Metagenome / Metatranscriptome Family F027860

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F027860
Family Type	Metagenome / Metatranscriptome
Number of Sequences	193
Average Sequence Length	40 residues
Representative Sequence	MDRPPAPPKEDERQTRRDLRAALIFGVVAATIELAALLYFFR
Number of Associated Samples	130
Number of Associated Scaffolds	193

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	30.57 %
% of genes near scaffold ends (potentially truncated)	18.13 %
% of genes from short scaffolds (< 2000 bps)	79.79 %
Associated GOLD sequencing projects	117
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (86.010 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (10.881 % of family members)
Environment Ontology (ENVO)	Unclassified (41.451 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (48.705 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 193 Family Scaffolds
PF01627	Hpt	13.99
PF02687	FtsX	11.40
PF13540	RCC1_2	10.88
PF00072	Response_reg	2.59
PF05157	T2SSE_N	1.55
PF00069	Pkinase	1.55
PF00005	ABC_tran	1.04
PF00202	Aminotran_3	0.52
PF05193	Peptidase_M16_C	0.52
PF01165	Ribosomal_S21	0.52
PF01653	DNA_ligase_aden	0.52
PF00034	Cytochrom_C	0.52
PF03129	HGTP_anticodon	0.52
PF13472	Lipase_GDSL_2	0.52
PF10017	Methyltransf_33	0.52
PF12704	MacB_PCD	0.52

COG ID	Name	Functional Category	% Frequency in 193 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	6.22
COG0124	Histidyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.52
COG0272	NAD-dependent DNA ligase	Replication, recombination and repair [L]	0.52
COG0423	Glycyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	0.52
COG0441	Threonyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.52
COG0442	Prolyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.52
COG0828	Ribosomal protein S21	Translation, ribosomal structure and biogenesis [J]	0.52

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.01 %
Unclassified	root	N/A	13.99 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	86.01 %
Unclassified	root	N/A	13.99 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	86.01 %
Unclassified	root	N/A	13.99 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	70.98 %
Unclassified	root	N/A	13.99 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.55 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.52 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	70.98 %
Unclassified	root	N/A	13.99 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	1.04 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.52 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	21.76 %
Unclassified	root	N/A	13.99 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	2.07 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1.04 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.52 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	21.76 %
Unclassified	root	N/A	13.99 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2.07 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1.04 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	0.52 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	21.76 %
Unclassified	root	N/A	13.99 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2.07 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1.04 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.52 %

Name	Rank	Taxonomy	Distribution
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	20.21 %
Unclassified	root	N/A	13.99 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2.07 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1.04 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	0.52 %
Agromyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces	0.52 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	20.21 %
Unclassified	root	N/A	13.99 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2.07 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1.04 %
unclassified Agromyces	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → unclassified Agromyces	0.52 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.52 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	20.21 %
Unclassified	root	N/A	13.99 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2.07 %
Acidobacteria bacterium 37-65-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1.04 %
Agromyces sp. ISL-38	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → unclassified Agromyces → Agromyces sp. ISL-38	0.52 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.52 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000956\|JGI10216J12902_116661125	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	540	Open in IMG/M
3300001535\|A3PFW1_10279380	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	4689	Open in IMG/M
3300001661\|JGI12053J15887_10426251	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	636	Open in IMG/M
3300001661\|JGI12053J15887_10607849	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	520	Open in IMG/M
3300004114\|Ga0062593_100087320	All Organisms → cellular organisms → Bacteria	2141	Open in IMG/M
3300004156\|Ga0062589_100504999	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1020	Open in IMG/M
3300004463\|Ga0063356_102742437	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	758	Open in IMG/M
3300004463\|Ga0063356_103160219	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	710	Open in IMG/M
3300004643\|Ga0062591_100496532	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1046	Open in IMG/M
3300005093\|Ga0062594_100372028	All Organisms → cellular organisms → Bacteria	1136	Open in IMG/M
3300005327\|Ga0070658_10013093	All Organisms → cellular organisms → Bacteria	6655	Open in IMG/M
3300005327\|Ga0070658_10467288	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1088	Open in IMG/M
3300005328\|Ga0070676_10160083	All Organisms → cellular organisms → Bacteria	1448	Open in IMG/M
3300005329\|Ga0070683_100029528	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	4965	Open in IMG/M
3300005330\|Ga0070690_100011912	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	5105	Open in IMG/M
3300005331\|Ga0070670_100516966	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1063	Open in IMG/M
3300005334\|Ga0068869_100768849	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	826	Open in IMG/M
3300005339\|Ga0070660_100215106	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1561	Open in IMG/M
3300005347\|Ga0070668_100129586	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2023	Open in IMG/M
3300005347\|Ga0070668_100891118	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	795	Open in IMG/M
3300005353\|Ga0070669_100022344	All Organisms → cellular organisms → Bacteria	4522	Open in IMG/M
3300005355\|Ga0070671_100273623	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1435	Open in IMG/M
3300005437\|Ga0070710_10562151	Not Available	789	Open in IMG/M
3300005438\|Ga0070701_10160241	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1303	Open in IMG/M
3300005444\|Ga0070694_101928768	Not Available	504	Open in IMG/M
3300005457\|Ga0070662_100314715	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1275	Open in IMG/M
3300005543\|Ga0070672_100679639	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	900	Open in IMG/M
3300005543\|Ga0070672_101223701	All Organisms → cellular organisms → Bacteria	669	Open in IMG/M
3300005543\|Ga0070672_101321805	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	644	Open in IMG/M
3300005563\|Ga0068855_100044348	All Organisms → cellular organisms → Bacteria	5263	Open in IMG/M
3300005578\|Ga0068854_100753101	All Organisms → cellular organisms → Bacteria	845	Open in IMG/M
3300005587\|Ga0066654_10621338	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	599	Open in IMG/M
3300005616\|Ga0068852_100060437	All Organisms → cellular organisms → Bacteria	3289	Open in IMG/M
3300005616\|Ga0068852_100800034	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	957	Open in IMG/M
3300005616\|Ga0068852_100962438	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	872	Open in IMG/M
3300005617\|Ga0068859_102067553	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	629	Open in IMG/M
3300005618\|Ga0068864_101148067	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	774	Open in IMG/M
3300005718\|Ga0068866_10086856	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1694	Open in IMG/M
3300005718\|Ga0068866_10238045	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1107	Open in IMG/M
3300005844\|Ga0068862_100857098	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	891	Open in IMG/M
3300006046\|Ga0066652_100000792	All Organisms → cellular organisms → Bacteria	15657	Open in IMG/M
3300006358\|Ga0068871_100701160	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	927	Open in IMG/M
3300006606\|Ga0074062_12966700	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	560	Open in IMG/M
3300006894\|Ga0079215_10492285	Not Available	761	Open in IMG/M
3300006918\|Ga0079216_11048756	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	636	Open in IMG/M
3300006949\|Ga0075528_10079497	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	854	Open in IMG/M
3300006954\|Ga0079219_11687365	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	586	Open in IMG/M
3300007004\|Ga0079218_10139468	All Organisms → cellular organisms → Bacteria	1749	Open in IMG/M
3300009094\|Ga0111539_10538993	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1359	Open in IMG/M
3300009098\|Ga0105245_12107840	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	618	Open in IMG/M
3300009137\|Ga0066709_100330066	All Organisms → cellular organisms → Bacteria	2086	Open in IMG/M
3300009176\|Ga0105242_11034167	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	831	Open in IMG/M
3300009651\|Ga0105859_1064128	Not Available	949	Open in IMG/M
3300009789\|Ga0126307_10069831	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2764	Open in IMG/M
3300009789\|Ga0126307_10244455	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1442	Open in IMG/M
3300009840\|Ga0126313_10027031	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	3895	Open in IMG/M
3300009840\|Ga0126313_10097941	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2151	Open in IMG/M
3300009840\|Ga0126313_11133290	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	643	Open in IMG/M
3300010036\|Ga0126305_10370297	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	941	Open in IMG/M
3300010036\|Ga0126305_11015913	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	569	Open in IMG/M
3300010037\|Ga0126304_10739249	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	666	Open in IMG/M
3300010039\|Ga0126309_10359567	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	859	Open in IMG/M
3300010039\|Ga0126309_11256394	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	511	Open in IMG/M
3300010044\|Ga0126310_10123963	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1606	Open in IMG/M
3300010166\|Ga0126306_10155085	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1703	Open in IMG/M
3300010166\|Ga0126306_10285754	All Organisms → cellular organisms → Bacteria → Acidobacteria	1267	Open in IMG/M
3300012046\|Ga0136634_10044815	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1580	Open in IMG/M
3300012212\|Ga0150985_101287199	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	510	Open in IMG/M
3300012212\|Ga0150985_105756131	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	866	Open in IMG/M
3300012212\|Ga0150985_108274142	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	544	Open in IMG/M
3300012285\|Ga0137370_10846398	Not Available	567	Open in IMG/M
3300012469\|Ga0150984_109347917	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	779	Open in IMG/M
3300012469\|Ga0150984_121391987	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	758	Open in IMG/M
3300012530\|Ga0136635_10182941	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	707	Open in IMG/M
3300012682\|Ga0136611_10761705	Not Available	585	Open in IMG/M
3300012682\|Ga0136611_10831571	Not Available	554	Open in IMG/M
3300012911\|Ga0157301_10138264	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	762	Open in IMG/M
3300012913\|Ga0157298_10322693	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	557	Open in IMG/M
3300012961\|Ga0164302_11594884	Not Available	542	Open in IMG/M
3300012985\|Ga0164308_10589679	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	944	Open in IMG/M
3300012987\|Ga0164307_11096434	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	654	Open in IMG/M
3300012988\|Ga0164306_10475486	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	956	Open in IMG/M
3300012989\|Ga0164305_11567824	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	587	Open in IMG/M
3300013100\|Ga0157373_10042634	All Organisms → cellular organisms → Bacteria	3243	Open in IMG/M
3300013100\|Ga0157373_10062507	All Organisms → cellular organisms → Bacteria	2637	Open in IMG/M
3300013102\|Ga0157371_10257043	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1259	Open in IMG/M
3300013102\|Ga0157371_10728989	Not Available	743	Open in IMG/M
3300013102\|Ga0157371_10986727	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	642	Open in IMG/M
3300013102\|Ga0157371_11370352	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	549	Open in IMG/M
3300013104\|Ga0157370_11619359	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	582	Open in IMG/M
3300013105\|Ga0157369_10801679	Not Available	967	Open in IMG/M
3300013307\|Ga0157372_10210791	All Organisms → cellular organisms → Bacteria	2252	Open in IMG/M
3300013307\|Ga0157372_11212077	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	872	Open in IMG/M
3300013307\|Ga0157372_12655579	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	575	Open in IMG/M
3300014325\|Ga0163163_12077206	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	628	Open in IMG/M
3300015163\|Ga0167665_1022491	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1248	Open in IMG/M
3300015167\|Ga0167661_1063186	Not Available	687	Open in IMG/M
3300015192\|Ga0167646_1037463	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1163	Open in IMG/M
3300015196\|Ga0167627_1002422	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	10175	Open in IMG/M
3300015262\|Ga0182007_10075791	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1103	Open in IMG/M
3300015262\|Ga0182007_10375905	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	538	Open in IMG/M
3300015371\|Ga0132258_10261665	All Organisms → cellular organisms → Bacteria	4235	Open in IMG/M
3300015371\|Ga0132258_10642591	All Organisms → cellular organisms → Bacteria	2668	Open in IMG/M
3300015374\|Ga0132255_102491208	Not Available	790	Open in IMG/M
3300017695\|Ga0180121_10070305	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1244	Open in IMG/M
3300018433\|Ga0066667_10315569	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1224	Open in IMG/M
3300018476\|Ga0190274_10082259	All Organisms → cellular organisms → Bacteria	2483	Open in IMG/M
3300018476\|Ga0190274_10173960	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1855	Open in IMG/M
3300018476\|Ga0190274_11316019	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	810	Open in IMG/M
3300018476\|Ga0190274_13804789	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	511	Open in IMG/M
3300018920\|Ga0190273_11155455	Not Available	654	Open in IMG/M
3300019361\|Ga0173482_10115924	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	995	Open in IMG/M
3300019362\|Ga0173479_10265280	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300019877\|Ga0193722_1020390	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1712	Open in IMG/M
3300021363\|Ga0193699_10000587	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	15465	Open in IMG/M
3300021363\|Ga0193699_10132881	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1018	Open in IMG/M
3300022756\|Ga0222622_10622034	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	781	Open in IMG/M
3300022756\|Ga0222622_11081591	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	590	Open in IMG/M
3300025315\|Ga0207697_10021487	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2641	Open in IMG/M
3300025321\|Ga0207656_10072827	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1530	Open in IMG/M
3300025481\|Ga0208079_1055793	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	876	Open in IMG/M
3300025484\|Ga0208587_1000376	All Organisms → cellular organisms → Bacteria	24657	Open in IMG/M
3300025899\|Ga0207642_11029119	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → unclassified Agromyces → Agromyces sp. ISL-38	531	Open in IMG/M
3300025904\|Ga0207647_10645683	Not Available	581	Open in IMG/M
3300025907\|Ga0207645_10085536	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2025	Open in IMG/M
3300025907\|Ga0207645_10115167	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1743	Open in IMG/M
3300025907\|Ga0207645_10562692	Not Available	774	Open in IMG/M
3300025909\|Ga0207705_10012870	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	6040	Open in IMG/M
3300025909\|Ga0207705_10021942	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	4555	Open in IMG/M
3300025909\|Ga0207705_11172981	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	590	Open in IMG/M
3300025919\|Ga0207657_11261166	Not Available	560	Open in IMG/M
3300025920\|Ga0207649_11434508	Not Available	546	Open in IMG/M
3300025921\|Ga0207652_10549590	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1038	Open in IMG/M
3300025925\|Ga0207650_11208054	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	644	Open in IMG/M
3300025928\|Ga0207700_10834483	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	825	Open in IMG/M
3300025929\|Ga0207664_11015572	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	743	Open in IMG/M
3300025931\|Ga0207644_10341383	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1214	Open in IMG/M
3300025934\|Ga0207686_10065445	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2318	Open in IMG/M
3300025937\|Ga0207669_11304749	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	617	Open in IMG/M
3300025940\|Ga0207691_10016877	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	6928	Open in IMG/M
3300025940\|Ga0207691_10176617	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1868	Open in IMG/M
3300025944\|Ga0207661_10119003	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2246	Open in IMG/M
3300025945\|Ga0207679_10325305	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1333	Open in IMG/M
3300025945\|Ga0207679_10452004	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1139	Open in IMG/M
3300025945\|Ga0207679_11033719	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	753	Open in IMG/M
3300026035\|Ga0207703_10730431	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	943	Open in IMG/M
3300026067\|Ga0207678_11503123	Not Available	594	Open in IMG/M
3300026121\|Ga0207683_10127417	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2289	Open in IMG/M
3300026142\|Ga0207698_10233950	All Organisms → cellular organisms → Bacteria	1670	Open in IMG/M
3300026142\|Ga0207698_10435057	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1262	Open in IMG/M
3300026142\|Ga0207698_10529196	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1152	Open in IMG/M
3300026285\|Ga0209438_1037925	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1597	Open in IMG/M
3300026304\|Ga0209240_1001394	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	9495	Open in IMG/M
3300027546\|Ga0208984_1116258	Not Available	578	Open in IMG/M
3300027637\|Ga0209818_1201765	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	582	Open in IMG/M
3300027691\|Ga0209485_1028402	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1332	Open in IMG/M
3300027886\|Ga0209486_10529800	Not Available	737	Open in IMG/M
3300028778\|Ga0307288_10252212	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	692	Open in IMG/M
3300028792\|Ga0307504_10298717	Not Available	605	Open in IMG/M
3300030496\|Ga0268240_10029523	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1092	Open in IMG/M
3300031232\|Ga0302323_100370826	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 37-65-4	1505	Open in IMG/M
3300031548\|Ga0307408_100426615	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1145	Open in IMG/M
3300031901\|Ga0307406_11087678	Not Available	690	Open in IMG/M
3300031911\|Ga0307412_11493021	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	614	Open in IMG/M
3300031938\|Ga0308175_100004910	All Organisms → cellular organisms → Bacteria	9437	Open in IMG/M
3300031938\|Ga0308175_100103248	All Organisms → cellular organisms → Bacteria	2631	Open in IMG/M
3300031938\|Ga0308175_100113747	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2522	Open in IMG/M
3300031938\|Ga0308175_100269982	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1718	Open in IMG/M
3300031938\|Ga0308175_100419333	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1403	Open in IMG/M
3300031938\|Ga0308175_100452639	All Organisms → cellular organisms → Bacteria	1354	Open in IMG/M
3300031938\|Ga0308175_100530964	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1256	Open in IMG/M
3300031938\|Ga0308175_100620358	All Organisms → cellular organisms → Bacteria	1166	Open in IMG/M
3300031938\|Ga0308175_100711210	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1092	Open in IMG/M
3300031938\|Ga0308175_101603493	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	728	Open in IMG/M
3300031938\|Ga0308175_101812114	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	684	Open in IMG/M
3300031938\|Ga0308175_102744142	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	551	Open in IMG/M
3300031938\|Ga0308175_102914945	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	533	Open in IMG/M
3300031939\|Ga0308174_10157629	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1695	Open in IMG/M
3300031939\|Ga0308174_11249897	Not Available	634	Open in IMG/M
3300031939\|Ga0308174_11552697	Not Available	568	Open in IMG/M
3300031996\|Ga0308176_10155005	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2103	Open in IMG/M
3300031996\|Ga0308176_10908165	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	925	Open in IMG/M
3300031996\|Ga0308176_11667538	Not Available	680	Open in IMG/M
3300031996\|Ga0308176_11880864	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	639	Open in IMG/M
3300032074\|Ga0308173_10113838	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	2129	Open in IMG/M
3300032126\|Ga0307415_100921132	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	807	Open in IMG/M
3300033412\|Ga0310810_10023080	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	7537	Open in IMG/M
3300034384\|Ga0372946_0002081	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	9032	Open in IMG/M
3300034384\|Ga0372946_0076356	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1546	Open in IMG/M
3300034384\|Ga0372946_0198728	Not Available	966	Open in IMG/M
3300034384\|Ga0372946_0324979	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	746	Open in IMG/M
3300034384\|Ga0372946_0533725	Not Available	569	Open in IMG/M
3300034384\|Ga0372946_0574650	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	546	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	56.99%
Host-Associated	Host-Associated	43.01%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	53.37%
Plants	Host-Associated → Plants	43.01%
Aquatic	Environmental → Aquatic	3.63%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere	27.46%
Rhizoplane	Host-Associated → Plants → Rhizoplane	14.51%
Freshwater	Environmental → Aquatic → Freshwater	2.59%
Sediment	Environmental → Aquatic → Sediment	1.04%
Roots	Host-Associated → Plants → Roots	1.04%
Peat	Environmental → Terrestrial → Peat	0.52%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.11%
Soil	Host-Associated → Plants → Rhizosphere → Soil	16.58%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.88%
Loam	Environmental → Terrestrial → Soil → Loam	6.22%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.11%
Ice	Environmental → Aquatic → Freshwater → Ice	2.59%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.04%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.04%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.52%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.52%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.52%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	16.58%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	10.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.88%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.70%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.66%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.63%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.11%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	2.59%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.07%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.04%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.04%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.52%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.52%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.52%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	10.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.36%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	6.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	6.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	5.70%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.18%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	5.18%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.11%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	2.59%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	2.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.07%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.07%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.07%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.07%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.55%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.55%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.55%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.55%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.55%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.04%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.04%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.04%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.04%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.52%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.52%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.52%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.52%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.52%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.52%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.52%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001535	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300006949	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009651	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063	Environmental	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300012046	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012530	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)	Environmental	Open in IMG/M
3300012682	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06)	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012913	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015163	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout)	Environmental	Open in IMG/M
3300015167	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)	Environmental	Open in IMG/M
3300015192	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)	Environmental	Open in IMG/M
3300015196	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface)	Environmental	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017695	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300019877	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025481	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025484	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300027546	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300030496	Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034384	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10216J12902_1166611252	3300000956	Soil	KEDERQTRRDLRAALIFGIVAATIELGVILYFMR*
A3PFW1_102793802	3300001535	Permafrost	MKEDTTQTRRDIRAAVIFGAVAAAIELAVLIYFFR*
JGI12053J15887_104262512	3300001661	Forest Soil	MTENHDHTRRDLRAALIFGLVAAALELGALLYFFR*
JGI12053J15887_106078492	3300001661	Forest Soil	MKEGPERMRRDLRAALIFGIVAAALELGALLYFFR*
Ga0062593_1000873204	3300004114	Soil	MLAFGMVDAPEPVREDERQTRRDLRAALVFGIVAATIELGAILYFFR*
Ga0062589_1005049993	3300004156	Soil	MDRAPDPSKEDQQQTRGDLRAALVFGIVAAAIELGAILYFFR*
Ga0063356_1027424372	3300004463	Arabidopsis Thaliana Rhizosphere	MDRAPGPVKEDERQTRRDLRAALIFGIVAATIEIGVLLYFMW*
Ga0063356_1031602192	3300004463	Arabidopsis Thaliana Rhizosphere	MDRVPSPLKEDERRTRRDIRAALVFGIVAATIELGIILYFMR*
Ga0062591_1004965322	3300004643	Soil	MDRAPGPPKEDERQTRRDLRMALIFGIVAATIELGVILYFFW*
Ga0062594_1003720282	3300005093	Soil	MDHAPSPLKEDERQTRRDVRAALVFGIVAATIELGVILYFMR*
Ga0070658_100130935	3300005327	Corn Rhizosphere	MDRPNAPPKEDQHRTRRDLRAALIFGVVAATIELGLLLYFFR*
Ga0070658_104672882	3300005327	Corn Rhizosphere	MDRAPDPLKEDEGQTRRDLRAALIFGIVAATIELGVILYFFW*
Ga0070676_101600832	3300005328	Miscanthus Rhizosphere	MDRPDAPPKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR*
Ga0070683_1000295282	3300005329	Corn Rhizosphere	MDRPDVPPKEDQRQTRRDLRAALIFGVVAATIELAALLYFFR*
Ga0070690_1000119123	3300005330	Switchgrass Rhizosphere	MDRAPDPLKEDERQTRRDLRAALIFGIVAAAIELGVILYFFW*
Ga0070670_1005169662	3300005331	Switchgrass Rhizosphere	MGAPPPLKEDHQRTRRDIRAAIIFGIVAATLELGALIYFMR*
Ga0068869_1007688492	3300005334	Miscanthus Rhizosphere	MDRAPDPLKEDERQTRRDLRAALIFGIVAATIELGVILYFFW*
Ga0070660_1002151062	3300005339	Corn Rhizosphere	MDRPNVPLKEDQQRTRRDIRAAVIFGVVAATIELGVLLYFFR*
Ga0070668_1001295863	3300005347	Switchgrass Rhizosphere	RTRKLLALGMDRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR*
Ga0070668_1008911181	3300005347	Switchgrass Rhizosphere	RPNVKSLAFGMDRPPAPPKEDERQTRRDLRAAVIFGVVAATIELAAVLYFFR*
Ga0070669_1000223443	3300005353	Switchgrass Rhizosphere	MDRPPAPPKEDERQTRRDLRAAVIFGVVAATIELAAVLYFFR*
Ga0070671_1002736232	3300005355	Switchgrass Rhizosphere	MDRAPGPLKEDERQTRRDLRAALIFGIMAATIELGVILYFFW*
Ga0070710_105621512	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MDRPNAPPKEDLQRTRRDIRAAVIFGVVAATIELGLLLYFFR*
Ga0070701_101602413	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MDRAPGPLKEDERQTRRDLRAALIFGIVAAAIELGVILYFFW*
Ga0070694_1019287681	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MDHAPSPLKEDERQTRRDVRAALVFGIVAATIELGIILYFMR*
Ga0070662_1003147152	3300005457	Corn Rhizosphere	MDRPNTPPKEDQRQTARDLRAAVIFGVVAATIELGVLLYIFR*
Ga0070672_1006796392	3300005543	Miscanthus Rhizosphere	MDRPDAPPKEDQHRTRRDLRAALIFGVVAAAIELALLLYFFR*
Ga0070672_1012237012	3300005543	Miscanthus Rhizosphere	MSEDHKRTARDLRAALIFGIIAATLELAVILYFMR*
Ga0070672_1013218052	3300005543	Miscanthus Rhizosphere	VKEDQRQTARDLRVAIIFGVVAASIELGLLVYFFR*
Ga0068855_1000443483	3300005563	Corn Rhizosphere	MKEDPERTRRDIRAALIFGIVAATLELGALIYFFR*
Ga0068854_1007531011	3300005578	Corn Rhizosphere	FGMDRPNAPPKEDQHRTRRDLRAALIFGVVAATIELGLLLYFFR*
Ga0066654_106213381	3300005587	Soil	MSPPRPPPQEDQRQTRRDLRTALIFGVVAATIEIAVLLYFFR*
Ga0068852_1000604372	3300005616	Corn Rhizosphere	MDRPPAPPEDQRQTRRNLPAALIFGVVAATLEMAALLYFFR*
Ga0068852_1008000341	3300005616	Corn Rhizosphere	KEDPERTRRDIRAALIFGIVAATLELGALIYFFR*
Ga0068852_1009624382	3300005616	Corn Rhizosphere	APDPPKEDERQTRRDLRAALVFGFVAATIELGVILYFFW*
Ga0068859_1020675531	3300005617	Switchgrass Rhizosphere	PNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR*
Ga0068864_1011480672	3300005618	Switchgrass Rhizosphere	VKEDQRQTARDLRVAIIFGIVAASIELGLLVYFFR*
Ga0068866_100868562	3300005718	Miscanthus Rhizosphere	MDRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR*
Ga0068866_102380452	3300005718	Miscanthus Rhizosphere	MDRAPGPPKEDERQTGRDLRTAIIFGIVAATIELGVILYFFW*
Ga0068862_1008570982	3300005844	Switchgrass Rhizosphere	KEDERQTRRDLRAALIFGIVAAAIELGVILYFFW*
Ga0066652_1000007926	3300006046	Soil	MERTPEPTKEDERQTRRDLRAVLVFGFVAATIELGLILYFFW*
Ga0068871_1007011601	3300006358	Miscanthus Rhizosphere	PPKEDERQTRRDLRTALIFGVVAATIELAALLYFFR*
Ga0074062_129667002	3300006606	Soil	MDRRSTPPQEDQRQTRRDLRRALIFGIVAATIEIAVLLYFFR*
Ga0079215_104922852	3300006894	Agricultural Soil	MDHAPGPLKEDERQTRRDLRAALVFGIVAATIELLALLYFFR*
Ga0079216_110487562	3300006918	Agricultural Soil	VEPLKEDHERTRRDIRAALVFGIVAATLEMAALFYFFR*
Ga0075528_100794972	3300006949	Arctic Peat Soil	VTEEDHRQTRRDLRVAIIFGIVAASLELGVLIYFFRA*
Ga0079219_116873652	3300006954	Agricultural Soil	MRLAFVMDRAPDPPKEDERQTRRDLRAALVFGIVAAAIELGVILYFFR*
Ga0079218_101394682	3300007004	Agricultural Soil	MDRAPSPAREDERQTRRDVRAALVFGIVAATIELGVILYFMR*
Ga0111539_105389932	3300009094	Populus Rhizosphere	MDRAPGPLKEDERQTRRDLRAALIFGIVAATIELGVILYFFW*
Ga0105245_121078401	3300009098	Miscanthus Rhizosphere	KEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR*
Ga0066709_1003300662	3300009137	Grasslands Soil	MSRPGTPPREDQRQTRRDLRAALIFGVVAATIEIGVLLYFFR*
Ga0105242_110341672	3300009176	Miscanthus Rhizosphere	MDRPPAPPKEDERQTRRDLRAALIFGVVAATIELAALLYFFR*
Ga0105859_10641281	3300009651	Permafrost Soil	MKQDHDRTRRDIRAALIFGVVAATIEMGILLYFFR*
Ga0126307_100698312	3300009789	Serpentine Soil	MDRSPTPVEDQRQTRRDLLAALVFGVVAATLELGALLYFFW*
Ga0126307_102444552	3300009789	Serpentine Soil	MDRPPTPVEEDQRQTRRDLRVALVFGIVAATLELGALLYFLW*
Ga0126313_100270313	3300009840	Serpentine Soil	MDRPPTPLEEDQRQTRRDLRAALVFGVVAATLELGALLYFFW*
Ga0126313_100979412	3300009840	Serpentine Soil	MDRAPGPLKEDERQTRRDLRAALVFGIVAATIELGVILYFFW*
Ga0126313_111332902	3300009840	Serpentine Soil	MDRAPAPLKEDERQTRRDLRAAIVFGIAAATIELGVILYFFW*
Ga0126305_103702972	3300010036	Serpentine Soil	MDRPPTPVEEDQRQTRRDLRAALVFGIVAATLELGALLYFLW*
Ga0126305_110159132	3300010036	Serpentine Soil	MDRAPSPVKEDERQTRRDLRAALVFGIVAATIELGAVLYFMR*
Ga0126304_107392492	3300010037	Serpentine Soil	MDRAPGPPKEDQQQTRRDLKVALVFGIVAAAIELGVILYFVW*
Ga0126309_103595672	3300010039	Serpentine Soil	MAGPPAPLKEDERQTRRDVRAAVVFGIVAATIELAALVYFFW*
Ga0126309_112563942	3300010039	Serpentine Soil	VEEDQRQTRRDLRAALIFGVVAAALELGALLYFFG*
Ga0126310_101239632	3300010044	Serpentine Soil	MDRPPAPLEEDQRQTRRDLRAALVFGVVAATLELGALLYFFW*
Ga0126306_101550851	3300010166	Serpentine Soil	MDHLPGPVQEDERQTRRDLRAALIFGVVAAAIELGALLYFFR*
Ga0126306_102857543	3300010166	Serpentine Soil	MLAYDMDGSPTPLKEDERQTRRDLRAAIIFGVVAAAIELGAFLYFFW*
Ga0136634_100448152	3300012046	Polar Desert Sand	MDRPPAPVKEDHARTRRDIRAASAFGVVAATLELGALLYFLR*
Ga0150985_1012871991	3300012212	Avena Fatua Rhizosphere	STPPKEDQRQTRRDIRAAVIFGVVAATIELAVLLYFFR*
Ga0150985_1057561312	3300012212	Avena Fatua Rhizosphere	MEWLGFGMDRPDAPPKEDQRQTRRDLRAAVIFGVVAATIELAALLYFFR*
Ga0150985_1082741421	3300012212	Avena Fatua Rhizosphere	MDRAPDPVKEDERQTRRDLRAVLVFGFVAATIELGFILYFFW*
Ga0137370_108463982	3300012285	Vadose Zone Soil	VKEDERQTARDLRAAIIFGIVAASIELGVLLYFFR*
Ga0150984_1093479171	3300012469	Avena Fatua Rhizosphere	LKWLAFGMDRPPAPPKEDERQTRRDLRAALIFGVVAATIELAALLYFFR*
Ga0150984_1213919871	3300012469	Avena Fatua Rhizosphere	PSTPPKEDQRQTRRDIRAAVIFGVVAATIELAVLLYFFR*
Ga0136635_101829412	3300012530	Polar Desert Sand	MSPEPARREDATQTKRDLRAALIFGVVAATLELAALIYFFG*
Ga0136611_107617051	3300012682	Polar Desert Sand	MTHDEQQQARRDIRAAVIFGVVAATLELGALLWFFT*
Ga0136611_108315711	3300012682	Polar Desert Sand	MTHDEQQQTRRDIRAAVIFGVVAATLELGALLWFFT*
Ga0157301_101382643	3300012911	Soil	MDRAPSPPKEDERQTRRDLRAALIFGIVAATIELGVILYFFW*
Ga0157298_103226931	3300012913	Soil	KLVAFSMDRAPGPPKEDERQTRRDLRMALIFGIVAATIELGVILYFFW*
Ga0164302_115948841	3300012961	Soil	MDRPSTPPKEDQHQTRRDLRAALIFGVVAATIELALLLYFFR*
Ga0164308_105896791	3300012985	Soil	MNRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR*
Ga0164307_110964342	3300012987	Soil	LLALGMDRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR*
Ga0164306_104754861	3300012988	Soil	MDRPNAPPKEDQQRTRRDIRAAVIFGVVAATIELGLLLYFFR*
Ga0164305_115678241	3300012989	Soil	DAPPKEDQHRTRRDLRAALIFGMVAATIELALLLYFFR*
Ga0157373_100426344	3300013100	Corn Rhizosphere	MKEDPERTRRDIRAALIFGIVAATMELGALIWFFR*
Ga0157373_100625071	3300013100	Corn Rhizosphere	VKEDPERTRRDIRAAFIFGIVAATLELGALIWFFR*
Ga0157371_102570433	3300013102	Corn Rhizosphere	MKEDPERTRRDIRAAFIFGIIAATLELGALIYFFR*
Ga0157371_107289891	3300013102	Corn Rhizosphere	VKEDPERTRRDIRAAFIFGIVAAALELGARIWFFR*
Ga0157371_109867271	3300013102	Corn Rhizosphere	MKEDPERTRRDIRAALIFGIVAATLEHGALSYFFR*
Ga0157371_113703521	3300013102	Corn Rhizosphere	MKEDPERTKRDLRAALIFGIVAATLELGALIYFFR*
Ga0157370_116193592	3300013104	Corn Rhizosphere	MDAPPPPIKEDQQRTRRDIRAAIIFGVVAATLELGALLYFMR*
Ga0157369_108016792	3300013105	Corn Rhizosphere	MDRPTTPPKEDQRQTRRDIRAALIFGVVAATIELGLLLYFFR*
Ga0157372_102107915	3300013307	Corn Rhizosphere	MKEDPERTRKDLRAALIFGIVAATVELAVLIWFFR*
Ga0157372_112120772	3300013307	Corn Rhizosphere	MKEDPERTRRDIRTAFIFGIIAATLELGALIYFFR*
Ga0157372_126555791	3300013307	Corn Rhizosphere	WLGLGMDRPDAPPKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR*
Ga0163163_120772061	3300014325	Switchgrass Rhizosphere	ESLAFSMDRAPDPLKEDERQTRRDLRAALIFGIVAATIELGLILYFFW*
Ga0167665_10224912	3300015163	Glacier Forefield Soil	VTQEDHRQTRRDIRAAIIFGIVAASLELGALLYFFR*
Ga0167661_10631861	3300015167	Glacier Forefield Soil	MKQDYDRTRRDIRAALIFGVVAATIEMGILLYFFR*
Ga0167646_10374631	3300015192	Glacier Forefield Soil	MSNERPPREDPRQTRRDIRAALVFGVVAATLELAAL
Ga0167627_10024225	3300015196	Glacier Forefield Soil	VTQEDHRRTRRDVRAAIIFGIVAASLELGALLYFFR*
Ga0182007_100757911	3300015262	Rhizosphere	MDRAPESPREDQQQTRRDLRAALVFGIVAATIELGAILYFFR*
Ga0182007_103759052	3300015262	Rhizosphere	MDRAPDLPKEDERQTRRDLRAALAFGIIAATIELGVILYFFR*
Ga0132258_102616652	3300015371	Arabidopsis Rhizosphere	MDRPDAPPKEDQRRTRRDLRAALIFGLVAATIELGVLLYFFR*
Ga0132258_106425912	3300015371	Arabidopsis Rhizosphere	MDRPPAPPKEDERQTRRDLRAALIFGVVAATIEIAALLYFFR*
Ga0132255_1024912081	3300015374	Arabidopsis Rhizosphere	MDRPNTPPKEDQQQPRRDLRAALIFGVVAATIELALLLYFFR*
Ga0180121_100703053	3300017695	Polar Desert Sand	MSPEPARREDATQTKRDLRAALIFGVVAATLELAALIYFFG
Ga0066667_103155692	3300018433	Grasslands Soil	MSRPGTPPREDQRQTRRDLRAALIFGVVAATIEIGVLLYFFR
Ga0190274_100822593	3300018476	Soil	MDRAPSPLKEDERQTRRDLRAALVFGIVAATIELGAILYFMR
Ga0190274_101739602	3300018476	Soil	MDAPPPLKEDHQRTKRDIRAAIIFGIVAATLELAALLYFMR
Ga0190274_113160191	3300018476	Soil	MSEDEPTPPREDPRRTARDIRAVLAFGIIAATVEMGLLLYFFR
Ga0190274_138047891	3300018476	Soil	APSPLREDERQTRRDVRAALVFGIVAATIELGVILYFMR
Ga0190273_111554552	3300018920	Soil	MDRPPAPLKEDQGQTRRDIRAALIFGVVAATLELAALAYFFF
Ga0173482_101159243	3300019361	Soil	MDRAPGPPKEDERQTRRDLRMALIFGIVAATIELGVILYFFW
Ga0173479_102652802	3300019362	Soil	MDHAPSPLKEDERQTRRDVRAALVFGIVAATIELGVILYFMR
Ga0193722_10203902	3300019877	Soil	MTENPDRTRRDLRAVLIFGVVAAALELGALLYFFR
Ga0193699_100005871	3300021363	Soil	MSQDPTPPPEDPKRATRDIRAALIFGVIAATLELAALLYFFR
Ga0193699_101328812	3300021363	Soil	MSQEPAPREDQRQTRRDIRAALIFGVVAATIELAALIYFFR
Ga0222622_106220342	3300022756	Groundwater Sediment	MDRPPAPPKEDERQTRRDLRAALIFGVVAATIELAALLYFFR
Ga0222622_110815912	3300022756	Groundwater Sediment	MKENPERTRRDLRAALIFGAVAAALELGALLYFFR
Ga0207697_100214872	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MDRAPDPLKEDERQTRRDLRAALIFGIVAAAIELGVILYFFW
Ga0207656_100728271	3300025321	Corn Rhizosphere	MDRPDVPPKEDQRQTRRDLRAALIFGVVAATIELAALLYFFR
Ga0208079_10557932	3300025481	Arctic Peat Soil	VTEEDHRQTRRDLRVAIIFGIVAASLELGVLIYFFRA
Ga0208587_10003769	3300025484	Arctic Peat Soil	VTEEDHRQTRRDLRVAIIFGIVAASLELGVLIYFFRD
Ga0207642_110291191	3300025899	Miscanthus Rhizosphere	PKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR
Ga0207647_106456831	3300025904	Corn Rhizosphere	MDRPNTPPKEDQRQTARDLRAAVIFGVVAATIELGVLLYIFR
Ga0207645_100855362	3300025907	Miscanthus Rhizosphere	MDRPPAPPKEDERQTRRDLRAAVIFGVVAATIELAAVLYFFR
Ga0207645_101151671	3300025907	Miscanthus Rhizosphere	MDRPDAPPKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR
Ga0207645_105626921	3300025907	Miscanthus Rhizosphere	AELLAYGMDHAPSPLKEDERQTRRDVRAALVFGIVAATIELGIILYFMR
Ga0207705_100128703	3300025909	Corn Rhizosphere	MKEDPERTRRDIRAALIFGIVAATLELGALIYFFR
Ga0207705_100219424	3300025909	Corn Rhizosphere	MDRPNAPPKEDQHRTRRDLRAALIFGVVAATIELGLLLYFFR
Ga0207705_111729811	3300025909	Corn Rhizosphere	VKEDPERTRRDIRAAFIFGIVAAALELGALIWFFR
Ga0207657_112611661	3300025919	Corn Rhizosphere	MDRPNVPLKEDQQRTRRDIRAAVIFGVVAATIELGVLLYFFR
Ga0207649_114345082	3300025920	Corn Rhizosphere	MDRPNVPLKEDQQRTRRDIRSAVIFGVVAATIELGVLLYFFR
Ga0207652_105495902	3300025921	Corn Rhizosphere	VKEDPERTRRDIRAAFIFGIVAATLELGALIWFFR
Ga0207650_112080541	3300025925	Switchgrass Rhizosphere	VKEDQRQTARDLRVAIIFGIVAASIELGLLVYFFR
Ga0207700_108344832	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MKEDPERTRRDLRAAIIFGIVAATLELGALIYFFR
Ga0207664_110155722	3300025929	Agricultural Soil	MKEDPERTKRDLRAAIIFGIVAATLELGALIYFFR
Ga0207644_103413833	3300025931	Switchgrass Rhizosphere	MDRAPGPLKEDERQTRRDLRAALIFGIMAATIELGVILYFFW
Ga0207686_100654453	3300025934	Miscanthus Rhizosphere	MDRPNTPPKEDQRQTTRDLRAAVIFGVVAATIELGVLLYIFR
Ga0207669_113047492	3300025937	Miscanthus Rhizosphere	MDRAPGPPKEDERQTGRDLRTAIIFGIVAATIELGVILYFFW
Ga0207691_100168772	3300025940	Miscanthus Rhizosphere	VKEDQRQTARDLRVAIIFGVVAASIELGLLVYFFR
Ga0207691_101766172	3300025940	Miscanthus Rhizosphere	MDRPDAPPKEDQHRTRRDLRAALIFGVVAAAIELALLLYFFR
Ga0207661_101190033	3300025944	Corn Rhizosphere	MDRAPGPLEEDQAQTRRDLRAAIIFGIVAAAIELGVVLYFF
Ga0207679_103253052	3300025945	Corn Rhizosphere	PLEEDQAQTRRDLRAAIIFGIVAAAIELGVVLYFFW
Ga0207679_104520041	3300025945	Corn Rhizosphere	MDRAPDPSKEDQQQTRGDLRAALVFGIVAAAIELGAILYFFR
Ga0207679_110337192	3300025945	Corn Rhizosphere	ARGILKEDQRQTARDLRVAIIFGIVAASIELGVLVYFFR
Ga0207703_107304312	3300026035	Switchgrass Rhizosphere	APDPLKEDERQTRRDLRAALIFGIVAAAIELGVILYFFW
Ga0207678_115031232	3300026067	Corn Rhizosphere	MDRPNAPPKEDQHRTRRDLRAALIFGVVAATIELGVLLYIFR
Ga0207683_101274172	3300026121	Miscanthus Rhizosphere	MDRAPGPLQEDQAQTRRDLRAAIIFGIVAAAIELGAILYFFW
Ga0207698_102339502	3300026142	Corn Rhizosphere	MDRPPAPPEDQRQTRRNLPAALIFGVVAATLEMAALLYFFR
Ga0207698_104350572	3300026142	Corn Rhizosphere	MDRPNTPPKEDQRQTARDLRAAVIFGVVAATIELGVLLYFFR
Ga0207698_105291962	3300026142	Corn Rhizosphere	PKEDQRQTRRDLRAALIFGVVAATIELAALLYFFR
Ga0209438_10379251	3300026285	Grasslands Soil	MSQDPTPPPEDQKRAARDIRTALIFGVVAATLELAALLYFFR
Ga0209240_10013949	3300026304	Grasslands Soil	VSEDQKQTARDIRVAIVFGIVAATIELGVLLYFFR
Ga0208984_11162582	3300027546	Forest Soil	MKENREQTRRDLRAALIFGLVAAALELGALLYFFR
Ga0209818_12017651	3300027637	Agricultural Soil	AYDMDHAPGPLKEDERQTRRDLRAALVFGIVAATIELLALLYFFR
Ga0209485_10284021	3300027691	Agricultural Soil	MDHAPGPLKEDERQTRRDLRAALVFGIVAATIELL
Ga0209486_105298002	3300027886	Agricultural Soil	MDRAPSPAREDERQTRRDVRAALVFGIVAATIELGVILYFMR
Ga0307288_102522121	3300028778	Soil	QPVEEDQRQTRRDLRAALIFGVAAAALELGALLYFFW
Ga0307504_102987171	3300028792	Soil	MHADTVKENHERTRKDIRLALIFGIVAATLEMGAVLYFMR
Ga0268240_100295232	3300030496	Soil	MDHAPDPPREDERQTRRDLRAALIFGIVAATIELGVILYFFW
Ga0302323_1003708262	3300031232	Fen	MKQDHDRTRRDIRAALIFGVVAATIEMGILLYFFR
Ga0307408_1004266152	3300031548	Rhizosphere	MDHAPGPLREDERQTRRDLRAALIFGVVAATIELGALLYFFR
Ga0307406_110876781	3300031901	Rhizosphere	MDHAPGPLREDERQTRRDLRAALIFGVVAATIELAALLYFFR
Ga0307412_114930212	3300031911	Rhizosphere	MDPGPHPPKEDQQQTRRDLRTALVFGIAMATIEFAALLYFL
Ga0308175_1000049105	3300031938	Soil	MDVPPPPVKEDHQRTRRDIRAAIVFGIVAATLELGALLYFFR
Ga0308175_1001032482	3300031938	Soil	MKEDPERTRRDIRTAFIFGIIAATLELGALLYFFR
Ga0308175_1001137472	3300031938	Soil	MDRPNTTPKEDQRQTRRDIRAAVIFGVVAATIELALLLYFFR
Ga0308175_1002699822	3300031938	Soil	MDRPDTPPKEDQRRTRRDIRAAFIFGVVAATIELAVLLYFFR
Ga0308175_1004193332	3300031938	Soil	MDQAPDSPREDQKQTRRDLRAALVFGIVAATIELGIILYFFR
Ga0308175_1004526392	3300031938	Soil	MDRAPDPPKEDQRQTRRDLRAAIVFGVVAATIELGVILYFFR
Ga0308175_1005309641	3300031938	Soil	MDRPDASPKEDQHRTRRDLRAALIFGVVAATIELALLLYFFR
Ga0308175_1006203582	3300031938	Soil	MDRAPGPPKEDQRQTRRDLRAALVFGVVAATIELGVILYFFR
Ga0308175_1007112101	3300031938	Soil	MDRAPGPLEEDQAQTRRDLRAAIIFGIVAAAIELGAILYFFW
Ga0308175_1016034933	3300031938	Soil	MKEDPDRTRRDIRTAFIFGIIAATLELGALLYFFR
Ga0308175_1018121142	3300031938	Soil	VKEDQEQTRRDIRAAIIFGVVAATLELGVILYFFR
Ga0308175_1027441422	3300031938	Soil	MDRAPDPPREDPQQTRRDLRAALVFGIVAATIELGAILYFFR
Ga0308175_1029149451	3300031938	Soil	FGMDGPDAPPKEDQRQTRRDIRAALIFGVVAATIELALLLYFFR
Ga0308174_101576292	3300031939	Soil	MDRAPGPPKEDQRQTRRDLRAALVFGFVAAAIELGVILYFFR
Ga0308174_112498972	3300031939	Soil	MDRPPPKEDQRQTRRNLRAALVFGIVAATLEMAALLYFSR
Ga0308174_115526971	3300031939	Soil	MDRPNAPLKEDHQRTRRDIRAAVIFGVVAATIELGFLLYFFR
Ga0308176_101550051	3300031996	Soil	MDQAPDSPGEDQKQTRRDLRAALVFGIVAATIELGAILYFFR
Ga0308176_109081652	3300031996	Soil	MDRSPAPPKEDQRQTRRDLRAALIFGIVAATLEFAALAYFFR
Ga0308176_116675381	3300031996	Soil	MDGPDAPPKEDQRQTRRDIRAALIFGVVAATIELALLLYFFR
Ga0308176_118808641	3300031996	Soil	MDRPPAPPKEDQRQTRRDLRAALIFGIVAATLELAALAYFFR
Ga0308173_101138382	3300032074	Soil	MDAPPPPIKEDQQRTRRDIRAAIIFGVVAATLELGALLYFMR
Ga0307415_1009211321	3300032126	Rhizosphere	MDPAPGPREDERQTRRDLRVALIFGVAAATIELGALLYFFR
Ga0310810_100230807	3300033412	Soil	MPSSSGDAEDRRTRRDLRAALIFGIVAASLELGALLYFFR
Ga0372946_0002081_6359_6484	3300034384	Soil	MNQEPAPREDPKQTKRDLRAALIFGVVAATLEIAALLYFFL
Ga0372946_0076356_28_135	3300034384	Soil	MEEDQHQTRRDLRRAIIFGIVAATLELGALLYFFR
Ga0372946_0198728_37_144	3300034384	Soil	MKEDPERTRRDLRAALIFGLVAAALELGALLYFLR
Ga0372946_0324979_548_658	3300034384	Soil	MTDDEQRQTKRDLRAALIFGVIAATLEMGALIWFFR
Ga0372946_0533725_147_254	3300034384	Soil	MKEDQDQTRRDIRAAIIFGVVAATIEMAVLLYFFL
Ga0372946_0574650_440_544	3300034384	Soil	MKEDPERTRRDLRAALIFGLVAAALELGALLYFFR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F027860

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences