Basic Information | |
---|---|
Family ID | F028005 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 193 |
Average Sequence Length | 42 residues |
Representative Sequence | MRGGVSISELHEMPVNHIDHLNEIVGENFEMSKKAGVPIL |
Number of Associated Samples | 154 |
Number of Associated Scaffolds | 193 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.04 % |
% of genes near scaffold ends (potentially truncated) | 36.79 % |
% of genes from short scaffolds (< 2000 bps) | 57.51 % |
Associated GOLD sequencing projects | 148 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (51.295 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (18.653 % of family members) |
Environment Ontology (ENVO) | Unclassified (62.694 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.047 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 193 Family Scaffolds |
---|---|---|
PF12322 | T4_baseplate | 22.28 |
PF07230 | Portal_Gp20 | 4.15 |
PF12850 | Metallophos_2 | 2.59 |
PF03420 | Peptidase_S77 | 2.07 |
PF07068 | Gp23 | 1.55 |
PF00149 | Metallophos | 1.04 |
PF13353 | Fer4_12 | 1.04 |
PF13476 | AAA_23 | 1.04 |
PF04965 | GPW_gp25 | 0.52 |
PF13186 | SPASM | 0.52 |
PF12697 | Abhydrolase_6 | 0.52 |
PF13884 | Peptidase_S74 | 0.52 |
PF01370 | Epimerase | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 51.30 % |
All Organisms | root | All Organisms | 48.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2236876008|none_p451476 | Not Available | 545 | Open in IMG/M |
3300000101|DelMOSum2010_c10029815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3018 | Open in IMG/M |
3300000101|DelMOSum2010_c10043177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2330 | Open in IMG/M |
3300000149|LPaug09P1610mDRAFT_c1000540 | Not Available | 6718 | Open in IMG/M |
3300000930|BpDRAFT_10192872 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
3300001352|JGI20157J14317_10035045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2547 | Open in IMG/M |
3300003216|JGI26079J46598_1008409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3238 | Open in IMG/M |
3300003216|JGI26079J46598_1010604 | All Organisms → Viruses → Predicted Viral | 2765 | Open in IMG/M |
3300003216|JGI26079J46598_1029630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1265 | Open in IMG/M |
3300003345|JGI26080J50196_1028236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1261 | Open in IMG/M |
3300003583|JGI26253J51717_1008594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2992 | Open in IMG/M |
3300004110|Ga0008648_10097088 | Not Available | 822 | Open in IMG/M |
3300004448|Ga0065861_1098904 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
3300005402|Ga0066855_10017531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2032 | Open in IMG/M |
3300005408|Ga0066848_10038659 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
3300005427|Ga0066851_10030021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1943 | Open in IMG/M |
3300005433|Ga0066830_10014273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1535 | Open in IMG/M |
3300005603|Ga0066853_10129968 | Not Available | 851 | Open in IMG/M |
3300005604|Ga0066852_10290191 | Not Available | 550 | Open in IMG/M |
3300005758|Ga0078117_1086665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4381 | Open in IMG/M |
3300005837|Ga0078893_10543772 | Not Available | 11144 | Open in IMG/M |
3300005934|Ga0066377_10000056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 24520 | Open in IMG/M |
3300005941|Ga0070743_10002067 | Not Available | 7610 | Open in IMG/M |
3300006011|Ga0066373_10017118 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
3300006090|Ga0082015_1001712 | All Organisms → Viruses → Predicted Viral | 3883 | Open in IMG/M |
3300006164|Ga0075441_10006301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 5195 | Open in IMG/M |
3300006164|Ga0075441_10013363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3462 | Open in IMG/M |
3300006164|Ga0075441_10015929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3144 | Open in IMG/M |
3300006164|Ga0075441_10023962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2510 | Open in IMG/M |
3300006164|Ga0075441_10094620 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
3300006164|Ga0075441_10183516 | Not Available | 783 | Open in IMG/M |
3300006165|Ga0075443_10017751 | All Organisms → Viruses → Predicted Viral | 2397 | Open in IMG/M |
3300006165|Ga0075443_10208978 | Not Available | 701 | Open in IMG/M |
3300006191|Ga0075447_10010749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3798 | Open in IMG/M |
3300006191|Ga0075447_10072554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1228 | Open in IMG/M |
3300006193|Ga0075445_10082596 | Not Available | 1220 | Open in IMG/M |
3300006193|Ga0075445_10276007 | Not Available | 572 | Open in IMG/M |
3300006352|Ga0075448_10013446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2661 | Open in IMG/M |
3300006613|Ga0101494_1071054 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
3300006752|Ga0098048_1002977 | Not Available | 7000 | Open in IMG/M |
3300006753|Ga0098039_1315663 | Not Available | 521 | Open in IMG/M |
3300006789|Ga0098054_1008135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4420 | Open in IMG/M |
3300006793|Ga0098055_1010048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4286 | Open in IMG/M |
3300006793|Ga0098055_1029638 | All Organisms → Viruses → Predicted Viral | 2275 | Open in IMG/M |
3300006902|Ga0066372_10466328 | Not Available | 738 | Open in IMG/M |
3300006925|Ga0098050_1040144 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
3300006947|Ga0075444_10018953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3601 | Open in IMG/M |
3300006947|Ga0075444_10023969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3117 | Open in IMG/M |
3300007513|Ga0105019_1000279 | All Organisms → cellular organisms → Bacteria | 89669 | Open in IMG/M |
3300007554|Ga0102820_1040343 | Not Available | 1138 | Open in IMG/M |
3300007623|Ga0102948_1001233 | Not Available | 10126 | Open in IMG/M |
3300007665|Ga0102908_1079274 | Not Available | 652 | Open in IMG/M |
3300007692|Ga0102823_1024927 | Not Available | 1643 | Open in IMG/M |
3300007715|Ga0102827_1087038 | Not Available | 704 | Open in IMG/M |
3300007756|Ga0105664_1094144 | Not Available | 594 | Open in IMG/M |
3300007777|Ga0105711_1465287 | Not Available | 630 | Open in IMG/M |
3300008224|Ga0105350_10310058 | Not Available | 580 | Open in IMG/M |
3300008253|Ga0105349_10058026 | All Organisms → Viruses → Predicted Viral | 1624 | Open in IMG/M |
3300008738|Ga0115660_1017480 | All Organisms → Viruses → Predicted Viral | 4894 | Open in IMG/M |
3300008993|Ga0104258_1000286 | Not Available | 7625 | Open in IMG/M |
3300009003|Ga0102813_1008561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4089 | Open in IMG/M |
3300009052|Ga0102886_1123592 | Not Available | 779 | Open in IMG/M |
3300009086|Ga0102812_10458570 | Not Available | 695 | Open in IMG/M |
3300009141|Ga0102884_1163167 | Not Available | 565 | Open in IMG/M |
3300009420|Ga0114994_10004070 | Not Available | 10622 | Open in IMG/M |
3300009420|Ga0114994_10021324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4559 | Open in IMG/M |
3300009420|Ga0114994_10037364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3382 | Open in IMG/M |
3300009420|Ga0114994_10114543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1832 | Open in IMG/M |
3300009420|Ga0114994_10355719 | Not Available | 972 | Open in IMG/M |
3300009420|Ga0114994_11010753 | Not Available | 538 | Open in IMG/M |
3300009436|Ga0115008_10003091 | All Organisms → cellular organisms → Bacteria | 13777 | Open in IMG/M |
3300009467|Ga0115565_10129029 | Not Available | 1184 | Open in IMG/M |
3300009606|Ga0115102_10421382 | Not Available | 605 | Open in IMG/M |
3300009606|Ga0115102_10782682 | Not Available | 800 | Open in IMG/M |
3300009705|Ga0115000_10004993 | Not Available | 10721 | Open in IMG/M |
3300010151|Ga0098061_1271200 | Not Available | 588 | Open in IMG/M |
3300012417|Ga0138262_1506368 | Not Available | 676 | Open in IMG/M |
3300012936|Ga0163109_10257419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1279 | Open in IMG/M |
3300012936|Ga0163109_10262117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1267 | Open in IMG/M |
3300012953|Ga0163179_10030438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3628 | Open in IMG/M |
3300012954|Ga0163111_12574786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 519 | Open in IMG/M |
3300017728|Ga0181419_1000039 | All Organisms → cellular organisms → Bacteria | 39124 | Open in IMG/M |
3300017755|Ga0181411_1238581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 503 | Open in IMG/M |
3300017824|Ga0181552_10012195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 5573 | Open in IMG/M |
3300017950|Ga0181607_10119026 | Not Available | 1641 | Open in IMG/M |
3300017962|Ga0181581_10007109 | All Organisms → cellular organisms → Bacteria | 8688 | Open in IMG/M |
3300017967|Ga0181590_10211083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1452 | Open in IMG/M |
3300017985|Ga0181576_10008092 | Not Available | 7479 | Open in IMG/M |
3300018876|Ga0181564_10159302 | Not Available | 1344 | Open in IMG/M |
3300020166|Ga0206128_1000048 | All Organisms → cellular organisms → Bacteria | 143906 | Open in IMG/M |
3300020166|Ga0206128_1000169 | Not Available | 78433 | Open in IMG/M |
3300020166|Ga0206128_1003640 | Not Available | 12583 | Open in IMG/M |
3300020166|Ga0206128_1012345 | Not Available | 5340 | Open in IMG/M |
3300020182|Ga0206129_10000369 | All Organisms → cellular organisms → Bacteria | 72893 | Open in IMG/M |
3300020182|Ga0206129_10005613 | Not Available | 13137 | Open in IMG/M |
3300020182|Ga0206129_10031106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3786 | Open in IMG/M |
3300020264|Ga0211526_1086636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 533 | Open in IMG/M |
3300020298|Ga0211657_1012707 | All Organisms → Viruses → Predicted Viral | 2110 | Open in IMG/M |
3300020314|Ga0211522_1000216 | All Organisms → cellular organisms → Bacteria | 21654 | Open in IMG/M |
3300020335|Ga0211690_1033434 | Not Available | 1244 | Open in IMG/M |
3300020347|Ga0211504_1024432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1578 | Open in IMG/M |
3300020365|Ga0211506_1003654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4835 | Open in IMG/M |
3300020376|Ga0211682_10019181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2784 | Open in IMG/M |
3300020377|Ga0211647_10135341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 824 | Open in IMG/M |
3300020416|Ga0211644_10183459 | Not Available | 857 | Open in IMG/M |
3300020444|Ga0211578_10249710 | Not Available | 720 | Open in IMG/M |
3300021084|Ga0206678_10273627 | Not Available | 818 | Open in IMG/M |
3300021085|Ga0206677_10105848 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
3300021185|Ga0206682_10268271 | Not Available | 753 | Open in IMG/M |
3300021347|Ga0213862_10001406 | All Organisms → cellular organisms → Bacteria | 10063 | Open in IMG/M |
3300021350|Ga0206692_1715321 | Not Available | 537 | Open in IMG/M |
3300021364|Ga0213859_10088908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1466 | Open in IMG/M |
3300021389|Ga0213868_10006058 | Not Available | 10736 | Open in IMG/M |
3300022074|Ga0224906_1098822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 865 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10053394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2532 | Open in IMG/M |
3300023565|Ga0228688_122830 | Not Available | 529 | Open in IMG/M |
3300023566|Ga0228679_1033183 | Not Available | 543 | Open in IMG/M |
3300023676|Ga0232114_128416 | Not Available | 549 | Open in IMG/M |
3300023694|Ga0228683_1031441 | Not Available | 582 | Open in IMG/M |
3300023702|Ga0232119_1035371 | Not Available | 766 | Open in IMG/M |
3300023704|Ga0228684_1058103 | Not Available | 602 | Open in IMG/M |
3300023704|Ga0228684_1082389 | Not Available | 504 | Open in IMG/M |
3300024185|Ga0228669_1016595 | Not Available | 1776 | Open in IMG/M |
3300024188|Ga0228602_1029814 | Not Available | 797 | Open in IMG/M |
3300024228|Ga0228633_1006289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3571 | Open in IMG/M |
3300024229|Ga0233402_1017353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1597 | Open in IMG/M |
3300024236|Ga0228655_1000719 | Not Available | 11126 | Open in IMG/M |
3300024237|Ga0228653_1092915 | Not Available | 650 | Open in IMG/M |
3300024237|Ga0228653_1094705 | Not Available | 642 | Open in IMG/M |
3300024244|Ga0228678_1092608 | Not Available | 584 | Open in IMG/M |
(restricted) 3300024264|Ga0233444_10008738 | Not Available | 8493 | Open in IMG/M |
3300024281|Ga0228610_1048720 | Not Available | 589 | Open in IMG/M |
3300024315|Ga0228618_1017875 | Not Available | 971 | Open in IMG/M |
3300024334|Ga0228671_1148248 | Not Available | 534 | Open in IMG/M |
3300024346|Ga0244775_10038775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4205 | Open in IMG/M |
3300024346|Ga0244775_10039832 | All Organisms → Viruses → Predicted Viral | 4144 | Open in IMG/M |
3300024346|Ga0244775_10418914 | Not Available | 1100 | Open in IMG/M |
3300025078|Ga0208668_1002961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4211 | Open in IMG/M |
3300025137|Ga0209336_10000002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 187122 | Open in IMG/M |
3300025658|Ga0209659_1028638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2236 | Open in IMG/M |
3300025673|Ga0209494_1003061 | All Organisms → Viruses | 7121 | Open in IMG/M |
3300025676|Ga0209657_1076383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1092 | Open in IMG/M |
3300025688|Ga0209140_1116622 | Not Available | 809 | Open in IMG/M |
3300025776|Ga0208699_1000386 | Not Available | 8823 | Open in IMG/M |
3300026123|Ga0209955_1000141 | Not Available | 29292 | Open in IMG/M |
3300026423|Ga0247580_1098646 | Not Available | 544 | Open in IMG/M |
3300026434|Ga0247591_1104748 | Not Available | 521 | Open in IMG/M |
3300026453|Ga0228644_1008253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2363 | Open in IMG/M |
3300026466|Ga0247598_1035432 | Not Available | 1405 | Open in IMG/M |
3300026468|Ga0247603_1014146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1411 | Open in IMG/M |
3300026495|Ga0247571_1143308 | Not Available | 562 | Open in IMG/M |
3300026500|Ga0247592_1067831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 869 | Open in IMG/M |
3300026503|Ga0247605_1164527 | Not Available | 531 | Open in IMG/M |
3300026513|Ga0247590_1156742 | Not Available | 583 | Open in IMG/M |
3300027522|Ga0209384_1073552 | Not Available | 863 | Open in IMG/M |
3300027668|Ga0209482_1002501 | Not Available | 11377 | Open in IMG/M |
3300027668|Ga0209482_1011159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4283 | Open in IMG/M |
3300027668|Ga0209482_1015484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3466 | Open in IMG/M |
3300027668|Ga0209482_1052410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1482 | Open in IMG/M |
3300027672|Ga0209383_1031117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2158 | Open in IMG/M |
3300027704|Ga0209816_1004346 | Not Available | 9390 | Open in IMG/M |
3300027704|Ga0209816_1010157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 5558 | Open in IMG/M |
3300027704|Ga0209816_1017353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3933 | Open in IMG/M |
3300027774|Ga0209433_10143373 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 894 | Open in IMG/M |
3300027779|Ga0209709_10372965 | Not Available | 576 | Open in IMG/M |
3300027813|Ga0209090_10001177 | Not Available | 16740 | Open in IMG/M |
3300027813|Ga0209090_10019949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3930 | Open in IMG/M |
3300027827|Ga0209035_10146975 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
3300028099|Ga0247576_1100559 | Not Available | 567 | Open in IMG/M |
3300028110|Ga0247584_1149545 | Not Available | 576 | Open in IMG/M |
3300028126|Ga0228648_1034379 | Not Available | 923 | Open in IMG/M |
3300028233|Ga0256417_1160131 | Not Available | 604 | Open in IMG/M |
3300028336|Ga0247583_1105229 | Not Available | 587 | Open in IMG/M |
3300028338|Ga0247567_1122037 | Not Available | 560 | Open in IMG/M |
3300028488|Ga0257113_1246551 | Not Available | 508 | Open in IMG/M |
3300031142|Ga0308022_1034700 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
3300031142|Ga0308022_1048878 | Not Available | 1321 | Open in IMG/M |
3300031599|Ga0308007_10001495 | Not Available | 10265 | Open in IMG/M |
3300031599|Ga0308007_10010127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3759 | Open in IMG/M |
3300031602|Ga0307993_1153096 | Not Available | 578 | Open in IMG/M |
3300031602|Ga0307993_1161026 | Not Available | 563 | Open in IMG/M |
3300031606|Ga0302119_10208312 | Not Available | 756 | Open in IMG/M |
3300031644|Ga0308001_10243622 | Not Available | 696 | Open in IMG/M |
3300031647|Ga0308012_10012111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3475 | Open in IMG/M |
3300031655|Ga0308018_10063153 | All Organisms → Viruses → Predicted Viral | 1329 | Open in IMG/M |
3300031658|Ga0307984_1054221 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
3300031658|Ga0307984_1154535 | Not Available | 640 | Open in IMG/M |
3300031675|Ga0302122_10106585 | Not Available | 1164 | Open in IMG/M |
3300031683|Ga0308006_10123639 | Not Available | 797 | Open in IMG/M |
3300031695|Ga0308016_10343148 | Not Available | 539 | Open in IMG/M |
3300031757|Ga0315328_10291057 | Not Available | 954 | Open in IMG/M |
3300031886|Ga0315318_10032368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2724 | Open in IMG/M |
3300032360|Ga0315334_10040629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3322 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 18.65% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 18.65% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.62% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.74% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.66% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.15% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.63% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.11% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.11% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.07% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.55% |
Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 1.55% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.55% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.04% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.04% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.04% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.04% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.04% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.52% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.52% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.52% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.52% |
Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 0.52% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.52% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.52% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.52% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.52% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.52% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.52% |
Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.52% |
Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.52% |
Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.52% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2236876008 | Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-3LG-Deep1200 | Environmental | Open in IMG/M |
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
3300000930 | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
3300003583 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA | Environmental | Open in IMG/M |
3300004110 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006011 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_O2min_ad_340m_LV | Environmental | Open in IMG/M |
3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
3300006613 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNA | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
3300007756 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
3300007777 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly | Environmental | Open in IMG/M |
3300008224 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1E Hudson Canyon | Environmental | Open in IMG/M |
3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
3300008738 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
3300012417 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
3300020298 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX556051-ERR599128) | Environmental | Open in IMG/M |
3300020314 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974) | Environmental | Open in IMG/M |
3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
3300020444 | Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980) | Environmental | Open in IMG/M |
3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300023565 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023566 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023676 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023694 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023702 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023704 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
3300024188 | Seawater microbial communities from Monterey Bay, California, United States - 2D | Environmental | Open in IMG/M |
3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
3300024244 | Seawater microbial communities from Monterey Bay, California, United States - 125D_r | Environmental | Open in IMG/M |
3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
3300024281 | Seawater microbial communities from Monterey Bay, California, United States - 11D | Environmental | Open in IMG/M |
3300024315 | Seawater microbial communities from Monterey Bay, California, United States - 20D | Environmental | Open in IMG/M |
3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025673 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon (SPAdes) | Environmental | Open in IMG/M |
3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025688 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025776 | Marine microbial communities from the Deep Pacific Ocean - MP2097 (SPAdes) | Environmental | Open in IMG/M |
3300026123 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026423 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026434 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
3300026466 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026468 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026495 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026513 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027774 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes) | Environmental | Open in IMG/M |
3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300028099 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 33R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028336 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 42R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028338 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
3300031647 | Marine microbial communities from water near the shore, Antarctic Ocean - #179 | Environmental | Open in IMG/M |
3300031655 | Marine microbial communities from water near the shore, Antarctic Ocean - #282 | Environmental | Open in IMG/M |
3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
3300031683 | Marine microbial communities from water near the shore, Antarctic Ocean - #69 | Environmental | Open in IMG/M |
3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
none_4514761 | 2236876008 | Marine Estuarine | LTWYMRGGVSISELHEMPAGHIKYLNEVVKDNFELSKKAGTPIL |
DelMOSum2010_100298153 | 3300000101 | Marine | MLQLTWYMRGGVSISELYDMEANHISHISAIVESNFELSKQAGMPIL* |
DelMOSum2010_100431773 | 3300000101 | Marine | MLKLTWYMRGGVSISELYDMEATHISHITSIVESNFELSKQAGVPIL* |
LPaug09P1610mDRAFT_10005408 | 3300000149 | Marine | MRGGVSISELHEMPVNHIKHLNDIIDQNFEMSKKAGTPIL* |
BpDRAFT_101928722 | 3300000930 | Freshwater And Marine | MRGGVSISEIHDMPAEHIGHLNSIIDDNFEMSKKAGTPIL* |
JGI20157J14317_100350453 | 3300001352 | Pelagic Marine | MLKLTWYMRGGVSISELYDMEANHISHITSIVEGNFELSKQAGMPIL* |
JGI26079J46598_10084093 | 3300003216 | Marine | MLKLTWYMRGGVSISELHDMPVSHIDHINEIIKENYEMSKQAGVPIL* |
JGI26079J46598_10106042 | 3300003216 | Marine | MLKLTWYMRGGVSISELHDMPVGHIAHINDIIKDNYEMSKQAGVPIL* |
JGI26079J46598_10296302 | 3300003216 | Marine | MLKLTWYMRGGVSITELYDMEANHISHINSIVESNFELSKQAGVPIL* |
JGI26080J50196_10282362 | 3300003345 | Marine | MLKLTWYMRGGVSISELYDMEANHISHINSIIESNFELSKQAGMPIL* |
JGI26253J51717_10085941 | 3300003583 | Marine | MLKLTWYMRGGVSISELHNMPVSHIDHINEIIKENYEMSKQAGVPIL* |
Ga0008648_100970881 | 3300004110 | Marine | MRGGVSISEIHDMPANHIKYLNEIVSDNFELSKSAGVPIL* |
Ga0065861_10989047 | 3300004448 | Marine | NMLKLTWYMRGGVSISELHDMPVGHIAHINDIIKDNYEMSKQAGVPIL* |
Ga0066855_100175312 | 3300005402 | Marine | MRGGVSISELHDMPASHIAHLNEIVSDNFELSKSAGVPIL* |
Ga0066848_100386592 | 3300005408 | Marine | MRGGVSISELHEMPSGHIHHLNEIVQENFDLSQKAGTPIL* |
Ga0066851_100300213 | 3300005427 | Marine | MRGGVSISEIQDMPLGHLKHINDIVGENFEMSKKAGVPIL* |
Ga0066830_100142733 | 3300005433 | Marine | MRGGVSISELHEMPVTHIKHLNDIIDQNFEMSKKAGTPIL* |
Ga0066853_101299682 | 3300005603 | Marine | MRGGVSISELHDMPAGHIHHLNEIVQENFDLSQKAGTPIL* |
Ga0066852_102901912 | 3300005604 | Marine | MRGGVSITELHEMPANHISYLNEIVQENFELSKNAGTPIL* |
Ga0078117_10866653 | 3300005758 | Lake Water | MRGGVSISEIYDMPITHIEHIHKIIGENFEMSKKAKTPIL* |
Ga0078893_105437729 | 3300005837 | Marine Surface Water | MLKLTWYMRGGVSISELHDMPATHLEYINDIIKENYEMSKQAGVPIL* |
Ga0066377_1000005619 | 3300005934 | Marine | MRGGVSISELHNMPVTHIKHLNEIVEKNFEMSKKAGMPIL* |
Ga0070743_100020673 | 3300005941 | Estuarine | MFHKGMLKLSWYMRGGVSISEIHDMPAEHIGHLNSIIDDNFEMSKKAGTPIL* |
Ga0066373_100171182 | 3300006011 | Marine | MRGGVSISELHDMPVNHITYLNEIVSDNFELSKSAGVPIL* |
Ga0082015_10017126 | 3300006090 | Marine | TLHKSLLKLTWYMRGGVSISELHEMPSGHIHHLNEIVQENFDLSQKAGTPIL* |
Ga0075441_100063013 | 3300006164 | Marine | LHKTLLKITWYMRGGVSISELHEMPVGHIEHLNAIIGENFEMSKKAGMAIL* |
Ga0075441_100133634 | 3300006164 | Marine | MRGGVSISELHGMPADHIRYLNEIVTENFELSKQAGTPIL* |
Ga0075441_100159293 | 3300006164 | Marine | MRGGVGISELHGMPANHLRYLNEIVSDNFELSKQAGTPIL* |
Ga0075441_100239623 | 3300006164 | Marine | MRGGVGISELHDMPASHLKFLNEVVQENFELSKNAGTPIL* |
Ga0075441_100946202 | 3300006164 | Marine | MRGGVSISELQEMPVGHIDHLNEIINENFELSKQAGTPIL* |
Ga0075441_101835162 | 3300006164 | Marine | MRGGVSISEIHNMPVGHLKYINDIVGENFELSKKAGVPIL* |
Ga0075443_100177516 | 3300006165 | Marine | SWYMRGGVSISEIHQMPADHIKYLNEIVNDNFEMSKQAGTPIL* |
Ga0075443_102089781 | 3300006165 | Marine | VGISELHGMPANHLRYLNEIVSDNFELSKQAGTPIL* |
Ga0075447_100107494 | 3300006191 | Marine | MRGGVSISELHDMPTGHISYLNEIVNDNFELSKKAGVPIL* |
Ga0075447_100725542 | 3300006191 | Marine | MRGGVSITELHEMPANHIDHLNDIVNENFEMSKKAGMPIL* |
Ga0075445_100825963 | 3300006193 | Marine | MRGGVSISELHEMPVGHIEHLNAIIGENFEMSKKAGMAIL* |
Ga0075445_102760072 | 3300006193 | Marine | MRGGVSISELHQMPVGHIDHLNDIITENFEMSKKAGMPIL* |
Ga0075448_100134463 | 3300006352 | Marine | MRGGVSISEIHQMPADHIKYLNEIVNDNFEMSKQAGTPIL* |
Ga0101494_10710541 | 3300006613 | Diffuse Hydrothermal Flow Volcanic Vent | GGVSISELHEMPAGHIKYLNEVVKDNFELSKKAGTPIL* |
Ga0098048_100297710 | 3300006752 | Marine | MRGGVSISELHEMPANHIEYLNEIVQDNFELSKNAGTPIL* |
Ga0098039_13156632 | 3300006753 | Marine | MRGGVSISELHDMPAGHIAHLNEIVTDNFELSKKAGTPIL* |
Ga0098054_10081354 | 3300006789 | Marine | MRGGVSIPELHEMPANHIEYLNEIVQDNFELSKNAGTPIL* |
Ga0098055_10100484 | 3300006793 | Marine | MRGGVSISELHNMPANHIRYLNEIVSENFELSKNAGTPIL* |
Ga0098055_10296382 | 3300006793 | Marine | MRGGVSISELHDMPASHIKYLNEIVSENFELSKNAGMPIL* |
Ga0066372_104663282 | 3300006902 | Marine | MRGGVSISELHDMPASHIAYLNEIVTDNFELSKKAGIPIL* |
Ga0098050_10401442 | 3300006925 | Marine | MRGGVSISELHDMPANHIKYLNEIVSDNFELSKSAGVPIL* |
Ga0075444_100189533 | 3300006947 | Marine | MRGGVSISELHEMPTGHIDHLNEIVNDNFEMSKKAGVPIL* |
Ga0075444_100239693 | 3300006947 | Marine | MRGGVSISELHDMPVAHISYLNEIVTDNFELSKQAGVPIL* |
Ga0105019_100027944 | 3300007513 | Marine | MRGGVSISELHDMPINHITYLNDIVSENFEMSKKAGVPIL* |
Ga0102820_10403431 | 3300007554 | Estuarine | GVSISELHAMPVTHISHLNEIIKDNFELSKKAGTPIL* |
Ga0102948_10012333 | 3300007623 | Water | MRGGVSISEIHEMPVTHIKHLNSIIENNFEMSKKAGTPII* |
Ga0102908_10792741 | 3300007665 | Estuarine | KLTWYMRGGVSISELHNMPANHIRYLNEIVSENFELSKNAGTPIL* |
Ga0102823_10249272 | 3300007692 | Estuarine | MRGGVSISELHEMPANHIDYLNEIVKDNFELSKNAGTPIL* |
Ga0102827_10870382 | 3300007715 | Estuarine | MRGGVSISEIHDMPAEHIGHLNSIIDDNFEMSKKAGTTIL* |
Ga0105664_10941441 | 3300007756 | Background Seawater | MRGGVSISELHDMPTGHIAYLNEIVNENFELSKKAGTPIL* |
Ga0105711_14652871 | 3300007777 | Diffuse Vent Fluid, Hydrothermal Vents | SLLKLTWYMRGGVSITELHEMPAGHISHLNAIINENFELSKKAGTPIL* |
Ga0105350_103100582 | 3300008224 | Methane Seep Mesocosm | MRGGVSISELHQMPVSHIDHLNDIITENFEMSKKAGMPII* |
Ga0105349_100580261 | 3300008253 | Methane Seep Mesocosm | MRGGVSISELHDMPVNHITYLNDIVSENFEMSKKAGVPIL* |
Ga0115660_10174801 | 3300008738 | Marine | TWYMRGGVSISEIHDMPANHIKHLNDIVNDNFELSKSAGVPIL* |
Ga0104258_100028610 | 3300008993 | Ocean Water | MLKLTWYMRGGVSISELHGMPVSHIDHINEIIKENYEMSKQAGVPIL* |
Ga0102813_10085612 | 3300009003 | Estuarine | MRGGVSISELHEMPANHIDYLNEIVRDNFELSKNAGTPIL* |
Ga0102886_11235921 | 3300009052 | Estuarine | YMRGGVSISELHEMPTSHIKHLNEIISENFEMSKKAGTPIL* |
Ga0102812_104585701 | 3300009086 | Estuarine | MLQLTWYMRGGVSISELYDMEANHISHISAIVESNFELS |
Ga0102884_11631671 | 3300009141 | Estuarine | LTWYMRGGVSISELHNMPANHIRYLNEIVSENFELSKNAGTPIL* |
Ga0114994_100040709 | 3300009420 | Marine | MRGGVSISELHDMPANHLKYLNEVVSENFELSKNAGTPIL* |
Ga0114994_100213242 | 3300009420 | Marine | LKLTWYMRGGVSISELHEMPAGHIEHLNDIVTENFEMSKQAGVPIL* |
Ga0114994_100373642 | 3300009420 | Marine | MRGGVSISELHEMPANHLDYLNDIVNENFEMSKKAGMPIL* |
Ga0114994_101145432 | 3300009420 | Marine | MRGGVSISEIHQMPADHIQYLNEIVNDNFELSKQAGVPIL* |
Ga0114994_103557191 | 3300009420 | Marine | SISEIHQMPADHIKYLNEIVNDNFEMSKQAGVPIL* |
Ga0114994_110107532 | 3300009420 | Marine | MRGGVSISEIHQMPADHIKYLNEIVNDNFEMSKQAGVPIL* |
Ga0115008_1000309113 | 3300009436 | Marine | MLKLTWYMRGGVSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL* |
Ga0115565_101290291 | 3300009467 | Pelagic Marine | TWYMRGGVSISELYDMEANHISHISAIVESNFELSKQAGVPIL* |
Ga0115102_104213821 | 3300009606 | Marine | KNMLKLTWYMRGGVSISELHDMPVGHIAHINDIIKDNYEMSKQAGVPIL* |
Ga0115102_107826821 | 3300009606 | Marine | ISELHNMPVSHIDHINEIIKENYEMSKQAGTPIL* |
Ga0115000_100049939 | 3300009705 | Marine | MRGGVSISELHEMPAGHIEHLNDIVTENFEMSKQAGVPIL* |
Ga0098061_12712001 | 3300010151 | Marine | YMRGGVSISEIHEMPAGHIDYLNEIVNENFEMSKQAGTPII* |
Ga0138262_15063681 | 3300012417 | Polar Marine | YMRGGVSITELHEMPANHIDHLNDIVNENFEMSKKAGMPIL* |
Ga0163109_102574192 | 3300012936 | Surface Seawater | MRGGVSISELHNMPVTHIKHLNGIVEKNFEMSKKAGMPIL* |
Ga0163109_102621172 | 3300012936 | Surface Seawater | MRGGVSIRELHDMPVNHIKHLNEIVEKNFEMSKKAGMPIL* |
Ga0163179_100304382 | 3300012953 | Seawater | MRGGVTIRDLHDMPVGHIKHINEIIEKNFDMSKKAGMPIL* |
Ga0163111_125747861 | 3300012954 | Surface Seawater | MRGGVSISELHEMPVNHIKHLNEIIDQNFEMSKKAGMPIL* |
Ga0181419_10000393 | 3300017728 | Seawater | MRGGVSISELNEMPVGHIKHLNEIIDQNFEMSKKAGTPIL |
Ga0181411_12385811 | 3300017755 | Seawater | MRGGVSISELHEMPVNHIKHLNEIIDQNFEMSKKA |
Ga0181552_100121954 | 3300017824 | Salt Marsh | MRGGVSISELHDMPAGHIKYLNEIVSENYEMSKKAGMPIL |
Ga0181607_101190263 | 3300017950 | Salt Marsh | MRGGVSISELHDMPVGHIKHLNDIIGENYEMSKKAGVPIL |
Ga0181581_100071091 | 3300017962 | Salt Marsh | GVNIEHLYEMPAEHIKHINAIIEENFEMSKKAGMPIL |
Ga0181590_102110833 | 3300017967 | Salt Marsh | MRGGVNIEHLYEMPAEHIKHINAIIEENFEMSKKAGMPI |
Ga0181576_100080921 | 3300017985 | Salt Marsh | MRGGVNIEHLYEMPAEHIKHINAIIEENFEMSKKAGMPIL |
Ga0181564_101593022 | 3300018876 | Salt Marsh | LLKLSWYMRGGVSISELHDMPAGHIKYLNEIVSENYEMSKKAGMPIL |
Ga0206128_1000048131 | 3300020166 | Seawater | MLKLTWYMRGGVSISELHDMPVGHIAHINDIIKDNYEMSKQAGVPIL |
Ga0206128_100016911 | 3300020166 | Seawater | MLKLTWYMRGGVSISELYDMEANHISHITSIVEGNFELSKQAGMPIL |
Ga0206128_10036409 | 3300020166 | Seawater | MFHKGMLKLSWYMRGGVSISEIHDMPAEHIGHLNSIIDDNFEMSKKAGTPIL |
Ga0206128_10123454 | 3300020166 | Seawater | MLKLTWYMRGGVSITELYDMEANHISHITSIVESNFELSKQAGVPIL |
Ga0206129_1000036939 | 3300020182 | Seawater | MRGGVSISELHDMPVGHIAHINDIIKDNYEMSKQAGVPIL |
Ga0206129_100056134 | 3300020182 | Seawater | MLKLTWYMRGGVSISELYDMEANHISHINSIVEGNFELSKKAGMPIL |
Ga0206129_100311063 | 3300020182 | Seawater | MLQLTWYMRGGVSISELYDMEANHISHISAIVESNFELSKQAGMPIL |
Ga0211526_10866362 | 3300020264 | Marine | MRGGVSISELHNMPVTHIKHLNGIVEKNFEMSKKAGMPIL |
Ga0211657_10127071 | 3300020298 | Marine | MRGGVSISELHDMPAGHIAYLNEIVTDNFELSKKAGTPIL |
Ga0211522_10002164 | 3300020314 | Marine | MRGGVSIRELHDMPVNHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0211690_10334342 | 3300020335 | Marine | SLYKLTWYMRGGVSISELHDMPASHIKYLNEIVSENFELSKNAGTPIL |
Ga0211504_10244322 | 3300020347 | Marine | MRGGVSISELHEMPVGHIKHLNEIIDQNFEMSKKAGTPIL |
Ga0211506_10036544 | 3300020365 | Marine | MRGGVSISELHEMPVTHIKHLNDIIDQNFEMSKKAGTPIL |
Ga0211682_100191813 | 3300020376 | Marine | MRGGVSISELHGMPADHIRYLNEIVTENFELSKQAGTPIL |
Ga0211647_101353411 | 3300020377 | Marine | MRGGVSISELHNMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0211644_101834591 | 3300020416 | Marine | KALDNTHKNLLQLSWYMRGGVSIRELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0211578_102497102 | 3300020444 | Marine | MRGGVSISELHDMPVGHIDYLNDIVTDNFELSKTAGVPIL |
Ga0206678_102736271 | 3300021084 | Seawater | MRGGVSISELHQMPVSHIDHLNDIITENFEMSKKAGMPIL |
Ga0206677_101058481 | 3300021085 | Seawater | MLKLTWYMRGGVSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0206682_102682712 | 3300021185 | Seawater | MLKLTWYMRGGVSISELYDMEANHISHINSIIESNFELSKQAGMPIL |
Ga0213862_100014063 | 3300021347 | Seawater | MLKLTWYMRGGVSISELYDMEATHISHITSIVESNFELSKQAGVPIL |
Ga0206692_17153211 | 3300021350 | Seawater | GVSISELHEMPVGHIKHLNEIIDQNFEMSKKAGTPIL |
Ga0213859_100889081 | 3300021364 | Seawater | MRGGVSISELHDMPVGHITHLNEIIGENYEASKKAGM |
Ga0213868_100060581 | 3300021389 | Seawater | MRGGVSISELHEMPANHIDYLNEIVRDNFELSKNAGTPIL |
Ga0224906_10988222 | 3300022074 | Seawater | MRGGVTIRDLHDMPVGHIKYINEIIEKNFDMSKKAGMPIL |
(restricted) Ga0233432_100533943 | 3300023109 | Seawater | MLKLTWYMRGGVSISELHNMPVSHIDHINEIIKENYEMSKQAGVPIL |
Ga0228688_1228301 | 3300023565 | Seawater | VSISELHEMPVGHIKHLNEIIDQNFEMSKKAGTPIL |
Ga0228679_10331831 | 3300023566 | Seawater | SISELHEMPVGHIKHLNEIIDQNFEMSKKAGTPIL |
Ga0232114_1284161 | 3300023676 | Seawater | RGGVSISELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0228683_10314411 | 3300023694 | Seawater | KNLLQLSWYMRGGVSISELHEMPVGHIKHLNEIIDQNFEMSKKAGTPIL |
Ga0232119_10353711 | 3300023702 | Seawater | GGVSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0228684_10581031 | 3300023704 | Seawater | GGVSISELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0228684_10823891 | 3300023704 | Seawater | LHKNMLKLTWYMRGGVSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0228669_10165951 | 3300024185 | Seawater | SISELHDMPAGHIQHLNEIVSENFELSKQAGTPIL |
Ga0228602_10298141 | 3300024188 | Seawater | MRGGVSISELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0228633_10062894 | 3300024228 | Seawater | MRGGVSISELHDMPAGHIQHLNEIVSENFELSKQAGTPIL |
Ga0233402_10173533 | 3300024229 | Seawater | MRGGVSISELHDMPVSHIKHLNEIVTENYDASKKSGMPLL |
Ga0228655_10007197 | 3300024236 | Seawater | MRGGVSISEIHDMPANHIKYLNEIVSDNFELSKSAGVPIL |
Ga0228653_10929151 | 3300024237 | Seawater | GGVSISELHDMPAGHIQHLNEIVSENFELSKQAGTPIL |
Ga0228653_10947051 | 3300024237 | Seawater | MLKLTWYMRGGVSISELHDMPVSHIDHINEIIKENYEMSKQ |
Ga0228678_10926082 | 3300024244 | Seawater | MRGGVSISELHEMPANHIEYLNEIVQDNFELSKNAGTHIL |
(restricted) Ga0233444_100087383 | 3300024264 | Seawater | MLKLTWYMRGGVSISELHDMPVSHIDHINEIIKENYEMSKQAGVPIL |
Ga0228610_10487201 | 3300024281 | Seawater | HKNLYKLSWYMRGGVSISEIHDMPANHIKYLNEIVSDNFELSKSAGVPIL |
Ga0228618_10178754 | 3300024315 | Seawater | MRGGVSISEIHDMPANHIKYLNEIVSDNFELSKSAGVPI |
Ga0228671_11482482 | 3300024334 | Seawater | MRGGVSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0244775_100387753 | 3300024346 | Estuarine | MRGGVSISELHEMPANHIDYLNEIVKDNFELSKNAGTPIL |
Ga0244775_100398321 | 3300024346 | Estuarine | SLYKLTWYMRGGVSISELHGMPSNHIQYLNEIVSENFELSKQAGTPIL |
Ga0244775_104189142 | 3300024346 | Estuarine | MLKLTWYMRGGVSITELYDMEANHISHINSIVESNFELSKQAGVPIL |
Ga0208668_10029614 | 3300025078 | Marine | MRGGVSISELHEMPSGHIHHLNEIVQENFDLSQKAGTPIL |
Ga0209336_1000000272 | 3300025137 | Marine | MRGGVSISELHEMPVNHIKHLNDIIDQNFEMSKKAGTPIL |
Ga0209659_10286383 | 3300025658 | Marine | MLKLTWYMRGGVSISELYDMEANHISHINSIVEGNFELSKQAGMPIL |
Ga0209494_10030615 | 3300025673 | Methane Seep Mesocosm | MRGGVSISELHDMPVNHITYLNDIVSENFEMSKKAGVPIL |
Ga0209657_10763831 | 3300025676 | Marine | MRGGVSISELHNMPANHIRYLNEIVSENFELSKNAGTP |
Ga0209140_11166221 | 3300025688 | Marine | LTWYMRGGVSISELHEMPVNHINHLNEIIKDNFELSKKAGTPIL |
Ga0208699_100038613 | 3300025776 | Deep Ocean | KSLLKLTWYMRGGVSISELHEMPSGHIHHLNEIIQENFDLSQKAGTPIL |
Ga0209955_100014112 | 3300026123 | Water | MRGGVSISEIHEMPVTHIKHLNSIIENNFEMSKKAGTPII |
Ga0247580_10986461 | 3300026423 | Seawater | VSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0247591_11047481 | 3300026434 | Seawater | SISELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0228644_10082531 | 3300026453 | Seawater | MRGGVSISELHEMPANHIEYLNEIVQDNFELSKNAGTPIL |
Ga0247598_10354323 | 3300026466 | Seawater | LTWYMRGGVSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0247603_10141462 | 3300026468 | Seawater | MRGGVSISQLHEMPVGHIKHLNEIIDQNFEMSKKAGTPIL |
Ga0247571_11433081 | 3300026495 | Seawater | WYMRGGVSISELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0247592_10678311 | 3300026500 | Seawater | MRGGVSISELHDMPVSHIKHLNEIVTENYDASKKSGM |
Ga0247605_11645271 | 3300026503 | Seawater | KLHKNMLKLTWYMRGGVSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0247590_11567421 | 3300026513 | Seawater | SISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0209384_10735521 | 3300027522 | Marine | MRGGVSISEIHQMPADHIKYLNEIVNDNFEMSKQAGTP |
Ga0209482_10025019 | 3300027668 | Marine | LHKTLLKITWYMRGGVSISELHEMPVGHIEHLNAIIGENFEMSKKAGMAIL |
Ga0209482_10111591 | 3300027668 | Marine | MRGGVSISEIHNMPVGHLKYINDIVGENFELSKKAGVPIL |
Ga0209482_10154841 | 3300027668 | Marine | MRGGVGISELHDMPASHLKFLNEVVQENFELSKNAGTPIL |
Ga0209482_10524101 | 3300027668 | Marine | MRGGVSITELHEMPANHIDHLNDIVNENFEMSKKAGMPIL |
Ga0209383_10311171 | 3300027672 | Marine | MRGGVSISELQEMPVGHIDHLNEIINENFELSKQA |
Ga0209816_10043469 | 3300027704 | Marine | MRGGVSISELQEMPVGHIDHLNEIINENFELSKQAGTPIL |
Ga0209816_10101571 | 3300027704 | Marine | MRGGVGISELHGMPANHLRYLNEIVSDNFELSKQAGTPIL |
Ga0209816_10173534 | 3300027704 | Marine | MRGGVSISELHDMPTGHISYLNEIVNDNFELSKKAGVPIL |
Ga0209433_101433732 | 3300027774 | Marine | RGGVSIRELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0209709_103729651 | 3300027779 | Marine | LKLTWYMRGGVSISELHEMPAGHIEHLNDIVTENFEMSKQAGVPIL |
Ga0209090_100011775 | 3300027813 | Marine | MRGGVSISELHDMPANHLKYLNEVVSENFELSKNAGTPIL |
Ga0209090_100199491 | 3300027813 | Marine | MRGGVSISELHEMPANHLDYLNDIVNENFEMSKKAGMPIL |
Ga0209035_101469752 | 3300027827 | Marine | MRGGVSISELHDMPVAHISYLNEIVTDNFELSKQAGVPIL |
Ga0247576_11005591 | 3300028099 | Seawater | VSISELHDMPVAHIDHINEIIKENYEMSKQAGTPIL |
Ga0247584_11495451 | 3300028110 | Seawater | GVSISELHDMPVSHIDHINEIIKENYEMSKQAGTPIL |
Ga0228648_10343791 | 3300028126 | Seawater | LHKSLYKLTWYMRGGVSISELHDMPAGHIQHLNEIVSENFELSKQAGTPIL |
Ga0256417_11601311 | 3300028233 | Seawater | GVSISELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0247583_11052291 | 3300028336 | Seawater | LQLSWYMRGGVSISELHEMPVGHIKHLNEIIDQNFEMSKKAGTPIL |
Ga0247567_11220371 | 3300028338 | Seawater | NLLQLSWYMRGGVSISELHDMPVTHIKHLNEIVEKNFEMSKKAGMPIL |
Ga0257113_12465511 | 3300028488 | Marine | LKLTWYMRGGVSISELHQMPVSHIDHLNDIITENFEMSKKAGMPII |
Ga0308022_10347002 | 3300031142 | Marine | MRGGVSISELHEMPVGHIEHLNAIIGENFEMSKKAGMAIL |
Ga0308022_10488781 | 3300031142 | Marine | LDSLNKNLYKLTWYMRGGVSISELHGMPADHIRYLNEIVTENFELSKQAGTPIL |
Ga0308007_100014958 | 3300031599 | Marine | MRGGVSISELHEMPVNHIDHLNEIVGENFEMSKKAGVPIL |
Ga0308007_100101273 | 3300031599 | Marine | MRGGVSISELHDMPASHIRYLNEIVSENFELSKNAGMPIL |
Ga0307993_11530962 | 3300031602 | Marine | WYMRGGVSISELHEMPVNHIDHLNEIVGENFEMSKKAGVPIL |
Ga0307993_11610261 | 3300031602 | Marine | TKRHEDLHKTLLKITWYMRGGVSISELHEMPVGHIEHLNAIIGENFEMSKKAGMAIL |
Ga0302119_102083121 | 3300031606 | Marine | MRGGVSISELHQMPVSHIDHLNDIVTENFEMSKKAGMPII |
Ga0308001_102436221 | 3300031644 | Marine | VSISEIHQMPADHIKYLNEIVNDNFEMSKQAGTPIL |
Ga0308012_100121111 | 3300031647 | Marine | MRGGVGISELHGMPANHLRYLNEIVSDNFELSKQAG |
Ga0308018_100631533 | 3300031655 | Marine | TWYMRGGVSISELHEMPVGHIEHLNAIIGENFEMSKKAGMAIL |
Ga0307984_10542212 | 3300031658 | Marine | MRGGVSISELHAMPVSHLKHINDIVSDNFEMSKKAGMPIL |
Ga0307984_11545352 | 3300031658 | Marine | MRGGVSISELHEMPANHIDYLNDVVKENFELSKKAGTPIL |
Ga0302122_101065851 | 3300031675 | Marine | MRGGVSISELHEMPAGHIEHLNDIVTENFEMSKQAGVPIL |
Ga0308006_101236392 | 3300031683 | Marine | MRGGVSISELHEMPVNHIDHLNEIVGENFEMSKKAGVPI |
Ga0308016_103431481 | 3300031695 | Marine | MRGGVSISELHGMPADHIRYLNEIVTENFELSKQAG |
Ga0315328_102910572 | 3300031757 | Seawater | VSVSEIHDMPANHIKYLNEIVSDNFELSKSAGVPIL |
Ga0315318_100323681 | 3300031886 | Seawater | MRGGVSISELHDMPVNHITYLNEIVSDNFELSKSAGVPIL |
Ga0315334_100406291 | 3300032360 | Seawater | MRGGISISEIHEMPSNHISFLNEIIQENFEMSKKAGTPIL |
⦗Top⦘ |