NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027855

Metagenome / Metatranscriptome Family F027855

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027855
Family Type Metagenome / Metatranscriptome
Number of Sequences 193
Average Sequence Length 182 residues
Representative Sequence MEESDSESDSDSDEENVGIAADKVIEKHPIYNAWESVKDGAADGKYERVITPHFSSDSDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYMDTYFDRAWDNFDVNGDGAVEVIKAPQFMRFLASDQSMQIGESG
Number of Associated Samples 116
Number of Associated Scaffolds 193

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.12 %
% of genes near scaffold ends (potentially truncated) 87.05 %
% of genes from short scaffolds (< 2000 bps) 99.48 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.482 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(49.223 % of family members)
Environment Ontology (ENVO) Unclassified
(70.984 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.047 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.59%    β-sheet: 13.27%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.48 %
UnclassifiedrootN/A0.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006400|Ga0075503_1095326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium763Open in IMG/M
3300009263|Ga0103872_1013585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium891Open in IMG/M
3300009265|Ga0103873_1023704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1039Open in IMG/M
3300009265|Ga0103873_1029671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium967Open in IMG/M
3300009436|Ga0115008_10548229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium829Open in IMG/M
3300009436|Ga0115008_10982403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300009436|Ga0115008_11494732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300009476|Ga0115555_1257274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300009495|Ga0115571_1426664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300009496|Ga0115570_10256976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium769Open in IMG/M
3300009508|Ga0115567_10417571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium824Open in IMG/M
3300009592|Ga0115101_1168609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300009592|Ga0115101_1218117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium750Open in IMG/M
3300009599|Ga0115103_1687003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300009608|Ga0115100_10160681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium991Open in IMG/M
3300009608|Ga0115100_10457114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium835Open in IMG/M
3300009608|Ga0115100_10787448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300010985|Ga0138326_10494017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300010985|Ga0138326_10593254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300010985|Ga0138326_10840453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300010987|Ga0138324_10208441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300012504|Ga0129347_1119234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium983Open in IMG/M
3300012518|Ga0129349_1286008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium662Open in IMG/M
3300012518|Ga0129349_1368981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300012520|Ga0129344_1277634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300012523|Ga0129350_1249216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300012523|Ga0129350_1343992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300012523|Ga0129350_1367155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300012963|Ga0129340_1080673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300016766|Ga0182091_1526543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300017697|Ga0180120_10204639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium816Open in IMG/M
3300017748|Ga0181393_1092912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium783Open in IMG/M
3300017772|Ga0181430_1245071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300018649|Ga0192969_1023866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium994Open in IMG/M
3300018671|Ga0193571_1015958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300018684|Ga0192983_1036720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300018692|Ga0192944_1036252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300018739|Ga0192974_1067689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300018742|Ga0193138_1027326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300018742|Ga0193138_1028576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium730Open in IMG/M
3300018742|Ga0193138_1052655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018762|Ga0192963_1046410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300018763|Ga0192827_1049528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300018763|Ga0192827_1072170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300018765|Ga0193031_1018908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium992Open in IMG/M
3300018765|Ga0193031_1053158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300018765|Ga0193031_1068272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300018765|Ga0193031_1083151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300018766|Ga0193181_1051218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300018791|Ga0192950_1033896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300018791|Ga0192950_1034224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018812|Ga0192829_1074690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300018812|Ga0192829_1091835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300018830|Ga0193191_1051645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium676Open in IMG/M
3300018831|Ga0192949_1076309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300018831|Ga0192949_1082729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300018831|Ga0192949_1086076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300018832|Ga0194240_1012363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300018838|Ga0193302_1069425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300018846|Ga0193253_1093693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300018846|Ga0193253_1101676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium669Open in IMG/M
3300018846|Ga0193253_1115331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300018848|Ga0192970_1036874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium919Open in IMG/M
3300018848|Ga0192970_1065635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300018870|Ga0193533_1090635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300018874|Ga0192977_1091379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300018885|Ga0193311_10047012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300018899|Ga0193090_1080733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium752Open in IMG/M
3300018899|Ga0193090_1123860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300018926|Ga0192989_10120298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300018926|Ga0192989_10125985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300018926|Ga0192989_10133613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300018979|Ga0193540_10113526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300018980|Ga0192961_10057602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1130Open in IMG/M
3300018980|Ga0192961_10143864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium726Open in IMG/M
3300018981|Ga0192968_10098810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium779Open in IMG/M
3300018982|Ga0192947_10174040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300018989|Ga0193030_10116432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium839Open in IMG/M
3300018989|Ga0193030_10122480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium822Open in IMG/M
3300018989|Ga0193030_10152540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium748Open in IMG/M
3300018989|Ga0193030_10163204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300018989|Ga0193030_10176116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018989|Ga0193030_10196691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium663Open in IMG/M
3300018989|Ga0193030_10212778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300018989|Ga0193030_10282554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300019003|Ga0193033_10134810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300019021|Ga0192982_10115203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium913Open in IMG/M
3300019021|Ga0192982_10118384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium902Open in IMG/M
3300019022|Ga0192951_10082543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1014Open in IMG/M
3300019022|Ga0192951_10210592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium715Open in IMG/M
3300019022|Ga0192951_10214587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300019032|Ga0192869_10207280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium836Open in IMG/M
3300019032|Ga0192869_10259478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium753Open in IMG/M
3300019036|Ga0192945_10101087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium907Open in IMG/M
3300019045|Ga0193336_10318317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300019045|Ga0193336_10645718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300019048|Ga0192981_10250818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300019051|Ga0192826_10076504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1164Open in IMG/M
3300019051|Ga0192826_10194772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium749Open in IMG/M
3300019051|Ga0192826_10206145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium727Open in IMG/M
3300019051|Ga0192826_10213319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium713Open in IMG/M
3300019051|Ga0192826_10217489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300019051|Ga0192826_10231751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300019051|Ga0192826_10254453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300019051|Ga0192826_10278171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300019051|Ga0192826_10300992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300019051|Ga0192826_10373581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300019095|Ga0188866_1018749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium724Open in IMG/M
3300019095|Ga0188866_1029771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300019108|Ga0192972_1064827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300019111|Ga0193541_1055140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300019111|Ga0193541_1059085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300019116|Ga0193243_1029149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium751Open in IMG/M
3300019116|Ga0193243_1040997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300019117|Ga0193054_1072473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300019118|Ga0193157_1023196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300019118|Ga0193157_1035357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300019129|Ga0193436_1070988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300019149|Ga0188870_10077128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium812Open in IMG/M
3300019149|Ga0188870_10142587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300019150|Ga0194244_10029226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300019150|Ga0194244_10039382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium735Open in IMG/M
3300019150|Ga0194244_10048426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300019150|Ga0194244_10102339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300019153|Ga0192975_10188698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300021169|Ga0206687_1479867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium710Open in IMG/M
3300021334|Ga0206696_1441204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300021350|Ga0206692_1317416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium628Open in IMG/M
3300021353|Ga0206693_1266897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300021353|Ga0206693_1318130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300021872|Ga0063132_115917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium580Open in IMG/M
3300021872|Ga0063132_136629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium555Open in IMG/M
3300021892|Ga0063137_1128800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300021896|Ga0063136_1016646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300021896|Ga0063136_1052195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300021908|Ga0063135_1114554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300021908|Ga0063135_1122448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium760Open in IMG/M
3300021912|Ga0063133_1041086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300021934|Ga0063139_1043239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300023685|Ga0228686_1047727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300025830|Ga0209832_1223498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300025897|Ga0209425_10310817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium786Open in IMG/M
3300026423|Ga0247580_1094980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300026449|Ga0247593_1083927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300026461|Ga0247600_1070440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300026465|Ga0247588_1063794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300026466|Ga0247598_1147324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300026468|Ga0247603_1056906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium791Open in IMG/M
3300026468|Ga0247603_1096088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300026468|Ga0247603_1105256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300026470|Ga0247599_1068803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300026471|Ga0247602_1106586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300026495|Ga0247571_1110118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300026500|Ga0247592_1142552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium572Open in IMG/M
3300026500|Ga0247592_1146363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300026504|Ga0247587_1112159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300028109|Ga0247582_1138959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300028134|Ga0256411_1159826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium734Open in IMG/M
3300028137|Ga0256412_1149027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium863Open in IMG/M
3300028137|Ga0256412_1172187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300028137|Ga0256412_1227342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300028137|Ga0256412_1405395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300028233|Ga0256417_1133740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300028282|Ga0256413_1230578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300028290|Ga0247572_1113678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300028334|Ga0247597_1036979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300028334|Ga0247597_1044523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300030856|Ga0073990_11748950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300030856|Ga0073990_11770309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300030856|Ga0073990_11786478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium699Open in IMG/M
3300031004|Ga0073984_11238109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300031004|Ga0073984_11259445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium901Open in IMG/M
3300031004|Ga0073984_11283375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300031062|Ga0073989_13470258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300031062|Ga0073989_13557323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300031062|Ga0073989_13589372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium747Open in IMG/M
3300031542|Ga0308149_1033153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300031674|Ga0307393_1120128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300031717|Ga0307396_10365634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300031725|Ga0307381_10143334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium814Open in IMG/M
3300031734|Ga0307397_10613612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300031735|Ga0307394_10416753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300031739|Ga0307383_10412527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300031742|Ga0307395_10319891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300031742|Ga0307395_10351644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium639Open in IMG/M
3300032517|Ga0314688_10655979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300032617|Ga0314683_10885282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300032708|Ga0314669_10384845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium766Open in IMG/M
3300032730|Ga0314699_10489296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300032730|Ga0314699_10515771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300032745|Ga0314704_10617509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300032748|Ga0314713_10372630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine49.22%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.62%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater13.47%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.66%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.63%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.59%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.07%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.55%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.04%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.52%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.52%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018671Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026423Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075503_109532613300006400AqueousDEPVWKLSSVLGHRDDHATQLGYAGYSTEAANARPPYQSTVQVESESESSDSESDEETNVGIAAEKVVEKNPIYNAWESIKDGAADGKYERVITPNFSSDSDDIFMRSMITKYAFEKRTPIEELDDGSKIGGEPTGTFMMSKTGMQYAAKEVLGTHKGLSGPALAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQLGESG*
Ga0103872_101358513300009263Surface Ocean WaterMREEESSSDSDSSDDEANVQTQDCKFYPCVIEKHPKYNAWESIKDGAANDKYERMPIAHFSADSDDIFMRSMVKKYAFEKRTPIEQLEDGTKIGGEPTGSFWMGKKDMMYAAKEVLKDHKGLSGDKLQSYLDTYFDRAWENFDPNGDGEIEVIKSPQFMRFLASDQGMSLGENGEDAGEIKAFNDLRAKMAEK*
Ga0103873_102370423300009265Surface Ocean WaterMREEESSSDSDSSDDEANVQTQDCKFYPCVIEKHPKYNAWESIKDGAVNGKYERLPIGHFSSDTDDLFMRSMVKKYAFEKRTPIEELEDGSKIGGEPTGSFWLTKQDMQRAAKEVLTTHKGLSGNDLNSYLDTYFDRAWENFDPNGDGEVEVLKAPQFMRFLASDQGMSLGENGEDEGQIKAFNALRAKMAEK*
Ga0103873_102967123300009265Surface Ocean WaterMEESESDSDSSDDETNVQTQDCKHYPCVIEKKPKYNAWESVKDGAADNKYERLPIAHFSADSDDIFMRSMVKKYAFEKRTPIEELEDGTKIGGEPTGSFWLTKKDMSLAAKEVLATHKGLTGDKLASYMDTYFDRAWENFDPNGDGEIEVIKCPMFMRFLASDQGMSLGENGEDSGEIKAFNDLRKKMAEK*
Ga0115008_1054822913300009436MarineQSTLQEESESSDSDSDSSDEEANVGLDAFKKPSECTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPVSHFSADSDDIFMRSMVKKYAFEKRTPIELLEDGTKIGGEPTGSFWMSKTDLGYAAKEVLKDHKGLTGDKLSSYLDTYFDRAVENFDPNGDGAIEVIKAPMFMRFLASDQGMSLGENGEDAGEIASFNALRAKMADK*
Ga0115008_1098240313300009436MarineVQILESDSESDSEDEAMVDITANKKPSECTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPLAHFSADSDDIFMRSMLKKYAFEKRTPIELLEDGTKIGGEPTGSFWMSKTDMTYASKEVLKDHKGMSGEKLSSYLDTYFDRAWENFDPNGDGAVEVIKAPMFMRFL
Ga0115008_1149473213300009436MarineVLEKKPTYKAWDSVKDGAVDGKYERLPVSHFSADSDDIFMRSMVKKFAFEKRTPIELLEDGTKIGGEPTGSFWLGKTDAMYAAKEVLKTHKGLSGDKLSSYLDTYYDRAWENFDPNADGAIEVIKAPMFMRFLASDQGMSLGENGEDDGEIATFNALRAKQAAAAAAF*
Ga0115555_125727413300009476Pelagic MarineAADKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG*
Ga0115571_142666413300009495Pelagic MarineESSDSEDDHANLALDADKVIEKHPIYNAWESVKDGAADDKYERIITPNFSADSDDIFMRSMITKYAHEKRTSIEELDDGTKLGGEPTGVFMMGKKDMFRASKEVMGTHKGLSGDALSTYLDTYFDKAWENFDVNSDGAIEVIKAPQFMRFLASDQSLQLGESG*
Ga0115570_1025697613300009496Pelagic MarineDSESDDENNAQIAADKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG*
Ga0115567_1041757113300009508Pelagic MarineKDDHEVQLAYAGYSTEAANARPPYKSTIQLDSVTDKVIEKNPTYNAWASIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG*
Ga0115101_116860913300009592MarineMKITYTIACLLGLAAADEPVWKLSSVLGHRDDHEVQVGYGSYSTEAANARPPYKSTVQILSESDKVIEKHPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMIKKYAHEKRTQIEELDDGSKIGGEPTGVFMMGKKDMTYAAKEVLGTHKGLSGAALSDYLDTYFDKAWSNFDVNNDGAIEVIK
Ga0115101_121811723300009592MarinePVGKLDSVKEHVGEAQDYEAYGDHSIAKADKRPPYRSSAQIESESESSDSEDDHANIGLAADKVIEKHPIYNAWESIKDGAADGKYERVITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGSKIGGEPTGTFMMSKKDMFRAAKEVLGTHKGLSGPALAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLASDQGMQIGESG*
Ga0115103_168700313300009599MarineVQNAYGDYSTEAANGRPPYKSTVQLDSESESSDSESDDESNAQIAADKVIEKNPTYNAWESIKDGAADGKYERVITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG*
Ga0115100_1016068113300009608MarineMRKPEEPVWSLESVNNHKADAGIQKEYGAYSTDQANGRPPYQSAVQEDSESSDSDSEDDANVDISAHKKPSECTEFPCVLEKKPTYKAWESIKDGAADDKYERLPIAHFSADTDDIFMRSMVKKYAFEKRTPIEMLEDGSKIGGEPTGSFWMGKTDMMYAAKEVLKTHKGLTGEKLSSYLDTYFDKAWDNFDVNADGSVEVVKSPMFMRFLASD*
Ga0115100_1045711413300009608MarineLLGLAVADAETPVGKLDSVKEHVGEAQDYEAYGDHSIAKADKRPPYRSSAQIESESESSDSEDDHANIGLAADKVIEKHPIYNAWESIKDGAADGKYERVITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGSKIGGEPTGTFMMSKKDMFRAAKEVLGTHKGLSGPALAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLASDQGMQIGESG*
Ga0115100_1078744813300009608MarineNAQIAADKVIEKHPIYNAWESVKDGAADDKYERIITPNFSSDSDDIFMRSMIKNYAHEQRTAIEELDDGSKIGGEPTGVFMMGKKDMFRAAKEVMGTHKGLKGGALNDYLDTYFDKAWENFDVNGDGFIEVIKSP*
Ga0138326_1049401713300010985MarineIGYAGYSTEKANGRPPYQSAVQMEESESDSESDSDDDTHAQLEADKVIDKNPIYQAWDSVPDGALDGKYERVVTPHFSADSDDLFMRSMIKTYAHEKRTPIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVIGTHKGLKGDKAKAYLDTYFDKAWDNFDVNGGGAVEVIKAPMFMRFLCSDQGMQLGESG*
Ga0138326_1059325413300010985MarineSVEKANGRPPYQSAIQQKEESESSSSDSDSSDDEANVGIAADKVIEKNPKYNAWESVKDGAVDGKYERIPVPNFSADSDDIFMRSMLKKYAFEKRTPIEELDDGTKIGGEPTGSFWMGKKDMMYAAKEVLKTHKGLSGDKLSSYLDTYFDRAWENFDPNGEGEVEVIKSPMFMRFLASDQYMSLQ*
Ga0138326_1084045313300010985MarineFIQRLTPVRDVTVIQMEDSESDSEDEDESNVGVAADKVLEKDPIYNAWESVKDGAADGKYERVITPHFSADSDDIFMRSMIKNYAHGKRTSIAELDDGTKIGGEPTGAFMMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDKAWDNFDVNGSGAVEVIKAPQFMRFLASDQGMSLGESG*
Ga0138324_1020844123300010987MarineMEESESDSESDSDDDTHAQLEADKVIDKNPIYQAWDSVPDGALDGKYERVVTPHFSADSDDLFMRSMIKTYAHEKRTPIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVIGTHKGLKGDKAKAYLDTYFDKAWDNFDVNGGGAVEVIKAPMFMRFLCSDQGMQLGESG*
Ga0129347_111923413300012504AqueousMEESESDSDSSDDETNVQTQDCKHYPCVIEKKPKYNAWESIKDGAADNKYERLPIAHFSADSDDIFMRSMVKKYAFEKRTPIEELEDGTKIGGEPTGSFWLAKKDMSYAAKEVLATHKGLSGDKLASYMDTYFDRAWENFDPNGDGEIEVIKAPMFMRFLASDQGMSLGENGEDEGEIKAFNDLRKKMADK*
Ga0129349_128600813300012518AqueousMKFTFAIACLLGLTTATEEQSFVQRLARPIKDVTVIQMEDSESDSDSEDETHAQLAADKVIDEHPIYNAWESVKDGAADGKYERVITPHFSADSDDIFMRSMIKNYAHEKRTQIEELDDGTKIGGEPTGAFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGEVEVIKAPQFMRFLASDQGMSLGESG*
Ga0129349_136898113300012518AqueousPYKSTVQIESDSESSDSDSEDEHENVGINSDKVIDKNPIYNAWESVKDGAPDGKYERVVTPHFSADSDDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWLGKKDMFRAAKEVLGTHKGLKGGALDDYLDTYFDRAWSNFDVNGDGAVEVIKAPQFMRFIASDQGMSLGESA*
Ga0129344_127763413300012520AqueousESDEETNVGIAAEKVVEKNPIYNAWESIKDGAADGKYERVITPNFSSDSDDIFMRSMITKYAFEKRTPIEELDDGSKIGGEPTGTFMMSKTGMQYAAKEVLGTHKGLSGPALAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQLGESG*
Ga0129350_124921613300012523AqueousQKKAEESSSDSDSESSEEENIQTAYDKNPTDCEYFPCTLEKKPKYNAWESVKDGAEEGKYERVITARFNGDDDDIFMRSMIKKYAFEKRNPIKLLEDGTKVGGEPTGSFWMSKNDMFFAAKEVLATHKGLTGDKLKTYLDTYYDRAWENFDPMGDGSIEVIKSPQFMRFLASDQGMKLGENGEDDGDIKAHNAVRAKLAA*
Ga0129350_134399213300012523AqueousFTFAIACLLGLTAATEEQSFVQRLARPIKDVTVIQMEDSESDSDSEDETHAQLAADKVIDEHPIYNAWESVKDGAADGKYERVITPHFSADSDDIFMRSMIKNYAHEKRTQIEELDDGTKIGGEPTGAFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGEVEVIK
Ga0129350_136715513300012523AqueousMEESESESDSGSDSESDDETNVGVAADKVVEEHPIYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMIKNYAHEQRTQIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGAVEVIKAPQFMRFLASDQTMSLGESG*
Ga0129340_108067313300012963AqueousIKDGAANDKYERMPIAHFSADSDDIFMRSMVKKYAFEKRTPIEELEDGSKIGGEPTGSFWMGKKDMMYAAKEVLKDHKGLSGDKLQSYLDTYFDRAWENFDPNGDGEIEVIKSPQFMRFLASDQGMSLGENGEDAGEIKAFNDLRAKMAE*
Ga0182091_152654313300016766Salt MarshLGHRDDHETQLAYGEYSTTAANGRPPYQSTVQIDSESDSSDSDSEDEANVGIAADKVIEKNPTYNAWESIKDGAADGKYERIVTPNFSSDSDDIFMRSMITKYAHEKRTPIEELEDGSKIGGEPTGVFMMGKKDMQYAAKEVLGTHKGLSGPALMDYMDTYFDKAWGNFDVNGDGAIEVIKSPMFMRFLCSDQ
Ga0180120_1020463913300017697Freshwater To Marine Saline GradientSTAAANARPPYQSTAQVDSESESSDSESDDENNAQIAADKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGSKIGGEPTGVFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG
Ga0181393_109291223300017748SeawaterMKFTFAIACLLGLAAAEEESTLVQRLAPVRDVTVIQMEDSESDSDDEVNAQVDAEKVIEKHPKYNAWESVKDGAVDGKYERVITPNYSADSDDIFMRSMLKKYAFEKRTPIEELDDGSKIGGEPTGSFWMSKKDMSYAAKEVLGTHKGLSGEKLAAYMDTYFDKAWENFDVNGDGEIEVIKCPMFMRFLASDQGMQLGESG
Ga0181430_124507113300017772SeawaterVQNHRTDSTIQKAYGDHSTDKANARPPYQSTVQMEESESESDSESEDETHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDLFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVMGSHKGLSGDALSSYLDTYFDKAWENFDVN
Ga0192969_102386623300018649MarineVKNPTYNAWESVKDGAADGKYERKVTTNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0193571_101595813300018671MarineRPYKSTVQIESDSESSDSESDDDEQANAQINADKVIDKNPIYNAWESVKDGAPDGKYERVITPHFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWLAKKSMMRAAKEVLGTHKGLSGGALDDYLDTYFDRAWGNFDVNGDGALEVIKAPQFMRFLASDQGMSLGESA
Ga0192983_103672013300018684MarineDEEENVGINADKVLVKDPIYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMISKYAHEKRTSIEELDDGSKIGGEPTGSFWLAKKDMFRAGKEVLGTHKGLSGEALSSYMDTYFDRAWTNFDVNGSGAVEVLKAPQFMRFLASDQGMSLGESA
Ga0192944_103625213300018692MarineYMGKIKMKFTFAIACLLSLAAADMAAEKDLVPFKDITVVQMEESDSESSDDDSQNVAINSDKVLEKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQTMQLGESA
Ga0192974_106768913300018739MarineEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0193138_102732613300018742MarineMEESESESDSESDDETHVALAADKVIDKNPIYHAWDHVPNGAADGKYERTVTPYFAADSDDNFMRSMIQHYAYEKRTPIEELDDGSKVGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLDSYLDTYFDKAWENFDVNGGGSLEVIKSPMFMRFLASDGAMPLGE
Ga0193138_102857613300018742MarineSVLGHQTESGEEIGYAGYSTVMANGRPPYKSHVQLESDSESSDSESDDEEQANAQINSDKVIDKSPIYNAWESVKDGAPDGKYERVVTPHFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWLGKKDTFRAAKEVLGTHKGLSGEALSNYLDTYFDRAWSNFDVNGDGAIEVIKAPQFMRFIASDQGMSLGESA
Ga0193138_105265513300018742MarineEANVGINSDKVIEKSPIYNAWESVKDGAADGKYERVVTSHFAADSDDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWLGKKDMFRAAKEVMGTHKGLKGDALSTYLDTYFDRAWSNFDVNGDGAVEVLKAPQFMRFLASDQGMSLGESA
Ga0192963_104641013300018762MarineAIACLLSLAAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0192827_104952813300018763MarineLTSVLGHRDDSNTQMGYGDYSTTKANERPPYKSTVQIDESDSESDSGSESDDETTHVGLSADKVIEKDPIYNAWESVKDGAADGKYERVITPHFSADTDDIFMRSMITKYAHERRTSIEELDDGTKIGGEPTGSFWMGKKDMYRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGTGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0192827_107217013300018763MarineYPVRDITVLQMDDSSDSDDEMHVQTEKVIEKDPIYNAWESVKDGAADGKYERVITSHFSADTDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMYRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGTGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0193031_101890813300018765MarineMEESDSESDSDSDEENVGIAADKVIEKHPIYNAWESVKDGAADGKYERVITPHFSSDSDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYMDTYFDRAWDNFDVNGDGAVEVIKAPQFMRFLASDQSMQIGESG
Ga0193031_105315813300018765MarineATEEKSLMKPYPIIKSTFVQVEDSGSEDDEETNVQTEKVIEKHPKYNAWESVKDGAADGKYERVITPHYSSDSDDIFMRSMIKTYAFEKRTSIEELDDGTKIGGEPTGSFWMSKKDMFRASKEVLGTHKGLSGDKLSSYMDTYFDRAWENFDVNGSGEVEVIKSPQFMRFLCSDQTMQLGESG
Ga0193031_106827223300018765MarineMIDKNPIYNAWESVKDGAPDGHYERIITPIFSTDTDDLFMRSMITNYAHEQRTPIEELDDGERIGGEPTGSFWMGRSDMFRAAKEVLNAHKGLSGGELDDYLDTYFDRAWENFDVNGEGAIEVIKTPQFMRFLASDQEMSLG
Ga0193031_108315113300018765MarineVAINSDKVIDKSPIYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTPIEELEDGTKVGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYYDRAWSNFDVNGDGSVEVIKAPQFMRFLASDQGMSLGESA
Ga0193181_105121813300018766MarineFTFAIACLLGLAAADMRADSELVPFKDITVVQMEESDSESSDDDQMNVDINTDKVIDKNPIYNAWESVKDGAPDGKYERVVTSNFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWLGKKDMFRAAKEVLGTHKGIKGGALDDYLDTYFDRAWSNFDVNGDGAVEVLKAPQFIRFLASDQGMSLGESA
Ga0192950_103389613300018791MarineVQLESDSESSDSESDEENVGINSDKVLEKSPIYNAWESVKDGAADGKYERKVTSNFATDSDDIFMRSMISKYAHEKRTSIEELDDGSKIGGEPTGSFWLAKKDMFRAGKEVLGTHKGLSGEALSNYMDTYFDRAWSNFDVNGDGSVEVLKAPQFMRFLASDQGMSLGESA
Ga0192950_103422413300018791MarineMGKIKMKFTFAIACLLSLAAADMAAEKDLVPFKDITVVQMEESDSESSDDDSQNVAINSDKVLEKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQTMQLGESA
Ga0192829_107469013300018812MarineVQIESDSESSDSESDDEHENVAINSDKVIDKNPIYNAWESVKDGAADGKYERVVTSNFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWLGKKDMFRAAKEVMGTHKGLSGDALSTYLDTYFDRAWGNFDVNGDGAVEVIKAPQFMRFLASDQGMSLGESA
Ga0192829_109183513300018812MarineQANVGINTDKVVDKNPIYNAWESVKDGAADGKYERVITPHFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWLAKKDMFRASKEVMGTHKGLSGDALSSYLDTYFDRAWSNFDVNGDGAVEVIKAPQFMRFLASDQGMSLGESA
Ga0193191_105164513300018830MarineQMGYGDYSTTKANERPPYKSTVQIDESDSESDSGSESDDETTHVGLSADKVIEKDPIYNAWESVKDGAVDGKYERVITPHFSADTDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMYRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGTGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0192949_107630913300018831MarineTFAIACLLSLAAADMAAEKDLVPFKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQTMQLGESA
Ga0192949_108272913300018831MarineSESDSDSDDDSNVALGSDKVIDKHPIYNAWESIKDGGADGKYERKITSNFANDNDDIFMRSMITKYAHEQRTPIEELEDGSKIGGEPTGAFMMSKKDMFRASKEVMGTHKGLKGGDLDSYLDTYFERCWSNFDVNGDGALAVIKSPMFMRFLASDQGMSLGENA
Ga0192949_108607613300018831MarineSDSESSDSESDEEEQANVGINADKVIDKNPIYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTQIEELEDGTKIGGEPTGSFWLAKKDMFRAAKEVLGTHKGLSGGALSDYLDTYFDRAWGNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0194240_101236313300018832MarineMKFTLVIAALLGLTSATETVAIQERLFRARDVTVLQMEDSDSDSDDDTQVGLDADKVIEKNPTYNAWDSVKDGALDGKYERVITPHFSADSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWMSKVEMKRAAKEVLGTHKGLSGDKLSTYLDTYYDKAWDNFDVNGSGAVEVIKAPQFMRFLCSDQSMQLGESG
Ga0193302_106942513300018838MarineESSDSESDDEQENVGINSDKVIEKNPIYNAWESVKDGAADGKYERVVTSHFAADSDDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWLGKKDMFRAAKEVMGTHKGLKGDALSTYLDTYFDRAWSNFDVNGDGAVEVIKAPQFMRFLASDQGMSLGESA
Ga0193253_108611823300018846MarineLPKPTDSAGVQLESESDSSDSEDDHVNVGLFADKVIEKHPIYNAWESVKDGAADDKYERIITPNFSSDSDDIFMRSMIKTYAHEKRTAIEELDDGTKIGGEPTGVFMMGKKDMFRASKEVMGTHKGLKGGALDSYLDTYFEKAWENFDVNGDGSIEVIKSP
Ga0193253_109369313300018846MarineTQQGFGNYATDKANARPPYKSTVQMNDSESDSESSDDEAANVDISKKPSECTEFPCVLEKKPVYKAWDSVKDGAADGKYERLPVSHFSADSDDIFMRSMVSKYAYEKRTPIEMLEDGSKIGGEPTGSFWLSKTDMTYAAKEVLKTHKGLSGEKLSSYLDTYFDRAWENFDPNGDGSVEVIKAPMFMRFLASDQGMGLGESG
Ga0193253_110167613300018846MarineFTFAIACLLGLAAADMTANSNMVPFKDITVVQMEESDSESSDDDQTNVDINTNKVIDKSPIYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTPIEELEDGAKIGGEPTGTFMLGKKDMFRAAKEVMGTHKGLSGDALSTYLDTYFDRAWSNFDVNGDGSLEVLKAPQFMRFLASDQGMSLGESA
Ga0193253_111533113300018846MarinePVGKLDSVKEHVGEAQDYEAYGDHSIAKADKRPPYRSSAQIESESESSDSEDDHANIGLAADKVIEKHPTYNAWESIKDGAADGKYERVITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMSKKDMFRAAKEVLGTHKGLSGPALAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLASDQGMQ
Ga0192970_103687413300018848MarineVKNPTYNAWESVKDGAADGKYERKVTTNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALDDYLETYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0192970_106563513300018848MarineLLSLAAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALDDYLETYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0193533_109063513300018870MarineSTTMANERPPYKSHVQLESDSESSDSESDEEEQANVDINTDKVIEKSPIYNAWESVKDGAADGKYERVITSNFASDADDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLKGEALSSYLDTYFDRAWSNFDVNGDGAVEVLKSPQFMRFLASDQGLSLGESA
Ga0192977_109137913300018874MarineDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALDDYLETYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0193311_1004701213300018885MarineLAAAEERQIAPVEYIRHRDVTVLQMEDSESESDDETNVGINSDKVIEKSPIYNAWESVKDGAADGKYERKITPHFASDSDDIFMRSMIKNYAHEKRTPIEELEDGTKVGGEPTGSFWMGKKDMFRASKEVLGTHKGLSGDALSSYMDTYFDRAWSNFDVNGDGAVEVLKAPQFMRFLASDQGMSLGESA
Ga0193090_108073313300018899MarineVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0193090_112386013300018899MarineQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0192989_1012029813300018926MarineRPPYQSTLQEESESSDSESDSEDETNVALGKQPSDCTSFPCVLEKKPIYNAWESVKDGAQDGKYERLPVSHFSGDSDDIFMRSMVSKYAYEKRTSIEMLEDGTKIGGEPTGSFWMSKSGTRLAAKEVLGTHKGLSGDKLSGYLDTYFDKAWENFDVNGDGSIEVIKSPMFMRFLASDQAMSLGESA
Ga0192989_1012598513300018926MarineYKSTVQLESDSESSDSESDDEQENVGINSDKVIDKSPIYNAWESVKDGAPDGKYERVVTPHFASDSDDIFMRSMITKYAHEKRTPIEELEDGTKVGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYYDRAWTNFDVNGDGSIEVIKAPQFMRFLASDQGMSLGESA
Ga0192989_1013361313300018926MarineLLGLTAANQNAEFVARLGPVADETVVQILESDSDSDSNDEETNVDISADKKFEDCTEFPCVLEKKPVYKAWESVKDGGVDGKQYERQPLPYFSSDTDDLFMRSMVKKYAYEKRTPIEALEDGSTVGGEPTGSFWLGKKDMTYAAKEVLATHKGLKGQALSDYLDTYFDKAWDNFDVNGDGAIEVIKAPMFMRFLGSDQMMEL
Ga0193540_1011352613300018979MarineGEYSTTMANERPPYKSHVQLESDSESSDSESDEEEQANVDINTDKVIEKSPIYNAWESVKDGAADGKYERVITSNFASDADDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLKGEALSSYLDTYFDRAWSNFDVNGDGAVEVLKSPQFMRFLASDQGLSLGESA
Ga0192961_1005760213300018980MarineMANERPPMRSHVQLESDSESSDSESDEENVGINSDKVLEKNPIYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMISKYAHEKRTSIEELDDGSKIGGEPTGSFWLAKKDMFRAGKEVLGTHKGLSGEALSSYMDTYFDRAWSNFDVNGDGSVEVLKAPQFMRFLASDQGMSLGES
Ga0192961_1014386413300018980MarineTWGKIKMKFTFAIACLLSLAAADMAAEKDLVPFKDITVVQMEESDSESSDDDSQNVAINSDKVLEKNPTYNAWESVKDGAADGKYERKITSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQTMQLGESA
Ga0192968_1009881013300018981MarineMGKIKMKFTFAIACLLSLAAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0192947_1017404013300018982MarineTWGKIKMKFTFAIACLLSLAAADMAAEKDLVPFKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPMFMRFLASDQTMQLGESA
Ga0193030_1011643223300018989MarineMIDKNPIYNAWESVKDGAPDGHYERIITPIFSTDTDDLFMRSMITNYAHEQRTPIEELDDGERIGGEPTGSFWMGRSDMFRAAKEVLNAHKGLSGGELDDYLDTYFDRAWENFDVNGEGAIEVIKTPQFMRFLASDQEMSLGE
Ga0193030_1012248013300018989MarineWGIKLLLMKVSFAVAVLVGLVSAGTNEPVWGLPSVLGHETDSKADVGYATYSTTKANDRPPYQSAVQIDESESESDSESDDETHVGLGAYGVFHAWDSIPGGAADGKYERVITPNFSADSDDLFMRSMIGKYAEEKKTDVETLDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDALSSYLDTYFDKAWDNFDVNGAGEVEVVKSPMFMRFLASDGAMPLGE
Ga0193030_1015254013300018989MarineMGITNSKMKFTIAIACLLGLTSAFDESNLVQRLSPIKDVTVLQMEDSESESDEENVMTDASKVIEKNPIYNAWESVKDGAADGKYERVLTPHFSADSDDIFMRSMLTKYAHEQRTSREMLDDGAIIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGEGAVEVIKAPQFMRFLASDQSLSLGESG
Ga0193030_1016320413300018989MarineMGIIKIYKMKFTFAIACLLGLASATEEKSLMKPYPIIKSTFVQVEDSGSEDDDETNVQTEKVIEKHPKYNAWESVKDGAADGKYERVITPHYSSDSDDIFMRSMIKTYAFEKRTSIEELDDGTKIGGEPTGSFWMSKKDMFRASKEVLGTHKGLSGDKLSSYMDTYFDRAWENFDVNGSGEVEVIKSPQFMRFLCSDQTMQLGESG
Ga0193030_1017611613300018989MarineSESDSESSDEEANVGLDAFKKPSECTTFPCVLDKKPTYKAWDSVKDGAVDGKYERLPVSHFSADSDDIFMRSMVKKYAYEKRTPIELLEDGTKIGGEPTGSFWLGKTDTMYAAKEVLKTHKGLSGDKLGSYLDTYFDRAWENFDPNGDGSIEVIKAPMFMRFLASDQGMSLGENGEDDGEIASFNALRAKQAAGF
Ga0193030_1019669113300018989MarineKANGRPPYQSTVQIESDSESESDSDDDNNVQTAADKVIEKHPTYNAWESVKDGAVDGKYERVITPHFSADTDDIFMRSMITKYAHEQRTAIEELDDGTRIGGEPTGSFWMGKKDMTRAAKEVLATHKGLSGDKLSSYMDTYFDRAWDNFDVNGEGAIEVIKSPQFMRFLASDQGMELGES
Ga0193030_1021277813300018989MarineSDSESDSESDEDNNVQTQADKVIEKNPIYNAWESVKDGAADGKYERVITPNFSADTDDIFMRSMIKKYAHEQRVQREELDDGTIIGGEPTGSFWMSKKDMFRASKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGDGAVEVIKAPQFMRFLASDQSMELGESG
Ga0193030_1028255413300018989MarineAADKVIEKHPTYNAWDSVKDGALDGKYERVITPHFSADSDDIFMRSMITKYAHEQRTPIEELDDGTKIGGEPTGSFWMSKVEMKRASKEVLGTHKGLSGDKLSTYLDTYYDKAWDNFDVNGSGAVEVIKAPQFMRFLCSDQGMQLGESG
Ga0193033_1013481013300019003MarineLESVQNHRTDSTIQKAYGDHSTEKANSRPPYQSAVQLESDSESSDSESDEEEQANVDINTDKVIEKSPIYNAWESVKDGAADGKYERVITSNFASDADDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLKGEALSSYLDTYFDRAWSNFDVNGDGAVEVLKSPQFMRFLASDQGLSLGESA
Ga0192982_1011520323300019021MarineAESDADLSDSESDDDSNVALAADKVVEKNPIYNAWESVKDGAADGKYERVVTSHFASDADDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWLAKKDMFRAAKEVLGTHKGLAGAALSSYLDTYFDRAWSNFDVNADGAVEVLKAPQFMRFLASDQGMALGESG
Ga0192982_1011838413300019021MarineTWGKIKMKFTFAIACLLSLAAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0192951_1008254313300019022MarineMANERPPMRSHVQLESDSESSDSESDEENVGINSDKVLEKSPIYNAWESVKDGAADGKYERKVTSNFATDSDDIFMRSMISKYAHEKRTSIEELDDGSKIGGEPTGSFWLAKKDMFRAGKEVLGTHKGLSGEALSNYMDTYFDRAWSNFDVNGDGSVEVLKAPQFMRFLASDQGMSLGES
Ga0192951_1021059213300019022MarineTWGKIKMKFTFAIACLLSLAAADMAAEKDLVPFKDITVVQMEESDSESSDDDSQNVAINSDKVLEKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQTMQLGESA
Ga0192951_1021458713300019022MarineREDSTVQKNYGDYSTLAADGRPPYKSTLQLDAESNADLSDSESDDDSNVALAADKVVEKNPIYNAWESVKDGAADGKYERVVTSHFASDADDIFMRSMITKYAHEKRTAIEELEDGTKIGGEPTGSFWLAKKDMFRAAKEVLGTHKGLAGAALSSYLDTYFDRAWSNFDVNADGAVEVLKAPQFMRFLASDQGMALGESG
Ga0192869_1020728013300019032MarineMKYTAAIACLLASVAATKQDEDFVARLGPVADETVVQILESDSETDSEDEAMVDISADKKPSECTSFPCVLEKKPTYKAWDSVKDGAVDGKYERLPVAHFSADSDDIFMRSMVKKYAYEKRTPIELLEDGSKIGGEPTGAFLLSKTDMSYAAKEVLKDHKGLSGEKLSSYMDTYFDRAWENFDPNGDGSVEVIKAPMFMRFLASDQGMSLGENGEDAGEIATFNALRAKQAAAF
Ga0192869_1025947813300019032MarineLESVQNHRTDSTIQKAYGDHSTDKANGRPPYQSVAQIESDSESSDSDSESDEEHANVAIGTSKVIDKSPIYNAWESVKDGAPDGKYERVITFNFASDSDDSFMRSMIKSYAHEARTPLEELDDGEKIGGEPTGAFWMSKKDMARAAKEVLGTHKGLTGGAFDDYMDTYFDRAWDEFDVNGDGAIEVIKTPQFMRFLASDQTMGLGENN
Ga0192945_1010108723300019036MarineLNESDSESDSESDDETHVGLDADKVIDKSPIYHAWDSIPDGAANGKYERVVTANFAADSDDLFMRSMIKKYSYEKRTPIEELDDGSHIGGEPTGSFMMSKKDMFRAAKEVLGTHKGLSGDKLDTYLDTYFDKAWENFDVNGGGSVEVIKSPMFMRFLASDGAMPLGE
Ga0193336_1031831713300019045MarineQDSSLAKNLGPVRDVTVLQMDSESDSDDENVQTASEKVIEKDPIYNAWESVKDGAADGKYERVVTSHFSADTDDLFMRSMITKYAHEARTSIEELDDGTRIGGEPTGAFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGAVEVIKSPQFMRFLASDQSMSLGE
Ga0193336_1064571813300019045MarineAADKVLEEHPIYNAWESVKDGAADGKYERVITPHFSADSDDIFMRSMIKNYAHEKRTAIEELDDGTKIGGEPTGSFWLGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGKGAVEVIKAPQFMRFLASDQGMSLGESG
Ga0192981_1025081813300019048MarineNKHPIYNAWESIKDGGPDGKYERKITSNFANDNDDIFMRSMITKYAHEQRTPIEELEDGSKIGGEPTGAFMMAKKDMFRASKEVMGTHKGLKGADLDSYLDTYFERCWSNFDVNGDGVLAVIKSPMFMRFLASDQGMNLGESS
Ga0192826_1007650413300019051MarineMEESDSESDSESDDETNTMVAADKVIEKHPIYNAWESVKDGAADGKYERVLTPNFSADSDDIFMRSMLKKYAFEKRTPIEELDDGSKIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLAAYMDTYFDKAWENFDVNGDGAVEVIKAPMFMRFLCSDQTMQLGESGXAIKFQYLKKTNKLNQDEVKXITGMLDGLFGSSLQGNEYFNI
Ga0192826_1019477213300019051MarineMKFTFAIACLLGLAAAEDESTLVQRLAPVKDVTVIQMEESESDSEEDETNAMVEADKVIEKHPIYNAWESVKDGAADGKYERVITPNFSADSDDIFMRSMLKKYAFEKRTPIEELDDGSKIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLATYMDTYFDKAWENFDVNGDGAVEVIKAPMFMRFLCSDQGMQLGESG
Ga0192826_1020614513300019051MarineQVDSDSESDSDSDEENAQIAADKVIEKNPIYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDKAWSNFDVNGDGAVEVIKAPMFMRFLCSDQGMQLGESG
Ga0192826_1021331913300019051MarineDDSDTQIGYAGYSTEKANGRPPYKSTVQMEESDSESDSESDDETNAMVAADKVIEKNPIYNAWESVKDGAADGKYERVITPNFSADSDDIFMRSMLKKYAFEKRTPIEELDDGSKIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLATYMDTYFDKAWSNFDVNGDGAVEVIKAPMFMRFLCSDQGMQLGESG
Ga0192826_1021748923300019051MarineMQMEESDSESDSESDDETNAQAAADKVIEKNPIYNAWESVKDGAADGKYERVTTPFFSADSDDLFMRSMITKYAFEKRTPIEELDDGSKIGGEPTGSFWMSKKDMFRASKEVLGTHKGLSGDKLSAYLDTYFDKAWENFDVNGSGSVEVIKSPMFMRFLCSDQTMQLGES
Ga0192826_1023175113300019051MarineGLTSATETSSLQQRLFPVKDVTVLQMEDSESDSDDDMQVGLSAEKVIEKHPVYNAWESVKDGALDGKYERVITPHFSSDSDDIFMRSMIKTYAHEKRTPIEELDDGTKIGGEPTGSFWMDKGDMQRAAKEVLGTHKGLSGDKLKTYMDTYFDKAWENFDVNGDGAVEVIKAP
Ga0192826_1025445313300019051MarineEESESDSESDSDDEVHAQLEADKVIEKHPIYNAWESVKDGALDGKYERVITPHFSSDSDDIFMRSMIKTYAHEKRTPIEELDDGTKIGGEPTGSFWMDKGDMQRAAKEVLGTHKGLSGDKLKTYMDTYFDKAWENFDVNGDGAVEVIKAPQFMRFLCSDQTMQLGESG
Ga0192826_1027817113300019051MarineMEESDSESDSESDDETNAQVAADKVIEKNPIYNAWESVKDGAADGKYERVTTPFFSADSDDLFMRSMITKYAFEKRTPIEELDDGSKIGGEPTGSFWMSKKDMFRASKEVLGTHKGLSGDKLSAYLDTYFDKAWENFDVNGSGSVEVIKSPMFMRFLCSDQTMQLGES
Ga0192826_1030099213300019051MarineVHAQLEADKVIEKHPIYNAWESVKDGAADGKYERVITPNFSADSDDIFMRSMLKKYAFEKRTPIEELDDGSKIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLATYMDTYFDKAWENFDVNGDGAVEVIKAPMFMRFLCSDQGMQLGESG
Ga0192826_1037358113300019051MarineKANGRPPYQSTVQIESDSESDSESDDDNNVQTAADKVIEKHPIYNAWESVKDGAVDGKYERVITPHFSADTDDIFMRSMITKYAHEQRTAIEELDDGTRIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYMDTYFDRAWDNFDVNGDGAVEVIKAPQFMRFLAS
Ga0188866_101874913300019095Freshwater LakeKYTAVIALFLASSVVAKQDDDFVARLGPIADETVVQILESDSESDSEDEAMVDITANKKPSECTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPLAHFSADSDDIFMRSMLKKYAFEKRTPIELLEDGTKIGGEPTGSFWMSKTDMTYASKEVLKDHKGMSGEKLSSYLDTYFDRAWENFDPNGDGAVEVIKAPMFMRFLASDQGMSLGENGEDAGEVASFNALRAKQAAA
Ga0188866_102977113300019095Freshwater LakeSFVQVESDSESSDSEDDHANLALDAYKVIEKNPTYNAWESVKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTSIEELDDGTKLGGEPTGVFMMGKKDMFRASKEVMGTHKGLSGDALSSYLDTYFDKAWENFDVNSDGAIEVIKAPQFMRFLASDQSLQLGESG
Ga0192972_106482713300019108MarineAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0193541_105514013300019111MarineNGRPPYQSTAQIESDSESSDSDSESDDEHANVAIGASKIIDKAPIYNAWESVKDGAPDGKYERVITFNFVSDSDDSFMRSMITKYAHEARTPLEELDNGEVIGGEPTGAFWMGKKDMARAAKEVLGTHKGLSGGAFEDYMDTYFDRAWDNFDVNGDGAIEVIKTPQFMRFLASDQTMSLGENN
Ga0193541_105908513300019111MarineDSESSDSESDEEEQANVDINTDKVIEKSPIYNAWESVKDGAADGKYERVITSNFASDADDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLKGEALSSYLDTYFDRAWSNFDVNGDGAVEVLKSPQFMRFLASDQGLSLGESA
Ga0193243_102914913300019116MarineHGSTEQIGYGAYSTEKANGRPPYQSTVQIESDSESESDSDDDNNVQTAADKVIEKHPTYNAWESVKDGAVDGKYERVITPHFSADTDDIFMRSMITKYAHEQRTAIEELDDGTRIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYMDTYFDRAWDNFDVNGDGAVEVIKSPQFMRFLASDQGMELGESG
Ga0193243_104099713300019116MarineESESDDETNVQTEKVIEKHPTYNAWESVKDGAVDGKYERVITPHFSADTDDIFMRSMITKYAHEQRTAIEELDDGTRIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYMDTYFDRAWDNFDVNGDGAVEVIKSPQFMRFLASDQGMELGESG
Ga0193054_107247313300019117MarineDVTVIQIDESESDSEDDNTHVGLAAEKVIDEHPIYNAWESVKDGAADGKYERVVTPWFSADSDDLFMRSMIKKYAHEKRTQIEELDDGSKIGGEPTGVFMMSKADMTRAAKEVLATHKGLSGDALSSYMDTYFPRTWENFDVNGDGAIEVIKAPQFMRFLASDQEMSLGQ
Ga0193157_102319613300019118MarineARLSPIRDVTVLQMDDSESDSDDDTHAQLAADKMIDEHPTYNAWESVKDGAVDGKYERVITPHFSADSDDIFMRSMIKTYAHEKRTPIEELDDGTRIGGEPTGSFWMGKKDMQRAAKEVLGTHKGLKGDKLSSYMDTYFDRAWDNFDVNGGGAVEVIKAPQFMRFLASDQTMGLGESG
Ga0193157_103535713300019118MarineVPIKDVTVIQMEESESESDDDETNVGVAADKVIDEHPIFNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSTYMDTYFDRAWDNFDVNGSGAVEVIKSPQFMRFISSD
Ga0193436_107098813300019129MarineEHANVGLTAEKVIDKNPIYNAWESVKDGAADGHYERIITPNFSADTDDVFMRSMLKNFAHEKRTPIEELDDGTKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGGDLSDYMDTYFDRAWDNFDVNGDGAVEVIKTPQFMRFLASDQTMSLGESA
Ga0188870_1007712813300019149Freshwater LakeMKYTAVIALFLASSVVAKQDDDFVARLGPIADETVVQILESDSESDSEDEAMVDITANKKPSECTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPLAHFSADSDDIFMRSMLKKYAFEKRTPIELLEDGTKIGGEPTGSFWMSKTDMTYASKEVLKDHKGMSGEKLSSYLDTYFDRAWENFDPNGDGAVEVIKAPMFMRFLASDQGMSLGENGEDAGEVASFNALRAKQAAA
Ga0188870_1014258713300019149Freshwater LakePVWSLESVQTHRTDSTIQKAYGDHSTEKANGRPPYKSTVQLESDSESSDSESDDEQENVGINSDKVVDKNPIYNAWESVKDGAPDGKYERVITPHFASDSDDIFMRSMITKYAHEKRTPIEELEDGTKVGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYYDRAWSNFDVNG
Ga0194244_1002922613300019150MarineSTTMANARPPYKSHVQLESDSESSDSESDDEQANAQINSDKVIDKNPIYNAWESVKDGAPDGKYERVVTPHFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWLGKKDTFRAAKEVLGTHKGLSGEALSSYLDTYFDRAWGNFDVNGDGAIEVIKAPQFMRFLASDQGMSLGESA
Ga0194244_1003938213300019150MarineTWGIKTKMKFTLAIAALLGLTSATETVAIQERLFRARDVTVLQMEDSDSDSDDDTQVGLDADKVIEKNPTYNAWDSVKDGALDGKYERVITPHFSADSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWMSKVEMKRAAKEVLGTHKGLSGDKLSTYLDTYYDKAWDNFDVNGSGAVEVIKAPQFMRFLCSDQSMQLGESG
Ga0194244_1004842613300019150MarineGINSDKVIDKNPIYNAWESVKDGAPDGKYERVVTSHFAADSDDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWLGKKDMFRAAKEVLGTHKGLKGDALSTYLDTYFDRAWSNFDVNGDGAVEVIKAPQFMRFIASDQGMSLGESA
Ga0194244_1010233913300019150MarineADKVLVKDPIYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDKAWDNFDVNGGGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0192975_1018869813300019153MarineMKFTFAIACLLSLAAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMAKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0206687_147986713300021169SeawaterPYKSHVQLESDSESSDSESDDEEQANVGINSDKVVDKNPIYNAWESVKDGAADGKYERVITPHFASDSDDIFMRSMITKYSHEKRTPIEELDDGTKIGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSSYLDTYFDRAWSNFDVNGDGSVEVIKAPQFMRFLASDQGMSLGESA
Ga0206696_144120413300021334SeawaterQKDYGDFSTTAANGRPPYKSTVQLESDSESSDSESDDEQENVGINSDKVVDKNPIYNAWESVKDGAPDGKYERVITPHFASDSDDIFMRSMITKYAHEKRTPIEELEDGTKVGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSSYLDTYFDRAWSNFDVNGDGSVEVIKAPQFMRFLASDQGMSLGESA
Ga0206692_131741613300021350SeawaterFTFAIACLLGLAAADMTADSNLVPFKDITVVQMEESDSESSDDDQTNVDINTDKVIDKNPIYNAWESVKDGAADGKYERVITSNFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYFDRAWSNFDVNGDGSLEVLKAPQFMRFLASDQGMSLGESA
Ga0206693_126689713300021353SeawaterESDDEEQANVGINTDKVVDKNPIYNAWESVKDGAADGKYERVITPHFASDSDDIFMRSMITKYSHEKRTPIEELDDGTKIGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYYDRAWSNFDVNGDGSIEVIKAPQFMRFLASDQGMSLGESA
Ga0206693_131813013300021353SeawaterEKANGRPPYQSAVQMEESDSESDSESDEENVGIDKVIEKHPIYNAWESVKDGAADGKYERVITPNFSADSDDIFMRSMIKKYAHEKRTAREELDDGTIIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYMDTYFDRAWENFDVNGDGAVEVIKSPQFMRFIASDQTMGLGESG
Ga0063132_11591713300021872MarineDKVIDKNPIYNAWESVKDGAPDGKYERVVTPHFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGSFWLAKKSMMRAAKEVLGTHKGLSGGALDDYLDTYFDRAWSNFDVNGDGALEVIKAPQFMRFLASDQGMSLGESA
Ga0063132_13662913300021872MarineSESDEEHANVAIGASKVIDKSPIYNAWESVKDGAPDGKYERVITFNFASDSDDSFMRSMIKSYAHEARTPLEELDDGEKIGGEPTGAFWMSKKDMARAAKEVLGTHKGLTGGAFDDYMDTYFDRAWDEFDVNGDGAIEVIKTPQFMRFLASDQTMGLGENN
Ga0063137_112880013300021892MarineESSDSDSESDEEHANVAIGASKVIDKSPIYNAWESVKDGAPDGKYERVITFNFASDSDDSFMRSMIKSYAHEARTPLEELDDGEKIGGEPTGAFWMSKKDMARAAKEVLGTHKGLTGGAYDDYMDTYFDRAWDEFDVNGDGAIEVIKTPQFMRFLASDQTMGLGENN
Ga0063136_101664613300021896MarineMKFTFAVACLLGLASAQGESTLVQRLAPVKDVTVIQMEESESDSDEDETNAQVEADKVIEKHPIYNAWESVKDGAADGKYERAITANFAADSDDIFMRSMLKKYAFEKRTAREELDDGSIIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLSTYMETYFDKAWENFDVNGDGAVEVIKAPMFMRFLCSDQGMQLGESG
Ga0063136_105219513300021896MarineERPPYKSHVQLESDSESSDSESDDEEQANVGINSDKVVDKNPIYNAWESVKDGAADGKYERVITPHFASDSDDIFMRSMITKYSHEKRTPIEELDDGTKIGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSSYLDTYFDRAWSNFDVNGDGSVEVIKAPQFMRFLASDQGMSLGES
Ga0063135_111455413300021908MarineTFAVACLLGLASAQGESTLVQRLAPVKDVTVIQMEESESDSDEDETNAQVEADKVIEKHPIYNAWESVKDGAADGKYERAITANFAADSDDIFMRSMLKKYAFEKRTAREELDDGSIIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLSTYMETYFDKAWENFDVNGDGAVEVIKAPMFMRFLCSD
Ga0063135_112244823300021908MarineMGYADYSTTKANERPPYKSTVQLEESESESDSDSDDDVNAQVEADKVIEKHPIYNAWESVKDGAADGKYERAITPNFSGDSDDIFMRSMLKKYAFEKRTAREELDDGSIIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLSTYMETYFDKAWENFDVNGDGAVEVIK
Ga0063133_104108613300021912MarineFTFAIACLLGLAAAEEESTLVQRLAPVRDVTVIQMEESESDSDEDETNAQVEADKVIDKHPIYNAWESVKDGAADGKYERVVTPNFSADSDDIFMRSMLKKYAFEKRTPIEELDDGSKIGGEPTGSFWLSKKDMTYAAKEVLGTHKGLSGDKLSTYMDTYFDKAWENFDVNGDGAVEVIKAPMFMRFLCSDQGMQL
Ga0063139_104323913300021934MarineLVGLVSAGTNEPVWGLPSVLGHETDSKADVGYATYSTTKANDRPPYQSAVQIDESESESDSESDDETHVGLGAYGVFHAWDSIPGGAADGKYERVITPNFSADSDDLFMRSMIGKYAEEKKTDVETLDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDALSSYLDTYFDKAWDNFDVNGAGEVEVIKSPMFMRFLASDGAMPLGE
Ga0228686_104772713300023685SeawaterVQLESDSESSDSESDDEQENVGINSDKVVDKNPIYNAWESVKDGAPDGKYERVITPHFASDSDDIFMRSMITKYAHEKRTPIEELEDGTKVGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYYDRAWSNFDVNGDGSIEVIKAPQFMRFLASDQGMSLGESA
Ga0209832_122349813300025830Pelagic MarineEVQLAYAGYSTEAANARPPYKSTIQLDSVTDKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQ
Ga0209425_1031081713300025897Pelagic MarineSESESSDSESDDESNAQIAADKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG
Ga0247580_109498013300026423SeawaterMEESESESDSGSDSESDDETNVGVAADKVVEEHPIYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMIKNYAHEQRTQIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGAVEVIKAPQFM
Ga0247593_108392713300026449SeawaterPYQSTVQMEESESESDSESDDETHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDIFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGSVEVVKSPMFMRFLASD
Ga0247600_107044013300026461SeawaterTIQKAYGDHSTDKANARPPYQSTVQMEESESESDSESDDETHVGLEAMGPIYNAWESIAGGAAEGKYERVVTPNFSADSDDLFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGSVEVVKSPMFMRFLASDQGMPLGESG
Ga0247588_106379413300026465SeawaterNHRTDSTIQKAYGDHSTDKANGRPPYQSVAQVESDSESSDSDSESDEEHANVAIGASKVIDKSPIYNAWESVKDGAPDGKYERVITFNFASDSDDSFMRSMIKSYAHEARTPLEELDDGEKIGGEPTGAFWMSKKDMARAAKEVLGTHKGLTGGAYDDYMDTYFDRAWDEFDVNGDGAIEVIKTPQFMRFLASDQTMGLGENN
Ga0247598_114732413300026466SeawaterVQINYADYSTTKALERPPYKSAIQLDESESDSDSESDDETNVGVAADKVIDEHPIYNAWESVKDGAADGKYERVITPHFSADSDDIFMRSMIKNYAHEKRTQIEELDDGTKIGGEPTGAFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGEVEAIKAPQFMRFIASDQGM
Ga0247603_105690613300026468SeawaterVSFAVAVLVGLVSAGTNEPVWKLSSVLGHESDSKSDIGYATYSTVKANGRPPYQSAVQIDESESESDSESEDETHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDLFMRSMITKYAFEKRTDLETLDDGSTVGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGSVEVVKSPMFMRFLASD
Ga0247603_109608813300026468SeawaterEEQANVGINTDKVVDKNPIYNAWESVKDGASDGKYERVITPHFASDSDDIFMRSMITKYSHEKRTPIEELDDGTKIGGEPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSSYLDTYFDRAWSNFDVNGDGSVEVIKAPQFMRFLASDQGMSLGESA
Ga0247603_110525613300026468SeawaterEHANVAIGASKVIDKSPIYNAWESVKDGAPDGKYERVITFNFASDSDDSFMRSMIKSYAHEARTPLEELDDGEKIGGEPTGAFWMSKKDMARAAKEVLGTHKGLTGGAYDDYMDTYFDRAWDEFDVNGDGAIEVIKTPQFMRFLASDQTMGLGENN
Ga0247599_106880313300026470SeawaterVSFAVAVLVGLVSAGTNEPVWKLSSVLGHESDSKSDIGYATYSTVKANGRPPYQSAVQIDESESESDSESEDETHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDLFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVMGSHKGLSGDALSSYLDTYFDKAWENFDVNGAGSVEVVKAPQFMRFLASDQTFDLGV
Ga0247602_110658613300026471SeawaterKFTFAIACLLGLTAATEESSFVQRLARPIKDVTVIQMEDSESDSDSEDETHAQLAADKVIDEHPIYNAWESVKDGAADGKYERVITPHFSADSDDIFMRSMIKNYAHEKRTQIEELDDGTKIGGEPTGAFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGEVEAIKAPQFMRFIASDQGMSLGESG
Ga0247571_111011813300026495SeawaterYQSTVQMEESESESDSESDDETHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDIFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFRMSKKDMFRAAKEVLGTHKGLSGDALSSYLDTYFDKAWDNFDVNGAGSVEVIKAPQFMRFLASDQTFDLGV
Ga0247592_114255213300026500SeawaterTHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDLFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGSVEVVKSPMFMRFLASDQGMPLGESG
Ga0247592_114636313300026500SeawaterQSAIQMEESESESDSGSDSESDDETNVGVAADKVVEEHPIYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMIKNYAHEQRTQIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGAVEVIKAPQFMRFLASDQTMSLGESG
Ga0247587_111215913300026504SeawaterKMKFTFAIACLLGLTAATEESSFVQRLARPIKDVTVIQMEDSESDSDSEDETHAQLAADKVIDEHPIYNAWESVKDGAADGKYERVITPHFSADSDDIFMRSMIKNYAHEKRTQIEELDDGTKIGGEPTGAFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGEVEAIKAPQFMRFIASDQGMSLGESG
Ga0247582_113895913300028109SeawaterLLVSSSSAVQLTAEPVWSLRSVNDHRTDSTIQKAYGDHSTDKANARPPYQSTVQMEESESESDSESDDETHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDIFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDALSSYLDTYFDKAWENFDVNGAGSVEVLKAPQFTRFLASD
Ga0256411_115982613300028134SeawaterMKFTFAIACLLGLTAATEESSFVQRLARPIKDVTVIQMEDSESDSDSEDETHAQLAADKVIDEHPIYNAWESVKDGAADGKYERVITPHFSADSDDIFMRSMIKNYAHEKRTQIEELDDGTKIGGEPTGAFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGKGEVEAIKAPQFMRFIASDQGMSLGESG
Ga0256412_114902713300028137SeawaterLTSVLGHQSDSESQIGYAGYSTEKANARPPYKSAVQVEESDSESDSESDDETHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDIFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGSVEVVKSPMFMRFLASDQGMPLGESG
Ga0256412_117218713300028137SeawaterKITFAVAVLVGLASAEEPVWSLSSVQNHRTDSTIQKAYGDHSTDKANARPPYQSTVQMEESESESDSESDDETHVGLEAMGPIYNAWESIAGGAAEGKYERVVTPNFSADSDDLFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDALSSYLDTYFDKAWENFDVNGAGSVEVIKAPQFMRFLASDQTFDLGV
Ga0256412_122734213300028137SeawaterTFAIACLLGLAAADMTADSNLVPFKDITVVQMEESDSESSDDDQTNVDINTDKVIDKNPIYNAWESVKDGAADGKYERVITSNFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYFDRAWSNFDVNGDGSLEVLKAPQFMRFLASDQGMSLGESA
Ga0256412_140539513300028137SeawaterSDSDDEHVNVGLSAQKVIDKNPIWNAWESVKDGAPDGHYERIITPIFSTDTDDLFMRSMISNYAHEQRTAIEELDDGTRIGGEPTGSFWMSRSDMMRAAKEVIKDHKGLSGADLADYLDTYFDRAWDEFDVNGEGAIEVIKTPQFMRFLASDQTMSLGE
Ga0256417_113374013300028233SeawaterMKFTFAIACLLGLAAAEERQIAPTQYIRHRDVTVLQMEDSESESDDETNVGINSDKVIDKSPIYNAWESVKDGAADGKYERKVTPHFASDSDDIFMRSMITKYAHEKRTPIEELEDGTKIGGEPTGSFWMGKKDMFRAGKEVLGTHKGLSGDALSSYMDTYFDRAWSNFDVNGDGAVEVLKAPQFMRFLASDQGMSLGESA
Ga0256413_123057813300028282SeawaterLGLAAADMTADSNLVPFKDITVVQMEESDSESSDDDQTNVDINTDKVIDKNPIYNAWESVKDGAADGKYERVITSNFASDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMLAKKDMFRAAKEVMGTHKGLSGDALSTYLDTYFDRAWSNFDVNGDGSLEVLKAPQFMRFLASDQGMSLGESA
Ga0247572_111367813300028290SeawaterDYSTEKANARPPYKSAVQVEESDSESDSESDDETHVGLEAMGPIYNAWESIAGGAAEGKYERVITPNFSADSDDIFMRSMITKYAFEKRTDIEELDDGSKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGSVEVVKSPMFMRFLASD
Ga0247597_103697913300028334SeawaterSTVQLDSESESSDSESDDETNAQIAADKVIEKHPIYNAWESVKDGAADDKYERIITPNFSSDSDDIFMRSMIKKYAHEKRTQIEELDDGSKIGGEPTGVFMMGKKDMTYAAKEVLGTHKGLSGAALTDYLDTYFDKAWENFDVNNDGAIEVIKSPMFMRFLCSDQGMQLGESG
Ga0247597_104452313300028334SeawaterQANVGINTDKVVDKNPIYNAWESVKDGAADGKYERVITPHFASDSDDIFMRSMITKYSHEKRTPIEELDDGTKIGGDPTGSFWLAKKDMFRAAKEVMGTHKGLSGDALSSYLDTYFDRAWSNFDVNGDGSVEVIKAPQFMRFLASDQGMSLGESA
Ga0073990_1174895013300030856MarineTEQNTFVNRLEKVRDVTVVQIEDSDSESDDDETHVGLDAEKVVEKNPIYNAWESIKDGAADGKYERVITPHFSADSDDLFMRSMIKKYAHEKRTPIEELDDGSKIGGEPTGSFWMSKKDMTYAAKEVLGTHKGLSGDALKSYMDTYFDRAWENFDVNGDGAVEVLKAP
Ga0073990_1177030913300030856MarineESESDSESDKEDDEDYVNAQVATDKVIDKHPIYHAWDHVPDGAADGKYERITTPNFSADSDDLFMRSMIQHYAFEKRTPIEELDDGSHIGGEPTGSFWMSKKDMFRAAKEVLNTHKGLSGDKLDTYLDTYFDKAWENFDVNGGGSVEVIKSPMFMRFLASDGAMSLGE
Ga0073990_1178647813300030856MarineDSTVQKDYGDYSTEAANARPPYKSTVQLEAESDSESSDSESDDDSNVGLAADKVIDKNPIYNAWESVKDGAADGKYERVITPHFASDSDDIFMRSMISKYAHEKRTPIEELDDGTKIGGEPTGSFWLAKKDMFRAAKEVLGTHKGLAGAALSSYLDTYFDRAWSNFDVNGDGAVEVIKAPQFMRFLASDQGMSLGESA
Ga0073984_1123810913300031004MarineLDESDSESDSDSDQENVAVAADKVIEKEPIYNAWESVKDGAVDGKYERVITPHFSGDDDDIFMRSMITKYAHEKRTSIEELDDGTRIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWENFDVNGSGAVEVIKAPQFMRFLCSDQTMQLGESG
Ga0073984_1125944513300031004MarineMGYGDYSTTKANERPPYKSTVQIEESESDSDSGSESDEETTHVGLAADKVIEKDPIYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMYRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0073984_1128337513300031004MarineTVQIDESDSESDSESDQENVGVAADKVIEKDPIYNAWESVKDGAVDGKYERVITPHFSGDDDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMGKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGAVEVIKAPQFMRFLCSDQTMQLGESG
Ga0073989_1347025813300031062MarineRDDSNTQMGYAGYSTDKANGRPPYQSAVQMEESDSESDSDSEEENVGIAADKVIEKNPIYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAHEKRTSIEELDDGTKIGGEPTGSFWMSKKDMFRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWSNFDVNGDGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0073989_1355732313300031062MarineMKFTFAIACLLGLAAAKYDDSTFVQRLSKVRDVTVIQMEDSDSESEDETNVGLDKVIEKHPIYNAWESVKDGAADDKYERIITPNFSADSDDIFMRSMLKTYAREHRTPIEELDDGSKIGGEPTGSFWMGKKDMYRAAKEVLKTHKGLSGDKLSSYLDTYFDRAWENFDVNGDGEVEVIKAPQFMRFLASDQSLSLGESD
Ga0073989_1358937213300031062MarineNEPVWALTSVLGHRDDSTTQMGYGDYSTTKANERPPYKSTVQIEESESDSDSGSESDEETTHVGLAADKVIEKDPIYNAWESVKDGAADGKYERVVTPHFSADSDDIFMRSMITKYAHEKRTSIEELDDVTKIGGEPTGSFWMGKKDMYRAAKEVLGTHKGLSGDKLSSYLDTYFDRAWDNFDVNGSGAVEVIKSPQFMRFLCSDQGMQLGESG
Ga0308149_103315313300031542MarineAQVDSESESSDSESDDESNAQIAADKVIEKNPTYNAWESIKDGAADGKYERVITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGSKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDSSMQIGESG
Ga0307393_112012813300031674MarineLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALDDYLETYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0307396_1036563413300031717MarineKFTFAIACLLSLAAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALDDYLETYFDRAWSNFDVNGDGSLEVLKSPMFMRFLASDQTMQLGESA
Ga0307381_1014333413300031725MarineKYTAAIACLLASVAAIKQDADFVARLGPVADETVVQILESDSDSDSEDEAMVDISADKKPSECTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPISHFSSDTDDIFMRSMLKKYAYEKRTPLELLEDGTKIGGEPTGAFLMSKTDMTYASKEVLKDHKGLSGEKLSSYMDTYFDRAWENFDPNGDGSVEVIKAPMFMRFLASD
Ga0307397_1061361213300031734MarineFTFAIACLLSLAAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALDDYLETYFDRAWSNFDV
Ga0307394_1041675313300031735MarineFTFAIACLLSLAAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALDDYLETYFDRAWSNFDVNGDGSLEVLK
Ga0307383_1041252713300031739MarineTFAIACLLSLAAADMAAEKDLVPFKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYAHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALSDYLDTYFDRAWSNFDVNGDGSLEVLKSPMFMRFLASDQTMQLGESA
Ga0307395_1031989113300031742MarineAANMAAEKDLAPIKDITVVQMEESDSESSDDDSQNVAINSDKVLVKNPTYNAWESVKDGAADGKYERKVTSNFASDSDDIFMRSMITKYSHEKRTSIEELDDGSKIGGEPTGSFWMGKKDMFRAAKEVMGTHKGLSGAALDDYLETYFDRAWSNFDVNGDGSLEVLKSPQFMRFLASDQGMSLGESA
Ga0307395_1035164413300031742MarineQVESDSESSDSESDEEETANVGLAVSKMISKHPTYNAWDSVKDGAPDGKYERVVTFNFANDSDDSFMRSMINTYAHEARTSIEELDDGTRVGGEPTGAFWMTKVEMFRAAKEVLSSHKELSGGALEDYLGTYYDRAWDEFDVNGDGAIEVIKTPQFMRFLASD
Ga0314688_1065597913300032517SeawaterAHRDDSTTQQGFGNYATDKANARPPYKSTVQVNDSESDSESSDEEANVGLDAFKKPSDCTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPVSHFSADSDDIFMRSMVKKFAFEKRTPIELLEDGTKIGGEPTGSFWLGKTDAMYAAKEVLKTHKGLSGDKLSSYLDTYYDRAWENFDPNADGAIEVI
Ga0314683_1088528213300032617SeawaterNAQIAADKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG
Ga0314669_1038484513300032708SeawaterATDKANARPPYKSTVQVNDSESDSESSDEEANVGLDAFKKPSDCTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPVSHFSADSDDIFMRSMVKKFAFEKRTPIELLEDGTKIGGEPTGSFWLGKTDAMYAAKEVLKTHKGLSGDKLSSYLDTYYDRAWENFDPNADGAIEVIKAPMFMRFLASDQGMSLGENGEDDGEIATFNALRAKQAAAAAAF
Ga0314699_1048929613300032730SeawaterLGPIADETVVQILESDSESDSEDEAMVDITANKKPSECTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPLAHFSADSDDIFMRSMLKKYAFEKRTPIELLEDGTKIGGEPTGSFWMSKTDMTYASKEVLKDHKGMSGEKLSSYLDTYFDRAWENFDPNGDGAVEVIKAPMFMRFLASDQGMSL
Ga0314699_1051577113300032730SeawaterANVGLDAFKKPSECTTFPCVLEKKPTYKAWDSVKDGAVDGKYERLPVSHFSADSDDIFMRSMVKKYAFEKRTPIELLEDGTKIGGEPTGSFWLSKTDLGYAAKEVLKDHKGLSGDKLSSYLDTYFDRAVENFDPNGDGAIEVIKAPMFMRFLASDQGMSLGENGEDAGEIASFNALRAK
Ga0314704_1061750913300032745SeawaterDKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGTKIGGEPTGTFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSDQGMQIGESG
Ga0314713_1037263013300032748SeawaterQSTAQVDSESESSDSESDDESNAQIAADKVIEKNPTYNAWESIKDGAADGKYERIITPNFSSDSDDIFMRSMITKYAHEKRTPIEELDDGSKIGGEPTGVFMMGKKDMQYAAKEVLGTHKGLKGAAAAEYMDTYFDKAWSNFDVNGDGAIEVIKSPMFMRFLCSD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.