Basic Information | |
---|---|
Family ID | F029155 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 189 |
Average Sequence Length | 48 residues |
Representative Sequence | MSTTVIREKPVKPSARTVPTPRPPIVTRAESAPCTCPEHCERDHEQD |
Number of Associated Samples | 148 |
Number of Associated Scaffolds | 189 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.11 % |
% of genes near scaffold ends (potentially truncated) | 27.51 % |
% of genes from short scaffolds (< 2000 bps) | 78.84 % |
Associated GOLD sequencing projects | 136 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.079 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.640 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.921 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.794 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.33% β-sheet: 0.00% Coil/Unstructured: 94.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 189 Family Scaffolds |
---|---|---|
PF00463 | ICL | 46.03 |
PF01274 | Malate_synthase | 41.80 |
PF09370 | PEP_hydrolase | 1.59 |
PF01425 | Amidase | 1.59 |
PF07883 | Cupin_2 | 1.06 |
PF07729 | FCD | 1.06 |
PF12697 | Abhydrolase_6 | 1.06 |
PF00392 | GntR | 1.06 |
PF00881 | Nitroreductase | 0.53 |
PF00501 | AMP-binding | 0.53 |
PF00561 | Abhydrolase_1 | 0.53 |
PF07593 | UnbV_ASPIC | 0.53 |
PF12399 | BCA_ABC_TP_C | 0.53 |
PF00005 | ABC_tran | 0.53 |
PF01230 | HIT | 0.53 |
COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
---|---|---|---|
COG2224 | Isocitrate lyase | Energy production and conversion [C] | 46.03 |
COG2225 | Malate synthase | Energy production and conversion [C] | 41.80 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.59 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 1.06 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.06 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.07 % |
Unclassified | root | N/A | 25.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_8713198 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300000042|ARSoilYngRDRAFT_c04724 | Not Available | 514 | Open in IMG/M |
3300000858|JGI10213J12805_10604426 | Not Available | 707 | Open in IMG/M |
3300000956|JGI10216J12902_106146912 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300002459|JGI24751J29686_10098010 | Not Available | 611 | Open in IMG/M |
3300003203|JGI25406J46586_10020329 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
3300003987|Ga0055471_10162475 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300003987|Ga0055471_10195089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 631 | Open in IMG/M |
3300003987|Ga0055471_10216907 | Not Available | 601 | Open in IMG/M |
3300003987|Ga0055471_10307022 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300003993|Ga0055468_10243766 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 564 | Open in IMG/M |
3300003996|Ga0055467_10207594 | Not Available | 606 | Open in IMG/M |
3300003997|Ga0055466_10168926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces clavuligerus | 633 | Open in IMG/M |
3300003999|Ga0055469_10083238 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300004013|Ga0055465_10002227 | All Organisms → cellular organisms → Bacteria | 2853 | Open in IMG/M |
3300004114|Ga0062593_100336748 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300004114|Ga0062593_100349279 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300004114|Ga0062593_100481751 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300004156|Ga0062589_102900837 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300004463|Ga0063356_101899230 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300004479|Ga0062595_100443589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 950 | Open in IMG/M |
3300004479|Ga0062595_102488344 | Not Available | 516 | Open in IMG/M |
3300004643|Ga0062591_101184535 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300005093|Ga0062594_101097733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces clavuligerus | 777 | Open in IMG/M |
3300005164|Ga0066815_10005316 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300005327|Ga0070658_11006815 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300005328|Ga0070676_10190477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1339 | Open in IMG/M |
3300005328|Ga0070676_10629662 | Not Available | 776 | Open in IMG/M |
3300005328|Ga0070676_11217744 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005329|Ga0070683_100136466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2323 | Open in IMG/M |
3300005329|Ga0070683_100317570 | Not Available | 1482 | Open in IMG/M |
3300005329|Ga0070683_100793863 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300005332|Ga0066388_100028218 | All Organisms → cellular organisms → Bacteria | 5183 | Open in IMG/M |
3300005334|Ga0068869_100350961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1202 | Open in IMG/M |
3300005336|Ga0070680_100033623 | All Organisms → cellular organisms → Bacteria | 4135 | Open in IMG/M |
3300005336|Ga0070680_100061330 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
3300005337|Ga0070682_101024299 | Not Available | 687 | Open in IMG/M |
3300005339|Ga0070660_100156622 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 1834 | Open in IMG/M |
3300005341|Ga0070691_10037994 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
3300005344|Ga0070661_100022174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4544 | Open in IMG/M |
3300005344|Ga0070661_101746064 | Not Available | 528 | Open in IMG/M |
3300005347|Ga0070668_100875308 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300005354|Ga0070675_100249810 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300005356|Ga0070674_100027358 | All Organisms → cellular organisms → Bacteria | 3736 | Open in IMG/M |
3300005445|Ga0070708_101622317 | Not Available | 602 | Open in IMG/M |
3300005458|Ga0070681_10199238 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300005459|Ga0068867_100315312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1294 | Open in IMG/M |
3300005535|Ga0070684_100264894 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300005546|Ga0070696_100508385 | Not Available | 959 | Open in IMG/M |
3300005548|Ga0070665_101205372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 768 | Open in IMG/M |
3300005563|Ga0068855_100444456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1415 | Open in IMG/M |
3300005564|Ga0070664_101018295 | Not Available | 779 | Open in IMG/M |
3300005617|Ga0068859_101074521 | Not Available | 885 | Open in IMG/M |
3300005844|Ga0068862_102675642 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005874|Ga0075288_1035558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella michiganensis | 745 | Open in IMG/M |
3300005893|Ga0075278_1061116 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 580 | Open in IMG/M |
3300005937|Ga0081455_10122577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2046 | Open in IMG/M |
3300005937|Ga0081455_10145283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1836 | Open in IMG/M |
3300005937|Ga0081455_10196899 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300006038|Ga0075365_10006375 | All Organisms → cellular organisms → Bacteria | 6487 | Open in IMG/M |
3300006038|Ga0075365_10626640 | Not Available | 760 | Open in IMG/M |
3300006051|Ga0075364_10721321 | Not Available | 680 | Open in IMG/M |
3300006178|Ga0075367_10031107 | All Organisms → cellular organisms → Bacteria | 3064 | Open in IMG/M |
3300006196|Ga0075422_10219208 | Not Available | 789 | Open in IMG/M |
3300006573|Ga0074055_11714511 | Not Available | 555 | Open in IMG/M |
3300006847|Ga0075431_101126391 | Not Available | 749 | Open in IMG/M |
3300006854|Ga0075425_101247129 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300006904|Ga0075424_101369608 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300006918|Ga0079216_11172617 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 614 | Open in IMG/M |
3300009053|Ga0105095_10723492 | Not Available | 556 | Open in IMG/M |
3300009098|Ga0105245_13152513 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300009156|Ga0111538_10927847 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300009174|Ga0105241_11703983 | Not Available | 612 | Open in IMG/M |
3300009551|Ga0105238_12966200 | Not Available | 510 | Open in IMG/M |
3300009868|Ga0130016_10003241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 32055 | Open in IMG/M |
3300009868|Ga0130016_10527769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces clavuligerus | 750 | Open in IMG/M |
3300009870|Ga0131092_10006293 | All Organisms → cellular organisms → Bacteria | 22498 | Open in IMG/M |
3300009873|Ga0131077_10009985 | All Organisms → cellular organisms → Bacteria | 19116 | Open in IMG/M |
3300009873|Ga0131077_10130527 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
3300010359|Ga0126376_12617800 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010362|Ga0126377_10025530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4922 | Open in IMG/M |
3300010371|Ga0134125_11135347 | Not Available | 855 | Open in IMG/M |
3300010375|Ga0105239_10228539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2087 | Open in IMG/M |
3300010375|Ga0105239_11695390 | Not Available | 731 | Open in IMG/M |
3300010396|Ga0134126_12152987 | Not Available | 609 | Open in IMG/M |
3300010396|Ga0134126_12256768 | Not Available | 593 | Open in IMG/M |
3300010399|Ga0134127_12797025 | Not Available | 567 | Open in IMG/M |
3300010401|Ga0134121_10552996 | Not Available | 1069 | Open in IMG/M |
3300011333|Ga0127502_10352600 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 631 | Open in IMG/M |
3300011333|Ga0127502_11352994 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 538 | Open in IMG/M |
3300012514|Ga0157330_1081930 | Not Available | 519 | Open in IMG/M |
3300012897|Ga0157285_10004291 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
3300012906|Ga0157295_10217736 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300012909|Ga0157290_10064151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 990 | Open in IMG/M |
3300012911|Ga0157301_10115026 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 811 | Open in IMG/M |
3300012913|Ga0157298_10171099 | Not Available | 670 | Open in IMG/M |
3300012943|Ga0164241_10054306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2929 | Open in IMG/M |
3300012943|Ga0164241_10204698 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300012943|Ga0164241_10293234 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 1163 | Open in IMG/M |
3300012943|Ga0164241_10387350 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300012961|Ga0164302_10290427 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300012984|Ga0164309_10012994 | All Organisms → cellular organisms → Bacteria | 4170 | Open in IMG/M |
3300012985|Ga0164308_10040260 | All Organisms → cellular organisms → Bacteria | 2938 | Open in IMG/M |
3300012986|Ga0164304_11750138 | Not Available | 520 | Open in IMG/M |
3300012987|Ga0164307_11770750 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300012989|Ga0164305_10365886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1092 | Open in IMG/M |
3300013308|Ga0157375_11771395 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300014263|Ga0075324_1105162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces clavuligerus | 611 | Open in IMG/M |
3300014267|Ga0075313_1028773 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300014270|Ga0075325_1003100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2634 | Open in IMG/M |
3300014270|Ga0075325_1037497 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300014270|Ga0075325_1096008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces clavuligerus | 694 | Open in IMG/M |
3300014270|Ga0075325_1147428 | Not Available | 594 | Open in IMG/M |
3300014325|Ga0163163_10718326 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300014326|Ga0157380_10086025 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 2582 | Open in IMG/M |
3300015371|Ga0132258_10511742 | All Organisms → cellular organisms → Bacteria | 3004 | Open in IMG/M |
3300015371|Ga0132258_10522289 | All Organisms → cellular organisms → Bacteria | 2972 | Open in IMG/M |
3300015371|Ga0132258_13412494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 1091 | Open in IMG/M |
3300015372|Ga0132256_101048263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 930 | Open in IMG/M |
3300015372|Ga0132256_103265933 | Not Available | 545 | Open in IMG/M |
3300017792|Ga0163161_11448798 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300018469|Ga0190270_13419839 | Not Available | 503 | Open in IMG/M |
3300018481|Ga0190271_10072384 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
3300018481|Ga0190271_10329965 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300018481|Ga0190271_10893576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1013 | Open in IMG/M |
3300018481|Ga0190271_12705967 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300019356|Ga0173481_10333377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 718 | Open in IMG/M |
3300020075|Ga0206349_1769747 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300020076|Ga0206355_1051592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 531 | Open in IMG/M |
3300020080|Ga0206350_10897435 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300020082|Ga0206353_10515835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
3300020082|Ga0206353_11472224 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 544 | Open in IMG/M |
3300020082|Ga0206353_11526355 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300021445|Ga0182009_10712929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 544 | Open in IMG/M |
3300022883|Ga0247786_1046724 | Not Available | 872 | Open in IMG/M |
3300022893|Ga0247787_1000983 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
3300023102|Ga0247754_1010514 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300024055|Ga0247794_10147762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 732 | Open in IMG/M |
3300025321|Ga0207656_10531693 | Not Available | 598 | Open in IMG/M |
3300025567|Ga0210076_1038392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 1031 | Open in IMG/M |
3300025791|Ga0210115_1035741 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 1086 | Open in IMG/M |
3300025885|Ga0207653_10009553 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
3300025899|Ga0207642_10032205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2205 | Open in IMG/M |
3300025899|Ga0207642_10203583 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1095 | Open in IMG/M |
3300025900|Ga0207710_10695449 | Not Available | 533 | Open in IMG/M |
3300025904|Ga0207647_10348796 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300025907|Ga0207645_10298560 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300025908|Ga0207643_10031626 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
3300025919|Ga0207657_10566529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 888 | Open in IMG/M |
3300025920|Ga0207649_10217921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1358 | Open in IMG/M |
3300025921|Ga0207652_10874317 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300025923|Ga0207681_10511776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 984 | Open in IMG/M |
3300025926|Ga0207659_10059807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2740 | Open in IMG/M |
3300025936|Ga0207670_11501597 | Not Available | 573 | Open in IMG/M |
3300025937|Ga0207669_10698463 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 833 | Open in IMG/M |
3300025937|Ga0207669_11902448 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 508 | Open in IMG/M |
3300025944|Ga0207661_10823854 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300025961|Ga0207712_11316310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 646 | Open in IMG/M |
3300025993|Ga0208415_1033018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 511 | Open in IMG/M |
3300026067|Ga0207678_10017655 | All Organisms → cellular organisms → Bacteria | 6264 | Open in IMG/M |
3300026078|Ga0207702_11950484 | Not Available | 578 | Open in IMG/M |
3300026089|Ga0207648_10111933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Thermaerobacter → Thermaerobacter subterraneus | 2397 | Open in IMG/M |
3300026089|Ga0207648_10453985 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300026095|Ga0207676_10232438 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
3300026116|Ga0207674_11822861 | Not Available | 575 | Open in IMG/M |
3300027886|Ga0209486_10099397 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300028587|Ga0247828_10037434 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300028590|Ga0247823_10744713 | Not Available | 736 | Open in IMG/M |
3300028592|Ga0247822_10091080 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
3300028592|Ga0247822_10205521 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300028812|Ga0247825_10200270 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 1380 | Open in IMG/M |
3300028812|Ga0247825_10210804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1344 | Open in IMG/M |
3300028889|Ga0247827_10853065 | Not Available | 608 | Open in IMG/M |
3300030336|Ga0247826_10020969 | All Organisms → cellular organisms → Bacteria | 3103 | Open in IMG/M |
3300030336|Ga0247826_10022101 | All Organisms → cellular organisms → Bacteria | 3054 | Open in IMG/M |
3300031652|Ga0315553_10343160 | Not Available | 608 | Open in IMG/M |
3300031854|Ga0310904_11136486 | Not Available | 561 | Open in IMG/M |
3300031908|Ga0310900_11914720 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 506 | Open in IMG/M |
3300031938|Ga0308175_101535197 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300031938|Ga0308175_102456114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces clavuligerus | 584 | Open in IMG/M |
3300031940|Ga0310901_10493852 | Not Available | 547 | Open in IMG/M |
3300031943|Ga0310885_10553368 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 633 | Open in IMG/M |
3300031996|Ga0308176_10425189 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300032013|Ga0310906_10925468 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Cavenderiaceae → Cavenderia → Cavenderia fasciculata → Cavenderia fasciculata SH3 | 623 | Open in IMG/M |
3300032075|Ga0310890_10433415 | Not Available | 984 | Open in IMG/M |
3300032179|Ga0310889_10488024 | Not Available | 623 | Open in IMG/M |
3300033550|Ga0247829_10085766 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
3300034819|Ga0373958_0212029 | Not Available | 512 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 10.58% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.82% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.23% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.23% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.17% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.17% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.12% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.12% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.12% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 2.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.59% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.59% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.06% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.06% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.06% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.53% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.53% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.53% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.53% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.53% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina - sample from Arabidopsis soil young | Host-Associated | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031652 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_03243140 | 2088090015 | Soil | LSRTLIREKPVLPTGTRPAPRVERPEIVTRAEVAPCTCPEPCERDHEND |
ARSoilYngRDRAFT_047242 | 3300000042 | Arabidopsis Rhizosphere | MTATLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEPC |
JGI10213J12805_106044261 | 3300000858 | Soil | MSSMLTREKPVKPTATTPPATRQRPEILTRAEVAPCTCPEHCERDHDND* |
JGI10216J12902_1061469122 | 3300000956 | Soil | MTPTSLVRERPVKPPVLTTPTPRRPPILTRAEVAPCTCPEYCERDHEND* |
JGI24751J29686_100980101 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | REKPVLPTSARPAPREDRPQIVTRAEVAPCTCPEPCERDHEND* |
JGI25406J46586_100203292 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MTALTREKPLEPAALRPAPTRPTPTIVTRAEIAACTCPEHCERDHEHD* |
Ga0055471_101624752 | 3300003987 | Natural And Restored Wetlands | MNQTLTREKPIRPKTAAPAPREERPEERPTILTRAEVAPCTCPEHCERDHEHD* |
Ga0055471_101950892 | 3300003987 | Natural And Restored Wetlands | MTPTTLIREKPVKPAARPATEPRPTIVTRAESALCTCPEPCERDHEHD* |
Ga0055471_102169072 | 3300003987 | Natural And Restored Wetlands | MTPTSLIREKPQKPVASAPAHAAPRPVVVTRAESAPCTCPEHCERDHEHD* |
Ga0055471_103070222 | 3300003987 | Natural And Restored Wetlands | MTPSALIREKPVEPGARSKPTPYLQRDAQPILTRAELAPCTCPEHCERDHERD* |
Ga0055468_102437661 | 3300003993 | Natural And Restored Wetlands | MTPTSLIREKPVKPAARSVQPPRPPIVTRAESAPCTCPEHCERDHEND* |
Ga0055467_102075942 | 3300003996 | Natural And Restored Wetlands | MTRTLTRETPVKPIRVRPAPRAERPQVVTRAEVAPCTCPEPCERDHEND* |
Ga0055466_101689261 | 3300003997 | Natural And Restored Wetlands | MTPTSLIREKPQKPVASAPAHAAPRPVVVTRAESAPCTCPEHCERDHEHD |
Ga0055469_100832381 | 3300003999 | Natural And Restored Wetlands | ASPPLIREKPVKPKTAAPAPRDERPTILTRAEVAPCTCPEPCERDHEHD* |
Ga0055465_100022271 | 3300004013 | Natural And Restored Wetlands | RKERRMTPTSLIREKPQKPVASAPAHAAPRPVVVTRAESAPCTCPEHCERDHEHD* |
Ga0062593_1003367482 | 3300004114 | Soil | MTATLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEPCERDHEHD* |
Ga0062593_1003492792 | 3300004114 | Soil | MTAMSTIRERPVKPAARAPEAPRPTIVTRAESAPCTCPEHCERDHEQD* |
Ga0062593_1004817512 | 3300004114 | Soil | LSRTLIREKPVLPTGTRPAPRVERPEIVTRAEVAPCTCPEPCERDHEND* |
Ga0062589_1029008372 | 3300004156 | Soil | MSTTVIREKPVKPEARITSTQRPPIVTRAETAPCTCPEHCERDHEQD* |
Ga0063356_1018992302 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MMQTTLIREKPVKPAARSTTAPAPRPPILTRAEVAPCTCPEHCERDHEND* |
Ga0062595_1004435891 | 3300004479 | Soil | MTSTLIREKPVKPKTAAPAPVAERPTILTRAEVAPCTCPEHCERDHEHD* |
Ga0062595_1024883441 | 3300004479 | Soil | MSTTVIREKPVKPDARITPTPRPPIVTRAETAPCTCPEHCE |
Ga0062591_1011845352 | 3300004643 | Soil | MTAMSTIRERSVKPAARAPEAPRPTIVTRAESAPCTCPEHCERDHEQD* |
Ga0062594_1010977332 | 3300005093 | Soil | MTSTLIRERPVKPKTAAPAPVTQRPTILTRAEVAPCTCPEHCERDHEH |
Ga0066815_100053162 | 3300005164 | Soil | MSTTVIREKPVKPGARILPTPRPPIVTRAESAPCTCPETCERDHEQD* |
Ga0070658_110068152 | 3300005327 | Corn Rhizosphere | MSTTVVREKPVKPGERIIPTPRPPIVTRAESAPCTCPERCERDHEQD* |
Ga0070676_101904772 | 3300005328 | Miscanthus Rhizosphere | MSTTVIREKPVKPGARTVPTPRPPIVTRAESAPCTCPEACERDHEQD* |
Ga0070676_106296622 | 3300005328 | Miscanthus Rhizosphere | MSTTAIREKPVKPDARIIPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0070676_112177441 | 3300005328 | Miscanthus Rhizosphere | MSTTVIREKPVKPDARITSTPRPPIVTRAETAPCTCPEHCERDHEQD* |
Ga0070683_1001364662 | 3300005329 | Corn Rhizosphere | MSSTLIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPEHCERDHEND* |
Ga0070683_1003175702 | 3300005329 | Corn Rhizosphere | SASPTLIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPEHCERDHEHD* |
Ga0070683_1007938632 | 3300005329 | Corn Rhizosphere | MSTTVIREKPVKPDARITSTQRPPIVTRAETAPCTCPEHCERDHEQD* |
Ga0066388_1000282182 | 3300005332 | Tropical Forest Soil | MTTTLIREKPVKPKTAAPAPRSERPTILTRSEVAPCTCPEPCERDHEND* |
Ga0068869_1003509612 | 3300005334 | Miscanthus Rhizosphere | MSTTVIREKPVKPDARITPTPRPPIVTRAETAPCTCPEHCERDHEQD* |
Ga0070680_1000336232 | 3300005336 | Corn Rhizosphere | MSSTLIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPEHCERDHEHD* |
Ga0070680_1000613301 | 3300005336 | Corn Rhizosphere | MSTTVIREKPVKPGARIIPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0070682_1010242992 | 3300005337 | Corn Rhizosphere | MSTTVIREKPVKPSARTVPTPRPPIVTRAESAPCTCPEACERDHEQD* |
Ga0070660_1001566223 | 3300005339 | Corn Rhizosphere | MSTTAIREKPVKPDARIIPTPRPPIVTRAESAPCTCPENCERDHGQD* |
Ga0070691_100379942 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAMSTIRERPVKPAASAPEAPRPTIVTRAESAPCTCPEHCERDHEQD* |
Ga0070661_1000221745 | 3300005344 | Corn Rhizosphere | MSTTVVREKPVKPGERIIPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0070661_1017460642 | 3300005344 | Corn Rhizosphere | TLTREKPVLPTSARPAPREDRPEIVTRAEMAPCTCPEPCERDHEND* |
Ga0070668_1008753082 | 3300005347 | Switchgrass Rhizosphere | MTSTLIREKPVKPKTAAPAPVTQRPTILTRAEVAPCTCPEHCERDHEHD* |
Ga0070675_1002498102 | 3300005354 | Miscanthus Rhizosphere | MSSSTLTREKPVLPTSARPAPREDRPEIVTRAEIAPCTCPEPCERDHEND* |
Ga0070674_1000273583 | 3300005356 | Miscanthus Rhizosphere | MTPTSLIREKPVKPAARSTTAPAPRPQILTRAEVAPCTCPEHCERDHEND* |
Ga0070708_1016223171 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTTVIREKPVKPGARTVPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0070681_101992383 | 3300005458 | Corn Rhizosphere | MSTTVVREKPVKPDARIIPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0068867_1003153121 | 3300005459 | Miscanthus Rhizosphere | MSTTAIREKPVKPDARIIPTPRPPIVTRAESEPCTCPESCERDHEQD* |
Ga0070684_1002648942 | 3300005535 | Corn Rhizosphere | MSSSTLTREKPVLPTSARPAPREDRPQIVTRAEVAPCTCPEPCERDHEND* |
Ga0070696_1005083851 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PRREERRMSTTVIREKPVKPSARTVPTPRPPIVTRAESAPCTCPEACERDHEQD* |
Ga0070665_1012053721 | 3300005548 | Switchgrass Rhizosphere | TLIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPKHCERDHEND* |
Ga0068855_1004444562 | 3300005563 | Corn Rhizosphere | MSTTVVREKPVKPGERIIPTPRPPIVTRAESEPCTCPESCERDHEQD* |
Ga0070664_1010182952 | 3300005564 | Corn Rhizosphere | MSSSTLTRERPVLPTSARPAPREDRPQIVTRAEVAPCTCPEPCERDHEND* |
Ga0068859_1010745212 | 3300005617 | Switchgrass Rhizosphere | MTAMSTIRERPVKPAARAPEAPRPTIVTRAESAPCTCPEHCERDHEQ |
Ga0068862_1026756422 | 3300005844 | Switchgrass Rhizosphere | IREKPVKPAARPTSAPRPTIVTRAESAPCTCPEHCERDHEQD* |
Ga0075288_10355582 | 3300005874 | Rice Paddy Soil | SAAPPQHLVREKSVKPRTAAPGPRSERPPILTRAEVAPCTCPEHCERDHEHD* |
Ga0075278_10611162 | 3300005893 | Rice Paddy Soil | MARTLIREKPVKPSTAAPAPQLKRPTVVTRAEVAPCTCPEP |
Ga0081455_101225772 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTRTLTRETPVKPTGVRPAPREERPQVVTRAEVAPCTCPEPCERDHEND* |
Ga0081455_101452833 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTPTALIREKPVKPDARTTPMPSPRPPVVTRAEVVPCTCPEPCERDHENE* |
Ga0081455_101968992 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSSTLIQIREKPVKPKTAAPAPGTERPTILTRAEVAPCTCPEPCERDHEHD* |
Ga0075365_100063752 | 3300006038 | Populus Endosphere | MSTSTLTREKPVLPTSARPAPREERPQIVTRAEVAPCTCPEPCERDHEND* |
Ga0075365_106266402 | 3300006038 | Populus Endosphere | LTREKPVLPTSARPAPREDRPQIVTRAEVAPCTCPEPCERDHEND* |
Ga0075364_107213212 | 3300006051 | Populus Endosphere | MTATLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEPCERDHEH |
Ga0075367_100311073 | 3300006178 | Populus Endosphere | MSTSTLTREKPVLPTSARPAPREERPEIVTRAEVAPCTCPEPCERDHEND* |
Ga0075422_102192082 | 3300006196 | Populus Rhizosphere | MSTTVIREKPVKPSARTVPTPRPPIVTRAESEPCTCPESCERDHEQD* |
Ga0074055_117145112 | 3300006573 | Soil | MSTTVIREKPVKPGARIIPTPRPPIVTRAESAPCTCPETCERDHEQD* |
Ga0075431_1011263911 | 3300006847 | Populus Rhizosphere | MSTTVVREKPVKPGERIIPTPRPPIVTRAESAPCTCPEACERDHEQD* |
Ga0075425_1012471292 | 3300006854 | Populus Rhizosphere | MTATLIREKPVKPKTAAPAPVAERPTILTRAEVAPCTCPEHCERDHEHD* |
Ga0075424_1013696082 | 3300006904 | Populus Rhizosphere | MTSTLIREKPVKPKTAAPAPVAQRPTILTRAEVAPCTCPEHCERDHEHD* |
Ga0079216_111726172 | 3300006918 | Agricultural Soil | MTPTSLVREKPVKPATTRPSQPAHRPVILTRAETAPCTCPEPCERDHEHD* |
Ga0105095_107234922 | 3300009053 | Freshwater Sediment | MSTALIREKPVKPAASRPAATGHRPVILTRAETSACTCPEPCERDHEHD* |
Ga0105245_131525131 | 3300009098 | Miscanthus Rhizosphere | STTVIREKPVKPDARITSTQRPPIVTRAETAPCTCPEHCERDHEQD* |
Ga0111538_109278472 | 3300009156 | Populus Rhizosphere | MMQPTLIREKPVKPAARSTTAPAPRPQILTRAEVAPCTCPEPCERDHEND* |
Ga0075423_109901532 | 3300009162 | Populus Rhizosphere | IREKPVKPTERKTPSLRVPRTPVVTRAEIAPCTCPEPCERDHENE* |
Ga0105241_117039831 | 3300009174 | Corn Rhizosphere | LIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPEHCERDHEND* |
Ga0105238_129662001 | 3300009551 | Corn Rhizosphere | AAIPRREERRMSTTAIREKPVKPDARIIPTPRPPIVTRAESAPCTCPERCERDHEQD* |
Ga0130016_100032416 | 3300009868 | Wastewater | MTPTTALIREKPVRPQTTPAPAAQPRPQIVTWAESAPCTCPEHCERDHEHD* |
Ga0130016_105277691 | 3300009868 | Wastewater | MSSTTLTREKPVKPGARTTPPPREAIVTRAESAQCTCPEHCERDHEND* |
Ga0131092_100062934 | 3300009870 | Activated Sludge | MSSIVREKPLKPVRPGARTTPAAQPPIVTRAESAPCTCPEHCERDHEQD* |
Ga0131077_1000998520 | 3300009873 | Wastewater | MTPTTLIREKPVKPAARPVQAPRPAIVTRAESAACTCPEHCERDHEND* |
Ga0131077_101305274 | 3300009873 | Wastewater | MTPTSLIREKPVKPPARTTPAPRPAIVTRAESVQCTCPEHCERDHEND* |
Ga0126376_126178002 | 3300010359 | Tropical Forest Soil | MTSILIREKPVKPKTAAPAPAAERPTILTRAEVAPCTCPEHCERDHEND* |
Ga0126377_100255302 | 3300010362 | Tropical Forest Soil | MSSTLIREKPIKPTPVRPSEPQGRAPIVTRAEVAPCTCPEPCERDHTDE* |
Ga0134125_111353472 | 3300010371 | Terrestrial Soil | REKPVKPGARIIPTPRPPIVTRSESAPCTCPESCERDHEQD* |
Ga0105239_102285391 | 3300010375 | Corn Rhizosphere | MTATLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPE |
Ga0105239_116953902 | 3300010375 | Corn Rhizosphere | MSTTAIRDKPVKPDARIIPTPRPPIVTRAESEPCTCPESCERDHEQD* |
Ga0134126_121529871 | 3300010396 | Terrestrial Soil | IPRREERRMSTTVIREKPVKPDARIIPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0134126_122567682 | 3300010396 | Terrestrial Soil | MTATLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEPCERDHKHD* |
Ga0134127_127970251 | 3300010399 | Terrestrial Soil | TLIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPEHCERDHEHD* |
Ga0134121_105529962 | 3300010401 | Terrestrial Soil | MSTTVVREKPVKPDARIIPTPRPPIVTRAESAPCTCPEACERDHEQD* |
Ga0127502_103526002 | 3300011333 | Soil | MTPTSLVREKPVKPATTRPSQPAHRPLILTRAETAPCTCPEPCERDHDDE* |
Ga0127502_113529942 | 3300011333 | Soil | MNATTLIREKPVKPVVRSAPAPAPRPPILTRAEVAPCTCPEHCERDHDDE* |
Ga0157330_10819302 | 3300012514 | Soil | MTATLIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPEHCE |
Ga0157285_100042911 | 3300012897 | Soil | TLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEPCERDHEHD* |
Ga0157295_102177362 | 3300012906 | Soil | MSSSTLTREKPVLPTSAHPAPREERPQIVTRAEVAPCTCPEPCERDHEND* |
Ga0157290_100641511 | 3300012909 | Soil | KERRMTATLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEPCERDHEHD* |
Ga0157301_101150262 | 3300012911 | Soil | MSTTVIREKPDKPEARITSTQRPPIVTRAETAPCTCPEHYERDHEQD* |
Ga0157298_101710992 | 3300012913 | Soil | MSTTVIREKPVKPEARITSTQRPPIVTRAETAPCTCPEHCE |
Ga0164241_100543064 | 3300012943 | Soil | MTPTTLTREKPVKPAARPMSAPRPTIVTRAESAPCTCPEHCERDHEQD* |
Ga0164241_102046982 | 3300012943 | Soil | MTTTTPIREKPVKPKTSAPAPRSERPAILTRAEVAPCTCPEPCERDHEHD* |
Ga0164241_102932342 | 3300012943 | Soil | MTPTTLIREKPVKPVAGPTTQPPRPTIVTRAESAPCTCPEPCERDHEND* |
Ga0164241_103873502 | 3300012943 | Soil | MTPTTLTREKPVKPAARPTSAPRPTIVTRAESAPCTCPEHCERDHEND* |
Ga0164302_102904272 | 3300012961 | Soil | MSTTAIREKPVKPGARIIPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0164309_100129943 | 3300012984 | Soil | MSTTAIREKPVKPDARIIPTPRPPIVTRAESAPCTCPETCERDHEQD* |
Ga0164308_100402604 | 3300012985 | Soil | MSTTVFREKPVKPGARIIPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0164304_117501382 | 3300012986 | Soil | SMTATSMIRERPVKPAARAPEAPRPTIVTRAEAAPCTCPEHCERDHEHD* |
Ga0164307_117707502 | 3300012987 | Soil | MSTTAIRDKPVKPDARIIPTPRPPIVTRAESAPCTCPETCERDHEQD* |
Ga0164305_103658862 | 3300012989 | Soil | MTATSMIRERPVKPAVRAAEAPRPTIVTRAESAPCTCPEHCERDHEHD* |
Ga0157375_117713952 | 3300013308 | Miscanthus Rhizosphere | MTATLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEHCERDHEHD* |
Ga0075324_11051621 | 3300014263 | Natural And Restored Wetlands | MTPTSLIREKPQKPAARTPQAPRPPIVTRAESAPCTCPEHCE |
Ga0075313_10287732 | 3300014267 | Natural And Restored Wetlands | MTPTSLIREKPQKPAARTPQAPRPPIVTRAESAPCTCPEHCERDHEHD* |
Ga0075325_10031001 | 3300014270 | Natural And Restored Wetlands | MTPTSLIREKPQKPAARTPQAPRPPIVTRAESAPCTCPEHCERDHENE* |
Ga0075325_10374972 | 3300014270 | Natural And Restored Wetlands | MNQTLTREKPIRPKTAVPAPREERPEERPTILTRAEVAPCTCPEHCERDHEHD* |
Ga0075325_10960082 | 3300014270 | Natural And Restored Wetlands | MTPTSLIREKPQKPAVRSPQAPRPPIVTRAESAPCTCPEHCERDHDDE* |
Ga0075325_11474281 | 3300014270 | Natural And Restored Wetlands | SLIREKPQKPVASAPAHAAPRPVVVTRAESAPCTCPEHCERDHEHD* |
Ga0163163_107183262 | 3300014325 | Switchgrass Rhizosphere | MSSSTVTRERPVLPTSARPAPREDRPEIVTRAEIAPCTCPEPCERDHEND* |
Ga0157380_100860253 | 3300014326 | Switchgrass Rhizosphere | MSTTAIREKPVKPDARIIPTPRPPIVTRAESAPCTCPEACERDNEQD* |
Ga0132258_105117421 | 3300015371 | Arabidopsis Rhizosphere | PPLLAREKPVEPGARTMPTPRPLPTIMTRAEVAPCTCPEHCERDHEND* |
Ga0132258_105222892 | 3300015371 | Arabidopsis Rhizosphere | MSSSTVTRERPVLPTSARPAPREDRPQIVTRAEVAPCTCPEPCERDHEND* |
Ga0132258_134124942 | 3300015371 | Arabidopsis Rhizosphere | MSTTAIRDKPVKPDARIIPTPRPPIVTRAESAPCTCPESCERDHEQD* |
Ga0132256_1010482632 | 3300015372 | Arabidopsis Rhizosphere | MSTTVIREKPVKPDARITPTPRPPIVTRAETAPCTCPERCERDHEQD* |
Ga0132256_1032659332 | 3300015372 | Arabidopsis Rhizosphere | MTTTLIRERPKKPTTAQKPPARDRPTIVTRAEVAPCTCPEPCERDHEHD* |
Ga0163161_114487982 | 3300017792 | Switchgrass Rhizosphere | MTAMSTIRERPVKPAARAPEAPRPTIVTRAESAPCTCPEHCERDHEQD |
Ga0190270_134198392 | 3300018469 | Soil | MNPTTLIREKPVKPSSRSGNPQERIPAAGSPPILTRAETAPCTCPEHCERDHEND |
Ga0190271_100723842 | 3300018481 | Soil | MTPTSLVREKPVKPSVLTAPTPRRLPILTRAEVAPCTCPEYCERDHEND |
Ga0190271_103299652 | 3300018481 | Soil | MTPTSLVREKPVKPATTRPSQPAHRPLILTRAETAPCTCPEPCERDHDDE |
Ga0190271_108935761 | 3300018481 | Soil | MTPTTTTREKPVKPVAQPRPGLQSRSPILTRAELAPCTCPEHCERDHEHD |
Ga0190271_127059672 | 3300018481 | Soil | MTPTSLIREKPQKPAVQSRPAPQPRPPILTRAETAPCTCPEHCERDHEND |
Ga0173481_103333772 | 3300019356 | Soil | MSTTVIREKPVKPDARITSTQRPPIVTRAETAPCTCPEHCERDHEQD |
Ga0206349_17697472 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSSTLTREKPVLPTSARPAPREDRPQIVTRAEVAPCTCPEPCERDHEND |
Ga0206355_10515922 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSTLIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPEHCERDHEND |
Ga0206350_108974352 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MTATLIREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEPCERDHEHD |
Ga0206353_105158352 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSTLIREKPVKPKTAAPAPAVERLPILTRAEVAPCTCPEHCERDHEND |
Ga0206353_114722242 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAMSTIRERPVKPAARAPEAPRPTIVTRAESPCTCPEHCERDHEQD |
Ga0206353_115263551 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | IREKPVKPDARIIPTPRPPIVTRAESAPCTCPESCERDHEQD |
Ga0182009_107129292 | 3300021445 | Soil | MTSTLIREKPVKPKTAAPAPVAERPTILTRAEVAPCTCPEHCERDHEHD |
Ga0247786_10467241 | 3300022883 | Soil | MSSSTVTRERPVLPTSARPAPREDRPQIVTRAEVAPCTCPEPCERDH |
Ga0247787_10009833 | 3300022893 | Soil | MTAMSTIRERPVKPAASAPEAPRPTIVTRAESAPCTCPEHCERDHEQD |
Ga0247754_10105143 | 3300023102 | Soil | MTAMSTIRERPVKPAASAPEAPRPTIVTRAESAPCTCPEHCERD |
Ga0247794_101477622 | 3300024055 | Soil | MTPTTLIREKPVKPAARPATEPRPTIVTRAESALCTCPEPCERDHEHD |
Ga0207656_105316931 | 3300025321 | Corn Rhizosphere | MSSTLIREKPVKPKTAAPAPAVERPPILTRAEVAPCTCPEHCERDHEHD |
Ga0210076_10383921 | 3300025567 | Natural And Restored Wetlands | MTPTSLIREKPQKPAARTPQAPRPPIVTRAESAPCTCPEHCERDHEHD |
Ga0210115_10357412 | 3300025791 | Natural And Restored Wetlands | MNQTLTREKPIRPKTAAPAPREERPEERPTILTRAEVAPCTCPEHCERDHEHD |
Ga0207653_100095532 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTTAIREKPVKPDARIIPTPRPPIVTRAESAPCTCPESCERDHEQD |
Ga0207642_100322052 | 3300025899 | Miscanthus Rhizosphere | MTAMSTIRERPVKPAARAPETPRPTIVTRAESAPCTCPEHCERDHEQD |
Ga0207642_102035832 | 3300025899 | Miscanthus Rhizosphere | MMQPTLIREKPVKPAARSTTAPAPRPQILTRAEVAPCTCPEHCERDHEND |
Ga0207710_106954492 | 3300025900 | Switchgrass Rhizosphere | MTAMSTIRERPVKPAARAPEAPRPTIVTRAESAPCTCPEHCERDHE |
Ga0207647_103487962 | 3300025904 | Corn Rhizosphere | MSTTAIREKPVKPDARIVPTPRPPIVTRAESAPCTCPESCERDHEQD |
Ga0207645_102985602 | 3300025907 | Miscanthus Rhizosphere | MSTTVIREKPVKPGARTVPTPRPPIVTRAESAPCTCPEACERDHEQD |
Ga0207643_100316262 | 3300025908 | Miscanthus Rhizosphere | MSTTVIREKPVKPSARTVPTPRPPIVTRAESAPCTCPEACERDHEQD |
Ga0207657_105665292 | 3300025919 | Corn Rhizosphere | MSTTVIREKPVKPSARTVPTPRPPIVTRAESAPCTCPEHCERDHEQD |
Ga0207649_102179211 | 3300025920 | Corn Rhizosphere | MSTTVVREKPVKPGERIIPTPRPPIVTRAESEPCTCPESCERDHEQD |
Ga0207652_108743172 | 3300025921 | Corn Rhizosphere | MSTTVIREKPVKPSARTVPTPRPPIVTRAESAPCTCPESCERDHEQD |
Ga0207681_105117761 | 3300025923 | Switchgrass Rhizosphere | IREKPVKPKTATPAPQAERPPILTRAEVAPCTCPEPCERDHEHD |
Ga0207659_100598072 | 3300025926 | Miscanthus Rhizosphere | MSSSTLTREKPVLPTSARPAPREDRPEIVTRAEIAPCTCPEPCERDHEND |
Ga0207670_115015971 | 3300025936 | Switchgrass Rhizosphere | MSTTVIREKPVKPDARITPTPRPPIVTRAETAPCTCPEHCERDHE |
Ga0207669_106984631 | 3300025937 | Miscanthus Rhizosphere | MTPASLIREKPVKPAARSTTAPAPRPQILTRAEVAPCTCPEHCERDHEND |
Ga0207669_119024482 | 3300025937 | Miscanthus Rhizosphere | MTPTSLIREKPVKPAARSTTAPAPRPQILTRAEVAPCTCPEHCER |
Ga0207661_108238542 | 3300025944 | Corn Rhizosphere | MSTTVVREKPVKPGERIIPTPRPPIVTRAESEPCTCPESCERDHERD |
Ga0207712_113163102 | 3300025961 | Switchgrass Rhizosphere | MSTTVIREKPVKPGARIIPTPRPPIVTRAESAPCTCPESCERDHEQD |
Ga0208415_10330182 | 3300025993 | Rice Paddy Soil | MARTLIREKPVKPSTAAPAPQLKRPTVVTRAEVAPCTCPEPCERDHERD |
Ga0207678_100176554 | 3300026067 | Corn Rhizosphere | MSTTAIREKPVKPDARIIPTPRPPIVTRAESAPCTCPEACERDHEQD |
Ga0207702_119504842 | 3300026078 | Corn Rhizosphere | MSTSTLTREKPVLPTSARPAPREERPEIVTRAEVAPCTCPEPCERDHE |
Ga0207648_101119333 | 3300026089 | Miscanthus Rhizosphere | MSTTVVREKPVKPGERIIPTPRPPIVTRAESEPCTCPESCERDHEQ |
Ga0207648_104539852 | 3300026089 | Miscanthus Rhizosphere | MTPTSLIREKPVKPAARSTTAPAPRPQILTRAEVAPCTCPEHCERDHEND |
Ga0207676_102324383 | 3300026095 | Switchgrass Rhizosphere | MTAMSTIRERPVKPAARAPEAPRPTIVTRAESAPCTCPEHCER |
Ga0207674_118228612 | 3300026116 | Corn Rhizosphere | MSTTAIREKPVKPDARIIPTPRPPIVTRAESEPCTCPESCERDHEQD |
Ga0209486_100993972 | 3300027886 | Agricultural Soil | MTPTSLVREKPVKPATTRPSQPAHRPVILTRAETAPCTCPEPCERDHEHD |
Ga0247828_100374343 | 3300028587 | Soil | MSSSSTLTREKPVRPTSARPVPREDRPQILTRAEVAPCTCPEPCERDHEND |
Ga0247823_107447131 | 3300028590 | Soil | MTPTSLIREKPVRPAVRDAPAATRPPILTRAETAPCTCPELCERDHEND |
Ga0247822_100910803 | 3300028592 | Soil | RMTPTSLIREKPVRPAVRDAPAATRPPILTRAETAPCTCPELCERDHEND |
Ga0247822_102055212 | 3300028592 | Soil | MSSSTLTREKPVRPTSARPVPREDRPQILTRAEVAPCTCPEPCERDHEND |
Ga0247825_102002701 | 3300028812 | Soil | MTPTSLIREKPVRPAVRDAPAATRPPILTRAETAPGTC |
Ga0247825_102108042 | 3300028812 | Soil | MSSSTVTRERPVLPTSARPAPREDRPQIVTRAEVALCTCPEPCERDHEND |
Ga0247827_108530652 | 3300028889 | Soil | MNATTLIREKAIKPAVRSAPAPAQPRPILTRAETAPCTCPEHCERDHEND |
Ga0247826_100209692 | 3300030336 | Soil | VTPTSLIREKPVKPQTRSAPASAPRPPILTRAEIVPCTCPEHCERDHEND |
Ga0247826_100221014 | 3300030336 | Soil | MTSTLIREKPVKPKTAAPAPVTQRPTILTRAEVAPCTCPEHCERDHEHD |
Ga0315553_103431601 | 3300031652 | Salt Marsh Sediment | REKPVRPSTAVSAPATERPPILTRAEVAPCTCPEHCERDHEHD |
Ga0310904_111364861 | 3300031854 | Soil | MTATLIREKPVKPKTATPAPQAERPPILTRAEVAP |
Ga0310900_119147202 | 3300031908 | Soil | MTPTSLIREKPVRPAVRDAPAATRPPIVTRAEVAPCTCPEHCERDHEND |
Ga0308175_1015351972 | 3300031938 | Soil | MTLIREKPVKPAVGPTTQTPRPTIVTRAESAPCTCPEHCERDHEND |
Ga0308175_1024561142 | 3300031938 | Soil | MSSTLIREKPVKPKTAAPAPRDERPTILTRAEIAPCTCPEPCERDHEHD |
Ga0310901_104938521 | 3300031940 | Soil | MSTTVVREKPVKPGERIIPTPRPPIVTRAESAPCTCPESCERDHEQD |
Ga0310885_105533682 | 3300031943 | Soil | MSSSTLTREKPVLPTSARPAPREDRPQIVTRAEVALCTCPEPCERDHEND |
Ga0308176_104251892 | 3300031996 | Soil | MTLIREKPVKPPVGPTTQTPRPTIVTRAESAPCTCPEHCERDHEND |
Ga0310906_109254682 | 3300032013 | Soil | MTSTLIREKPVKPKTAAPAPVAQRPTILTRAEVAPCTCPEHCERDHEHD |
Ga0310890_104334152 | 3300032075 | Soil | EERRMSTTVIREKPVKPSARTVPTPRPPIVTRAESAPCTCPEACERDHEQD |
Ga0310889_104880242 | 3300032179 | Soil | MTPTSLIREKPVKPAARSTTAPAPRPQILTRAEVAP |
Ga0247829_100857662 | 3300033550 | Soil | MTPTSLIREKPVRPAVRDAPAATRPPILTRAETAPCTCPEHCERDHEND |
Ga0373958_0212029_404_511 | 3300034819 | Rhizosphere Soil | PDARIIPTPRPPIVTRAESAPCTCPESCERDHEQD |
⦗Top⦘ |