga0310906_109393892 | 3300032013 | Soil | HRQYRITMDYLDRRQDELAKVVTHRWPLEKIAEAFETIRAGTGLKMVIVP |
Ga0310890_109172612 | 3300032075 | Soil | THRQYRITMDYLDRKQDELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP |
Ga0326721_104705841 | 3300032080 | Soil | DVLAPVVTHRFPLERIEDAFATIRDGTGLKMVIVP |
Ga0307415_1021615392 | 3300032126 | Rhizosphere | RRRKELAPVVTHQFPLERIGEAFETIRSGAGLKMVVVP |
Ga0268251_103851021 | 3300032159 | Agave | RQYRITMDYLDRRRDDLAAVVTHRFPLDRIAEAFETIRAGTGLKMVIQP |
Ga0315283_110545761 | 3300032164 | Sediment | EDLEGVVTHRFPLEQIADAFETIRSGTGLKMVIIP |
Ga0214471_109001892 | 3300033417 | Soil | YLNRRRDDLGRIVTHRFPLDRIAEAFATIRAGTGLKMVIEPGASA |
Ga0364924_074782_590_721 | 3300033811 | Sediment | MDYLDRRQEDLARVVTHRFPLDDIAQAFETIRSGAGLKMVILP |
Ga0364938_083087_411_554 | 3300034114 | Sediment | MDYLNRRRDDLGRIVTHRFPLDRIAEAFATIRAGTGLKMVIEPGASA |
Ga0364933_181750_2_160 | 3300034150 | Sediment | ATRRQYQITMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGAGLKMVVVP |
Ga0334913_010763_2061_2189 | 3300034172 | Sub-Biocrust Soil | DYLNRRREELAAVVTHRFPLEAIGEAFQTIRSGAGLKMVIVP |
⦗Top⦘ |