NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029547

Metagenome / Metatranscriptome Family F029547

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029547
Family Type Metagenome / Metatranscriptome
Number of Sequences 188
Average Sequence Length 44 residues
Representative Sequence MDYLDRRQEDLARVVTHRFPLDRIAEAFETIRSGTGLKMVIVP
Number of Associated Samples 173
Number of Associated Scaffolds 188

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.60 %
% of genes near scaffold ends (potentially truncated) 95.74 %
% of genes from short scaffolds (< 2000 bps) 90.96 %
Associated GOLD sequencing projects 167
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.957 % of family members)
Environment Ontology (ENVO) Unclassified
(26.064 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.681 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.80%    β-sheet: 11.27%    Coil/Unstructured: 54.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 188 Family Scaffolds
PF00370FGGY_N 77.66
PF02782FGGY_C 15.43
PF00120Gln-synt_C 0.53
PF00582Usp 0.53
PF13561adh_short_C2 0.53
PF07722Peptidase_C26 0.53
PF13847Methyltransf_31 0.53
PF09250Prim-Pol 0.53
PF00107ADH_zinc_N 0.53
PF00005ABC_tran 0.53
PF00903Glyoxalase 0.53
PF01872RibD_C 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 188 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.53
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309009|GPKNP_GG3DY5402F0C5VAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300000858|JGI10213J12805_10869394All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300000891|JGI10214J12806_12547602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia519Open in IMG/M
3300000956|JGI10216J12902_111047694All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300000956|JGI10216J12902_112615424All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300002908|JGI25382J43887_10495643All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300002916|JGI25389J43894_1039228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia815Open in IMG/M
3300003373|JGI25407J50210_10020158All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300004061|Ga0055487_10002436All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300004114|Ga0062593_101074935All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300004156|Ga0062589_101573879All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300004157|Ga0062590_101032474All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300004281|Ga0066397_10137524All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005171|Ga0066677_10142466All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300005177|Ga0066690_10430371All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300005180|Ga0066685_10668994All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300005186|Ga0066676_10991555All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005187|Ga0066675_10902833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300005206|Ga0068995_10124033All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005332|Ga0066388_105919692All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005441|Ga0070700_101254700All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005446|Ga0066686_10357942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales996Open in IMG/M
3300005446|Ga0066686_11136199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300005451|Ga0066681_10803019All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300005456|Ga0070678_100282016All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300005518|Ga0070699_101655201All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005537|Ga0070730_10940685All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005546|Ga0070696_100194762All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300005547|Ga0070693_100422392All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300005553|Ga0066695_10590740All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005556|Ga0066707_10875511All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005569|Ga0066705_10323180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales976Open in IMG/M
3300005576|Ga0066708_10351429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales946Open in IMG/M
3300005586|Ga0066691_10831209All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300005614|Ga0068856_100199194All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300005618|Ga0068864_100152054All Organisms → cellular organisms → Bacteria2097Open in IMG/M
3300005764|Ga0066903_105752287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300005841|Ga0068863_100979357All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300005873|Ga0075287_1034083All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005874|Ga0075288_1064576All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005981|Ga0081538_10014636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces6133Open in IMG/M
3300005981|Ga0081538_10057098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2279Open in IMG/M
3300006034|Ga0066656_10234943All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300006169|Ga0082029_1791916All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300006173|Ga0070716_101621215All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006573|Ga0074055_10977503All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300006577|Ga0074050_10020880All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006800|Ga0066660_10086430All Organisms → cellular organisms → Bacteria2178Open in IMG/M
3300006806|Ga0079220_10702551All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300006844|Ga0075428_100168388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2376Open in IMG/M
3300006844|Ga0075428_101779275All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006854|Ga0075425_100780160All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300006880|Ga0075429_100063804All Organisms → cellular organisms → Bacteria3209Open in IMG/M
3300006904|Ga0075424_100477943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1330Open in IMG/M
3300006904|Ga0075424_102359710All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300006918|Ga0079216_10920409All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006969|Ga0075419_10481963All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300006969|Ga0075419_11161633All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300007070|Ga0073929_1014871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1748Open in IMG/M
3300009012|Ga0066710_103774221All Organisms → cellular organisms → Bacteria → Terrabacteria group569Open in IMG/M
3300009038|Ga0099829_10169857All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300009081|Ga0105098_10769213All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300009087|Ga0105107_10802281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300009090|Ga0099827_10939133All Organisms → cellular organisms → Bacteria → Terrabacteria group750Open in IMG/M
3300009100|Ga0075418_13137469All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009137|Ga0066709_104090768All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300009809|Ga0105089_1017310All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300009840|Ga0126313_11018221All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300010038|Ga0126315_11155555All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010042|Ga0126314_10551433All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300010166|Ga0126306_11679733All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300010333|Ga0134080_10094518All Organisms → cellular organisms → Bacteria → Terrabacteria group1223Open in IMG/M
3300010362|Ga0126377_11838173All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010371|Ga0134125_12263395All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300010397|Ga0134124_11168684All Organisms → cellular organisms → Bacteria → Terrabacteria group788Open in IMG/M
3300010398|Ga0126383_10120811All Organisms → cellular organisms → Bacteria2387Open in IMG/M
3300011000|Ga0138513_100050118All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300011107|Ga0151490_1692315All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300011412|Ga0137424_1020978All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300012022|Ga0120191_10161621All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012200|Ga0137382_10027367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3362Open in IMG/M
3300012203|Ga0137399_10218987All Organisms → cellular organisms → Bacteria → Terrabacteria group1552Open in IMG/M
3300012355|Ga0137369_10132017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2005Open in IMG/M
3300012359|Ga0137385_10291690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1405Open in IMG/M
3300012363|Ga0137390_11791109All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300012897|Ga0157285_10286198All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300012907|Ga0157283_10302441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300012915|Ga0157302_10214518All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300012930|Ga0137407_12135422All Organisms → cellular organisms → Bacteria → Terrabacteria group535Open in IMG/M
3300012960|Ga0164301_10915172All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300013297|Ga0157378_10025989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5160Open in IMG/M
3300013297|Ga0157378_12266545All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300013307|Ga0157372_13429437All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300014487|Ga0182000_10101314All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300015052|Ga0137411_1024933All Organisms → cellular organisms → Bacteria → Terrabacteria group804Open in IMG/M
3300015372|Ga0132256_101250497All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300015374|Ga0132255_101391165All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300017654|Ga0134069_1213156All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300017656|Ga0134112_10128498All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300018028|Ga0184608_10007177All Organisms → cellular organisms → Bacteria3674Open in IMG/M
3300018028|Ga0184608_10085389All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300018029|Ga0187787_10273744All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018031|Ga0184634_10132824All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300018056|Ga0184623_10420046All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300018071|Ga0184618_10404068All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300018077|Ga0184633_10204473All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300018078|Ga0184612_10436396All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300018081|Ga0184625_10177496All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300018422|Ga0190265_12822912All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300018431|Ga0066655_10120849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1505Open in IMG/M
3300018433|Ga0066667_10876413All Organisms → cellular organisms → Bacteria → Terrabacteria group770Open in IMG/M
3300018466|Ga0190268_10166254All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300018468|Ga0066662_12695150All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300018481|Ga0190271_13770536All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300019361|Ga0173482_10441871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300019362|Ga0173479_10339181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium701Open in IMG/M
3300019377|Ga0190264_10854203All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300019377|Ga0190264_12097260All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300020003|Ga0193739_1012464All Organisms → cellular organisms → Bacteria2227Open in IMG/M
3300022694|Ga0222623_10380571All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300023263|Ga0247800_1051549All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300025160|Ga0209109_10238739All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300025312|Ga0209321_10460876All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300025313|Ga0209431_10220998All Organisms → cellular organisms → Bacteria1495Open in IMG/M
3300025920|Ga0207649_10424340All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300025938|Ga0207704_11393961All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025944|Ga0207661_12110830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300025957|Ga0210089_1024029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300026050|Ga0208293_1016072All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300026088|Ga0207641_11019336All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300026118|Ga0207675_100897000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium903Open in IMG/M
3300026298|Ga0209236_1172700All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300026318|Ga0209471_1266791All Organisms → cellular organisms → Bacteria → Terrabacteria group577Open in IMG/M
3300026535|Ga0256867_10271252All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300026537|Ga0209157_1262629All Organisms → cellular organisms → Bacteria → Terrabacteria group662Open in IMG/M
3300026552|Ga0209577_10827352All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300027056|Ga0209879_1022064All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300027324|Ga0209845_1023661All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300027456|Ga0207482_105692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300027671|Ga0209588_1224834All Organisms → cellular organisms → Bacteria → Terrabacteria group579Open in IMG/M
3300027821|Ga0209811_10401261All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300027880|Ga0209481_10074033All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300027961|Ga0209853_1034972All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300028380|Ga0268265_12153937All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300028536|Ga0137415_10904050All Organisms → cellular organisms → Bacteria → Terrabacteria group693Open in IMG/M
3300028578|Ga0272482_10326378All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300028597|Ga0247820_11360790All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300028705|Ga0307276_10197692All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300028715|Ga0307313_10198028All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300028717|Ga0307298_10039191All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300028722|Ga0307319_10337686All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300028791|Ga0307290_10183125All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300028799|Ga0307284_10007768All Organisms → cellular organisms → Bacteria3100Open in IMG/M
3300028814|Ga0307302_10055981All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300028828|Ga0307312_10432828All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300028881|Ga0307277_10010350All Organisms → cellular organisms → Bacteria3590Open in IMG/M
3300028881|Ga0307277_10165556All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300028881|Ga0307277_10292670All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300028884|Ga0307308_10510386All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300028885|Ga0307304_10125971All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300030336|Ga0247826_11626343All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300030516|Ga0268255_10226450All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300030620|Ga0302046_10328789All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300031228|Ga0299914_10577371All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300031548|Ga0307408_100339801All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300031731|Ga0307405_10000670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13228Open in IMG/M
3300031824|Ga0307413_10296855All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300031824|Ga0307413_10698688All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300031824|Ga0307413_11804853All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300031847|Ga0310907_10054928All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300031901|Ga0307406_12140088All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031965|Ga0326597_10654206All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300031965|Ga0326597_12054507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300031995|Ga0307409_100326398All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300031995|Ga0307409_102957600All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300032002|Ga0307416_103243746All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300032005|Ga0307411_10986648All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300032013|Ga0310906_10939389All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300032075|Ga0310890_10917261All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300032080|Ga0326721_10470584All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300032126|Ga0307415_102161539All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300032159|Ga0268251_10385102All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032164|Ga0315283_11054576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium857Open in IMG/M
3300033417|Ga0214471_10900189All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300033811|Ga0364924_074782All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300034114|Ga0364938_083087All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300034150|Ga0364933_181750All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300034172|Ga0334913_010763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2189Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.66%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.13%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.13%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.60%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.60%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere1.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.06%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.06%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.06%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.06%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.06%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.06%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.53%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.53%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.53%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.53%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.53%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.53%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.53%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.53%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.53%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309009Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300004061Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005206Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007070Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC2 2012 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026050Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027456Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-E (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028578Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030516Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034114Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPKNP_046030902070309009SoilITMDYLDRRQDDLARVVTHRFPLDRIAEAFETIRAGTGLKMVILP
JGI10213J12805_1086939423300000858SoilYRITMDYLNRRRDELAAVVTHRFPLDGIAEAFETIRSGAGLKMVIVP*
JGI10214J12806_1254760213300000891SoilHRQYRITMDYLARRQDELARVVTHRFPLEQIGEAFDTIRSGTGLKMVIVP*
JGI10216J12902_11104769413300000956SoilDYLDRKQDVLAAVVTHRWPLEQIGEAFETIRSGSGLKMVIVP*
JGI10216J12902_11261542413300000956SoilRQYRITMDYLDRKQDELAAVVTHRWPLDRIGEAFETIRAGTGLKMVIVP*
JGI25382J43887_1049564313300002908Grasslands SoilLRRRRDELAAVVTHRFPLDQIGDAFETIRSGAGLKIVMLP*
JGI25389J43894_103922813300002916Grasslands SoilMDYLERRRDELASVVTHRFPLDRIDEAFNTIRSGSGLKVVIVQ*
JGI25407J50210_1002015823300003373Tabebuia Heterophylla RhizosphereMDYLNRRRKELAPVVTHQFPLERIDEAFETIRSGTGLKMVVVP*
Ga0055487_1000243613300004061Natural And Restored WetlandsITMDYLDRKQELLAAVVTHRWPLEQIAEAFETIRSGSGLKMVIVP*
Ga0062593_10107493523300004114SoilTHRQYRITMDYLDRRQEELARVVTHRFSLDHIAEGFSTIREGTGLKVVILP*
Ga0062589_10157387923300004156SoilTMDYLDRKQEALARVVTHRFPLERIGEAFETIRAGTGLKMVIVP*
Ga0062590_10103247413300004157SoilITMDYLARRRDDLAAVVTHRFPLDRIEEAFETIRAGAGLKMVILP*
Ga0066397_1013752413300004281Tropical Forest SoilMDYLNRRRDELGAVVTHRFPLAEVAEAFETIRSGAGLKMVILP*
Ga0066677_1014246623300005171SoilDYLDRRQDDLARVVTHRFPLDRIAEAFETIRSGTGLKMVILP*
Ga0066690_1043037113300005177SoilMDYLERRRDELASVVTHRFPLAKIGEAFNTIRSGSGLKVVIVQ*
Ga0066685_1066899423300005180SoilDRRQEELGRVVTHRFPLEGIAEAFETIRTGSGLKMVIVP*
Ga0066676_1099155513300005186SoilMDYLDRRQEDLARVVTHRFPLDRIAEAFETIRSGTGLKMVIVP*
Ga0066675_1090283313300005187SoilITMDYLRRRRDQLAAVVTHRFPLDRIGDAFETIRSGTGLKVVMLP*
Ga0068995_1012403323300005206Natural And Restored WetlandsMDYLNRRREDLEGVVTHRFPLEQIADAFETIRSGAGLKMVIVP*
Ga0066388_10591969223300005332Tropical Forest SoilGAYGATHRQYRITMDYLDRKQDQLAAVVTHRWPLERIAEAFETIRDGTGLKMVIVP*
Ga0070700_10125470013300005441Corn, Switchgrass And Miscanthus RhizosphereTMDYLDRRQEDLARVVTHRFPLEDIAEAFETIRSGSGLKTVILP*
Ga0066686_1035794213300005446SoilDYLERRRDELASVVTHRFPLERIGEAFNTIRSGSGLKVVIVQ*
Ga0066686_1113619923300005446SoilYLRRRRDELAAVVTHRFPLDRIGDAFETIRSGAGLKVVMLP*
Ga0066681_1080301923300005451SoilGATHRQYRITMDYLRRRRDELAAVVTHRFPLDQIGVAFETIRSGAGLKVVMLP*
Ga0070678_10028201623300005456Miscanthus RhizosphereTHRQYRITMDYLDRKQDVLASVVTHRFPLDRIAEAFETIRAGTGLKMVIIP*
Ga0070699_10165520113300005518Corn, Switchgrass And Miscanthus RhizosphereRITMDYLNRRRDDLTAVVTHRFPLERIGDAFETIRSGAGLKMVILP*
Ga0070730_1094068523300005537Surface SoilRDELGGVVTHRFPLEQIEEAFSTIRSGGGLNLVIEP*
Ga0070696_10019476213300005546Corn, Switchgrass And Miscanthus RhizosphereQYRITMDYLNRRRPDLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIIP*
Ga0070693_10042239213300005547Corn, Switchgrass And Miscanthus RhizosphereTMDYLNRRRAELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP*
Ga0066695_1059074023300005553SoilQYRITMDYLERRRDELASVVTHRFPLDKIDEAFNTIRSGSGLKVVIVQ*
Ga0066707_1087551123300005556SoilMDYLERRRDELASVVTHRFPLERIGEAFNTIRSGSGLKVVIVQ*
Ga0066705_1032318023300005569SoilRQDDLARVVTHRFPLDRIAEAFETIRSGTGLKMVILP*
Ga0066708_1035142913300005576SoilRDELASVVTHRFPLEKIDEAFNTIRSGSGLKVVIVQ*
Ga0066691_1083120923300005586SoilQYRITMDYLRRRRDELAAVVTHRFPLDRIGDAFETIRSGAGLKVVMLP*
Ga0068856_10019919433300005614Corn RhizosphereMDYLNRRRAELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP*
Ga0068864_10015205433300005618Switchgrass RhizosphereDRRQEELARVVTHRFPLEDIAQAFETIRSGTGLKTVIVP*
Ga0066903_10575228713300005764Tropical Forest SoilQYRITMDYLNRRRDDLAPVVTHRFGLDRIAEAFETIRSGTGLKTVVIP*
Ga0068863_10097935713300005841Switchgrass RhizosphereDLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIIP*
Ga0075287_103408323300005873Rice Paddy SoilDLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIVP*
Ga0075288_106457613300005874Rice Paddy SoilTMDYLDRRRDELAPVVTHRFPLGEIEQAFETIRSGAGLKAVIEP*
Ga0081538_1001463613300005981Tabebuia Heterophylla RhizosphereRQYRITMDYLNRRRKELAPVVTHQFPLERIDEAFETIRSGTGLKMVVVP*
Ga0081538_1005709833300005981Tabebuia Heterophylla RhizosphereMDYLHRRRDTLAPVVTHQFPLDKVGEAFETIRSGAGLKLVVVP*
Ga0066656_1023494323300006034SoilQYRITMDYLERRRDELASVVTHRFPLERIGEAFNTIRSGSGLKVVIVQ*
Ga0082029_179191613300006169Termite NestRQYRITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGAGLKMVVVP*
Ga0070716_10162121513300006173Corn, Switchgrass And Miscanthus RhizosphereHRQYRITMDYLNRRRDDLAPVVTHRFELDRIAEAFETIRSGTGLKTVVIP*
Ga0074055_1097750323300006573SoilNRRRPDLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIIP*
Ga0074050_1002088013300006577SoilEDLARVVTHRFPLEEIAQAFETIRSGAGLKTVILP*
Ga0066660_1008643013300006800SoilRRDELASVVTHRFPLERIGEAFNTIRSGSGLKVVIVQ*
Ga0079220_1070255133300006806Agricultural SoilLNRRRDELGAVVTHRFPLAHIAEAFDTIRSGAGLKMVILP*
Ga0075428_10016838843300006844Populus RhizosphereGAYGATHRQYRITMGYLDRRRDELAPVVTHQFPLERIDEAFETIRSGAGLKMVVVP*
Ga0075428_10177927513300006844Populus RhizosphereTHRQYRITMDYLARKQDELAKVVTHRWPLEKIAEAFETIRAGNGLKMVVMP*
Ga0075425_10078016013300006854Populus RhizosphereTMDYLNRRRDELGAVVTHRFPLARIAEAFDTIRSGAGLKMVILP*
Ga0075429_10006380413300006880Populus RhizosphereDRRQEDLARVVTHRFPLEDIAEAFETIRSGSGLKTVILP*
Ga0075424_10047794313300006904Populus RhizosphereYGATHRQYRITMGYLNRRRHELAPVVTHQFPLDRIDEAFETIRSGAGLKTVVVP*
Ga0075424_10235971023300006904Populus RhizosphereRRDELASVVTHRFPLERIDEAFNTIRSGSGLKVVIVQ*
Ga0079216_1092040913300006918Agricultural SoilATHRQYRITMDYLARKQEELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVLP*
Ga0075419_1048196323300006969Populus RhizosphereITMDYLDRRQEDLARVVTHRFPLDDIAQAFETIRSGAGLKMVILP*
Ga0075419_1116163323300006969Populus RhizosphereELGAVVTHRFPLSQIAEAFDTIRSGAGLKMVILP*
Ga0073929_101487113300007070Hot Spring SedimentQYRITMDYLARRREELAGVVTHRLPLERIGEGFEAIRSGAALKVVIEP*
Ga0066710_10377422113300009012Grasslands SoilRRDELASVVTHRFPLDKIDEAFNTIRSGSGLKVVIVQ
Ga0099829_1016985713300009038Vadose Zone SoilRDDLAPVVTHRFPLEKIEDAFNTIRSGSGLKVVIIP*
Ga0105098_1076921313300009081Freshwater SedimentTHRQYRITMDYLDRRQEDLARVVTHRFQLEEIAQAFETIRSGSGLKTVIVP*
Ga0105107_1080228113300009087Freshwater SedimentRITMDYLDRKQEVLAAVVTHRWPLEQIADAFETIRSGSGLKMVIVP*
Ga0099827_1093913313300009090Vadose Zone SoilLGRRRDELAAVVTHRFPLDRIGEAFETIRSGSGLKMVVVP*
Ga0075418_1313746913300009100Populus RhizosphereELAPVVTHQFPLDKIGEAFETIRSGAGLKMVVVP*
Ga0066709_10409076813300009137Grasslands SoilATHRQYRITMDYLDRKQEELARVVTHRFPLDGIAEAFETIRNGTGLKMVIVP*
Ga0105089_101731013300009809Groundwater SandELAAVVTHRFPLDRIGEAFQTIRSGAGLKMVILP*
Ga0126313_1101822123300009840Serpentine SoilTTRQYRITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGTGLKMVVVP*
Ga0126315_1115555523300010038Serpentine SoilYLDRRRDELAPVVTHQFPLDRIDEAFETIRSGSGLKTVVVP*
Ga0126314_1055143323300010042Serpentine SoilYRITMEYLNRRRKELVPVVTHQFPLERISEAFETIRSGTGLKMVVVP*
Ga0126306_1167973313300010166Serpentine SoilRQEDLARVVTHRFPLEEIAQAFETIRSGSGLKTVILP*
Ga0134080_1009451813300010333Grasslands SoilITMDYLERRRDELASVVTHRFPLAKIGEAFNTIRSGSGLKVVIVQ*
Ga0126377_1183817313300010362Tropical Forest SoilRRRDELGAVVTHRFPLARIAEAFDTIRSGAGLKMVILP*
Ga0134125_1226339523300010371Terrestrial SoilYLDRKQDVLASVVTHRFPLDRIAEAFETIRAGTGLKMVIIP*
Ga0134124_1116868423300010397Terrestrial SoilYLERRRDELAAVVTHRFRLDQIGEAFNTIRSGSGLKVVIVQ*
Ga0126383_1012081113300010398Tropical Forest SoilATRRQYRLTMDYLNRRRDELGAVVTHRFPLAEVAEAFETIRSGAGLKMVILP*
Ga0138513_10005011823300011000SoilYGATRRQYRITMAYLNRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP*
Ga0151490_169231523300011107SoilQDDLARVVTHRFPLDKIAEAFETIRSGTGLKMVILP*
Ga0137424_102097813300011412SoilELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP*
Ga0120191_1016162113300012022TerrestrialMDYLDRRQEDLARVVTHRFPLEEIAQAFETIRSGSGLKTVILP*
Ga0137382_1002736733300012200Vadose Zone SoilYLNRRRDELGAVVTHRFPLAQIAEGFDTIRSGAGLKIVIMP*
Ga0137399_1021898713300012203Vadose Zone SoilDELAAVVTHRFPLDKIGEAFETIRSGSGLKMVVVP*
Ga0137369_1013201713300012355Vadose Zone SoilRRDELAAVVTHRFPLDGIGEAFQTIRSGAGLKMVILP*
Ga0137385_1029169023300012359Vadose Zone SoilYRITMDYLERRRKELASVVTHRFPLEKIGEAFNTIRSGAGLKVVIVQ*
Ga0137390_1179110913300012363Vadose Zone SoilELAAVVTHRFPLEKIGEAFETIRSGSGLKMVVIP*
Ga0157285_1028619823300012897SoilDRKQDVLASVVTHRFPLDRIAEAFETIRAGTGLKMVIIP*
Ga0157283_1030244123300012907SoilDYLARRQDELARVVTHRFPLEQIGEAFDTIRSGTGLKMVIVP*
Ga0157302_1021451813300012915SoilELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP*
Ga0137407_1213542223300012930Vadose Zone SoilYLERRRKELASVVTHRFPLEKIGEAFNTIRSGAGLKVVIVQ*
Ga0164301_1091517223300012960SoilDELAAVVTHRFPLEKIGEAFETIRSGSGLKMVVIP*
Ga0157378_1002598953300013297Miscanthus RhizosphereMDYLDRKQDVLASVVTHRFPLDRIAEAFETIRAGTGLKMVIIP*
Ga0157378_1226654513300013297Miscanthus RhizosphereRRRPDLEGVVTHRFPLEQIGEAFETIRSGAGLKMVIIP*
Ga0157372_1342943713300013307Corn RhizosphereQYRLTMDYLNRRRDELGAVVTHRFPLAHIAEAFDTIRSGAGLKMVILP*
Ga0182000_1010131423300014487SoilITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGTGLKMVVVP*
Ga0137411_102493313300015052Vadose Zone SoilMDYLERRRNELAAVVTHRFPLDRIGEAFETIRSGSGLKMVVVP*
Ga0132256_10125049723300015372Arabidopsis RhizosphereAELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP*
Ga0132255_10139116523300015374Arabidopsis RhizosphereYGATHRQYKITMDYLDRRQEELARVVTHRFSLDHIADGFSTIREGTGLKVVILP*
Ga0134069_121315613300017654Grasslands SoilRQEELGRVVTHRFPLEGIAEAFETIRTGSGLKMVIVP
Ga0134112_1012849813300017656Grasslands SoilTMGYLERRRDDLAAVVTHRFPLGAIAEAFETIRSGTGLKMVIEP
Ga0184608_1000717713300018028Groundwater SedimentATRRQYRITMAYLNRRRDELAPVVTHLFPLDKIGEAFETIHSGEGLKMVVVP
Ga0184608_1008538913300018028Groundwater SedimentKEDLARVVTHRFPLEDIAEAFETIRSGSGLKTVILP
Ga0187787_1027374423300018029Tropical PeatlandLNRRRIDLEGVVTHRFSLEHIAEAFETIRSGTGLKMVILP
Ga0184634_1013282413300018031Groundwater SedimentRQYRITMDYLNRRRDDLGRIVTHRFPLDRIAEAFATIRAGTGLKMVIEPGATA
Ga0184623_1042004613300018056Groundwater SedimentQYRITMDYLARKQEELAKVVTHRWPLEKIAEAFETIRSGTGLKMVIVP
Ga0184618_1040406813300018071Groundwater SedimentMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0184633_1020447313300018077Groundwater SedimentATRRQYRITMAYLNRRRDELAPVVTHLFPLDKIGEAFETIRSGEGLKMVVVP
Ga0184612_1043639623300018078Groundwater SedimentITMDYLDRRRDDLAGVVTHRYPLDRIQEAFETIRQGTGLKMVILP
Ga0184625_1017749623300018081Groundwater SedimentRDDLGRIVTHRFPLDRIAEAFATIRAGTGLKMVIEPGASA
Ga0190265_1282291213300018422SoilKQDELASVVTHRWPLEKIAEAFETIRAGTGLKMVVMP
Ga0066655_1012084923300018431Grasslands SoilLERRRDELASVVTHRFPLDRIDEAFKTIRSGSGLKVVIVQ
Ga0066667_1087641313300018433Grasslands SoilRDELASVVTHRFPLDRIDEAFNTIRSGSGLKVVIVQ
Ga0190268_1016625423300018466SoilATRRHYRTTMAYLARRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0066662_1269515023300018468Grasslands SoilTMDYLERRRDELASVVTHRFPLDRIDEAFNTIRSGSGLKVVIVQ
Ga0190271_1377053613300018481SoilRGAYGATHRQYRITMDYLDRKQALLAAVVTHRWPLEQIGEAFETIRSGSGLKMVIVP
Ga0173482_1044187113300019361SoilHMDYLARRRDDLAGVVTHRFPLDRIAEAFETIRSGAGLKMVIVP
Ga0173479_1033918123300019362SoilTMDYLARRQDELARVVTHRFPLERIGEAFDTIRSGTGLKMVIVP
Ga0190264_1085420313300019377SoilYLSRRRGALAPVVTHRFPLDKIDEAFETIRSGAGLKTVVVP
Ga0190264_1209726013300019377SoilQYRITMDYLDRKQDELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP
Ga0193739_101246433300020003SoilRRQEELARVVTHLFPLDDIAQAFETIRSGAGLKVVILP
Ga0222623_1038057113300022694Groundwater SedimentTRRQYQITMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0247800_105154923300023263SoilRITMDYLDRRQEDLARVVTHRFPLEDIAQAFETIRSGSGLKTVIVP
Ga0209109_1023873913300025160SoilMGYLYRRQDELGQVVTHRFSLEHIAEAFETIHSGAGLKMVILP
Ga0209321_1046087633300025312SoilQYRITMGYLDRRQDELGQVVTHRFSLEHIAEAFETIHSGAGLKMVILP
Ga0209431_1022099813300025313SoilQEELAKVVTHRWPLERIAEAFETIRAGTGLKMVIVP
Ga0207649_1042434013300025920Corn RhizosphereDRRQEDLARVVTHRFPLEDIAQAFETIRSGTGLKTVIVP
Ga0207704_1139396123300025938Miscanthus RhizosphereRRQEELARMVTHRFGLDGIAEAFETIRSGTGLKVVVVP
Ga0207661_1211083023300025944Corn RhizosphereMDYLDRKQEALARVVTHRFPLERIGEAFETIRAGTGLKMVIVP
Ga0210089_102402923300025957Natural And Restored WetlandsRQYRITMDYLDRKQDELAAVVTHRWPLEHIADAFETIRAGTGLKMVIVP
Ga0208293_101607223300026050Natural And Restored WetlandsYKELDIRGAYGATHRQYRITMDYLDRKQELLAAVVTHRWPLEQIAEAFETIRSGSGLKMVIVP
Ga0207641_1101933623300026088Switchgrass RhizosphereTRRQYRLTMDYLNRRRDELGAVVTHRFPLAHIAEAFDTIRSGAGLKMVILP
Ga0207675_10089700013300026118Switchgrass RhizosphereRITMDYLDRRQDDLARVVTHRFPLDKIAEAFETIRSGTGLKMVILP
Ga0209236_117270013300026298Grasslands SoilRRRRDELAAVVTHRFPLDRIGDAFETIRSGAGLKVVMLP
Ga0209471_126679123300026318SoilLRRRRDQLAAVVTHRFPLDRIGDAFETIRSGTGLKVVMLP
Ga0256867_1027125223300026535SoilRQEDLARVVTHRFPLDDIAQAFETIRSGAGLKMVILP
Ga0209157_126262913300026537SoilYRITMDYLERRRDELASVVTHRFPLAKIGEAFNTIRSGSGLKVVIVQ
Ga0209577_1082735223300026552SoilGATHRQYGITMGYLDRRQDELGRIVTHRLPLEEIPRAFETIRSGTGLKVVVLP
Ga0209879_102206423300027056Groundwater SandRDQLAAVVTHRFPLERIGEAFETIRSGAGLKMVIQP
Ga0209845_102366113300027324Groundwater SandTRAERIVTHRFPLERIAEGFDTIRDGSGLKVVIRP
Ga0207482_10569213300027456SoilRQDDLARVVTHRFPLDKIAEAFETIRSGTGLKMVILP
Ga0209588_122483423300027671Vadose Zone SoilTHRQYRITMDYLRRRRDELAAVVTHRFPLDQIGDAFETIRSGAGLKIVMLP
Ga0209811_1040126123300027821Surface SoilTHRQYGITMDYLDRKQDELAKVVTNRWPLEKIAEAFETIRAGTGLKMVIVP
Ga0209481_1007403313300027880Populus RhizosphereAYGATHRQYRITMDYLDRRQEELARVVTHRFSLDHIAQAFETIRDGSGLKMVILP
Ga0209853_103497223300027961Groundwater SandRRDQLAAVVTHRFPLDGIAEAFETIRSGAGLKMVIQP
Ga0268265_1215393713300028380Switchgrass RhizosphereYGATRRQYRITMAYLNRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0137415_1090405023300028536Vadose Zone SoilNRRRDDLAAVVTHRFPLDRIGEAFETIRSGSGLKMVVVP
Ga0272482_1032637823300028578SoilRITMDYLHRRRQELAPVVTHRFQLDEIDDAFETIRGGTGLKAVVVP
Ga0247820_1136079013300028597SoilTELAPVVTHQFPLDKIGEAFETIRSGAGLKMVVVP
Ga0307276_1019769213300028705SoilAYGATRRQYRITMAYLNRRRDELAPVVTHQFPLERIDEAFETIRSGAGLKMVVVP
Ga0307313_1019802813300028715SoilATRRHYRITMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0307298_1003919113300028717SoilITMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0307319_1033768613300028722SoilLDRRQEDLARVVTHRFPLEEIAQAFETIRSGSGLKTVIVP
Ga0307290_1018312523300028791SoilLGAYGATHRQYRITMDYLARKQEELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP
Ga0307284_1000776813300028799SoilDYLDRRQDDLARVVTHRFPLDKIAEAFETIRSGTGLKMVILP
Ga0307302_1005598133300028814SoilRRRNELAAVVTHRFPLEAIGEAFETIRSGAGLKMVILP
Ga0307312_1043282813300028828SoilLDRRQEDLARVVTHRFPLEEIAQAFETIRSGSGLKTVILP
Ga0307277_1001035043300028881SoilYGATTRQYRITMDYLNRRRKELAPVVTHQFPLDRIGEAFETIRAGTGLKMVVVP
Ga0307277_1016555623300028881SoilITMDYLARRQDELARVVTHRFPLERIGEAFDTIRSGTGLKMVIVP
Ga0307277_1029267023300028881SoilQYRITMDYLNRRRKELAPVVTHQFPLERIGEAFETIRAGTGLKMVVVP
Ga0307308_1051038623300028884SoilRREDLQGVVTHRFPLERIAEAFETIRSGAGLKMVIIP
Ga0307304_1012597123300028885SoilAELGAVVTHRFPLAQIAEAFDTIRSGAGLKMVILP
Ga0247826_1162634323300030336SoilQYRITMDYLDRRQEDLARVVTHRFPLEDIAQAFETIRSGSGLKAVILP
Ga0268255_1022645013300030516AgaveMAYLNRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0302046_1032878913300030620SoilKEDLAPVVTHRFPLERIDEAFGTIRAGTGLKMVIVP
Ga0299914_1057737123300031228SoilDYLHRRRQELAPVVTHRFQLDEIGDAFETIRSGTGLKAVVVP
Ga0307408_10033980123300031548RhizosphereLDRRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0307405_1000067013300031731RhizosphereYLNRRRKELAPVVTHQFPLERIGEAFETIRSGTGLKMVVVP
Ga0307413_1029685513300031824RhizosphereRRDELAPVVTHQFPLDKIGEAFETIRSGEGLKMVVVP
Ga0307413_1069868813300031824RhizosphereYGATTRQYRITMEYLNRRRKELAPVVTHQFPLERISEAFETIRSGTGLKMVVVP
Ga0307413_1180485313300031824RhizosphereGATTRQYRITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGAGLKMVVVP
Ga0310907_1005492823300031847SoilTMDYLDRKQDELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP
Ga0307406_1214008823300031901RhizosphereEDLARVVTHRFPLEEIGQAFETIRSGSGLKTVILP
Ga0326597_1065420613300031965SoilEDLEGVVTHRFPLEQIADAFETIRSGAGLKIVIVP
Ga0326597_1205450713300031965SoilMDYLDRKQEELARVVTHRWPLEQIGEAFETIRAGTGLKMVIVP
Ga0307409_10032639813300031995RhizosphereGATTRQYRITMEYLNRRRKELAPVVTHQFPLERIGEAFETIRSGTGLKMVVVP
Ga0307409_10295760023300031995RhizosphereAYGATHRQYRITMDYLDRKQDQLARVVTHRWPLEKIAEAFETIRAGTGLKMVIVP
Ga0307416_10324374613300032002RhizosphereELDILGAYGATHRQYRITMDYLDRKQDVLAAVVTHRWPLDQIADAFETIRSGTGLKMVIV
Ga0307411_1098664823300032005RhizosphereYLDRRRDELAPVVTHQFPLDKIGEAFETLRSGEGLKMVVVP
Ga0310906_1093938923300032013SoilHRQYRITMDYLDRRQDELAKVVTHRWPLEKIAEAFETIRAGTGLKMVIVP
Ga0310890_1091726123300032075SoilTHRQYRITMDYLDRKQDELAKVVTHRWPLEKIAEAFETIRAGTGLKMVVMP
Ga0326721_1047058413300032080SoilDVLAPVVTHRFPLERIEDAFATIRDGTGLKMVIVP
Ga0307415_10216153923300032126RhizosphereRRRKELAPVVTHQFPLERIGEAFETIRSGAGLKMVVVP
Ga0268251_1038510213300032159AgaveRQYRITMDYLDRRRDDLAAVVTHRFPLDRIAEAFETIRAGTGLKMVIQP
Ga0315283_1105457613300032164SedimentEDLEGVVTHRFPLEQIADAFETIRSGTGLKMVIIP
Ga0214471_1090018923300033417SoilYLNRRRDDLGRIVTHRFPLDRIAEAFATIRAGTGLKMVIEPGASA
Ga0364924_074782_590_7213300033811SedimentMDYLDRRQEDLARVVTHRFPLDDIAQAFETIRSGAGLKMVILP
Ga0364938_083087_411_5543300034114SedimentMDYLNRRRDDLGRIVTHRFPLDRIAEAFATIRAGTGLKMVIEPGASA
Ga0364933_181750_2_1603300034150SedimentATRRQYQITMAYLDRRRDELAPVVTHQFPLDKIGEAFETIRSGAGLKMVVVP
Ga0334913_010763_2061_21893300034172Sub-Biocrust SoilDYLNRRREELAAVVTHRFPLEAIGEAFQTIRSGAGLKMVIVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.