Metagenome Family F027701

Overview

Basic Information

• Family ID: F027701
• Family Type: Metagenome
• Number of Sequences: 193
• Average Sequence Length: 38 residues
• Representative Sequence: MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQ
• Number of Associated Samples: 65
• Number of Associated Scaffolds: 193

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 89.83 %
• % of genes near scaffold ends (potentially truncated): 13.47 %
• % of genes from short scaffolds (< 2000 bps): 91.71 %
• Associated GOLD sequencing projects: 65
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (78.756 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (98.446 % of family members)
• Environment Ontology (ENVO): Unclassified (98.446 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (98.446 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 43.75%
  β-sheet: 0.00%
  Coil/Unstructured: 56.25%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 193 Family Scaffolds
PF04195	Transposase_28	2.07

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
All Organisms	root	All Organisms	21.24 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
cellular organisms	root	All Organisms → cellular organisms	21.24 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	21.24 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	19.69 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.55 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	19.69 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.55 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	19.69 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.55 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19.69 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.55 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	19.69 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.55 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	19.69 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.55 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	19.69 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	1.55 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19.69 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	1.55 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	19.69 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	1.55 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	19.69 %
Spirurina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina	1.55 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	19.69 %
Spiruromorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha	1.55 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	19.69 %
Filarioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea	1.55 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	19.69 %
Setariidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae	1.55 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	19.69 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.52 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.52 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	78.76 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	1.55 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.52 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300013296|Ga0157374_12363970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	559
3300013297|Ga0157378_12637364	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	555
3300013297|Ga0157378_12830519	Not Available	538
3300015267|Ga0182122_1066536	Not Available	515
3300015269|Ga0182113_1063210	Not Available	575
3300015269|Ga0182113_1067213	Not Available	564
3300015274|Ga0182188_1053143	Not Available	525
3300015275|Ga0182172_1058552	Not Available	546
3300015275|Ga0182172_1069236	Not Available	519
3300015275|Ga0182172_1076218	Not Available	503
3300015276|Ga0182170_1023806	Not Available	703
3300015276|Ga0182170_1033622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	640
3300015277|Ga0182128_1058760	Not Available	550
3300015277|Ga0182128_1064683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	535
3300015283|Ga0182156_1027670	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	703
3300015283|Ga0182156_1087512	Not Available	503
3300015285|Ga0182186_1024156	Not Available	718
3300015285|Ga0182186_1074640	Not Available	520
3300015286|Ga0182176_1025824	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	731
3300015286|Ga0182176_1047618	Not Available	606
3300015286|Ga0182176_1051387	Not Available	592
3300015286|Ga0182176_1080300	Not Available	513
3300015287|Ga0182171_1006750	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1024
3300015287|Ga0182171_1031280	Not Available	679
3300015288|Ga0182173_1061823	Not Available	556
3300015289|Ga0182138_1018408	Not Available	785
3300015291|Ga0182125_1044722	Not Available	629
3300015291|Ga0182125_1060496	Not Available	576
3300015292|Ga0182141_1020988	Not Available	773
3300015292|Ga0182141_1078841	Not Available	531
3300015294|Ga0182126_1027083	Not Available	727
3300015294|Ga0182126_1078652	Not Available	534
3300015294|Ga0182126_1084078	Not Available	524
3300015295|Ga0182175_1016561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	841
3300015295|Ga0182175_1038343	Not Available	666
3300015295|Ga0182175_1074778	Not Available	548
3300015296|Ga0182157_1058560	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	598
3300015296|Ga0182157_1079842	Not Available	544
3300015298|Ga0182106_1027624	Not Available	743
3300015298|Ga0182106_1029838	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	726
3300015298|Ga0182106_1030174	Not Available	724
3300015298|Ga0182106_1032669	Not Available	708
3300015298|Ga0182106_1065986	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	577
3300015298|Ga0182106_1084716	Not Available	534
3300015299|Ga0182107_1042614	Not Available	659
3300015299|Ga0182107_1048083	Not Available	637
3300015300|Ga0182108_1020089	Not Available	823
3300015300|Ga0182108_1022983	Not Available	792
3300015300|Ga0182108_1049521	Not Available	636
3300015300|Ga0182108_1080344	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	550
3300015300|Ga0182108_1081954	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	546
3300015302|Ga0182143_1083099	Not Available	540
3300015302|Ga0182143_1102831	Not Available	505
3300015303|Ga0182123_1021516	Not Available	773
3300015303|Ga0182123_1023957	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	751
3300015303|Ga0182123_1094539	Not Available	509
3300015303|Ga0182123_1095457	Not Available	508
3300015304|Ga0182112_1019164	Not Available	827
3300015304|Ga0182112_1069058	Not Available	574
3300015305|Ga0182158_1100361	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	509
3300015305|Ga0182158_1101119	Not Available	508
3300015308|Ga0182142_1050930	Not Available	646
3300015308|Ga0182142_1060635	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	614
3300015308|Ga0182142_1077761	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	569
3300015308|Ga0182142_1079412	Not Available	565
3300015308|Ga0182142_1090808	Not Available	542
3300015314|Ga0182140_1047821	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	660
3300015314|Ga0182140_1056280	Not Available	629
3300015314|Ga0182140_1081472	Not Available	562
3300015321|Ga0182127_1088714	Not Available	562
3300015322|Ga0182110_1076655	Not Available	587
3300015322|Ga0182110_1087855	Not Available	562
3300015322|Ga0182110_1089055	Not Available	560
3300015322|Ga0182110_1093082	Not Available	552
3300015323|Ga0182129_1031917	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	738
3300015323|Ga0182129_1117250	Not Available	501
3300015341|Ga0182187_1022331	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1061
3300015341|Ga0182187_1061218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	764
3300015341|Ga0182187_1089733	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	670
3300015341|Ga0182187_1151036	Not Available	558
3300015341|Ga0182187_1171016	Not Available	533
3300015342|Ga0182109_1147946	Not Available	589
3300015342|Ga0182109_1201842	Not Available	522
3300015342|Ga0182109_1203183	Not Available	521
3300015342|Ga0182109_1217953	Not Available	507
3300015343|Ga0182155_1053315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	839
3300015343|Ga0182155_1063659	Not Available	790
3300015343|Ga0182155_1101053	Not Available	674
3300015343|Ga0182155_1104386	Not Available	666
3300015343|Ga0182155_1135566	Not Available	607
3300015343|Ga0182155_1157114	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	575
3300015343|Ga0182155_1205159	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	520
3300015344|Ga0182189_1088855	Not Available	715
3300015344|Ga0182189_1127882	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	627
3300015345|Ga0182111_1117216	Not Available	668
3300015345|Ga0182111_1143391	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	619
3300015345|Ga0182111_1153655	Not Available	603
3300015346|Ga0182139_1016007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1322
3300015346|Ga0182139_1075186	Not Available	787
3300015346|Ga0182139_1090796	Not Available	735
3300015346|Ga0182139_1178370	Not Available	570
3300015346|Ga0182139_1192131	Not Available	553
3300015347|Ga0182177_1064607	Not Available	835
3300015347|Ga0182177_1095083	Not Available	725
3300015347|Ga0182177_1170238	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	583
3300015347|Ga0182177_1212558	Not Available	535
3300015347|Ga0182177_1212869	Not Available	534
3300015347|Ga0182177_1237936	Not Available	511
3300015347|Ga0182177_1238564	Not Available	511
3300015347|Ga0182177_1250025	Not Available	501
3300015351|Ga0182161_1146829	Not Available	639
3300015351|Ga0182161_1192869	Not Available	574
3300015351|Ga0182161_1237414	Not Available	527
3300015355|Ga0182159_1062643	Not Available	1032
3300015355|Ga0182159_1064969	Not Available	1017
3300015355|Ga0182159_1080038	Not Available	938
3300015355|Ga0182159_1179292	Not Available	673
3300015355|Ga0182159_1199027	Not Available	644
3300015361|Ga0182145_1030425	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	922
3300015361|Ga0182145_1163777	Not Available	533
3300015361|Ga0182145_1168303	Not Available	528
3300015361|Ga0182145_1187915	Not Available	508
3300017404|Ga0182203_1050011	Not Available	737
3300017404|Ga0182203_1125954	Not Available	549
3300017407|Ga0182220_1072056	Not Available	566
3300017409|Ga0182204_1030333	Not Available	758
3300017409|Ga0182204_1056450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	632
3300017410|Ga0182207_1032176	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	875
3300017410|Ga0182207_1038793	Not Available	826
3300017410|Ga0182207_1098555	Not Available	613
3300017410|Ga0182207_1111673	Not Available	588
3300017410|Ga0182207_1160169	Not Available	519
3300017410|Ga0182207_1171968	Not Available	507
3300017411|Ga0182208_1106208	Not Available	536
3300017411|Ga0182208_1128377	Not Available	503
3300017413|Ga0182222_1060359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	586
3300017413|Ga0182222_1068299	Not Available	568
3300017415|Ga0182202_1025190	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	855
3300017415|Ga0182202_1028720	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	821
3300017415|Ga0182202_1095815	Not Available	568
3300017420|Ga0182228_1074304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	615
3300017420|Ga0182228_1130975	Not Available	500
3300017424|Ga0182219_1032842	Not Available	789
3300017424|Ga0182219_1050722	Not Available	689
3300017425|Ga0182224_1033056	Not Available	830
3300017425|Ga0182224_1052342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	723
3300017425|Ga0182224_1063956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	680
3300017425|Ga0182224_1084160	Not Available	625
3300017425|Ga0182224_1091984	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	608
3300017425|Ga0182224_1125551	Not Available	551
3300017427|Ga0182190_1055035	Not Available	730
3300017427|Ga0182190_1111364	Not Available	576
3300017427|Ga0182190_1137527	Not Available	535
3300017430|Ga0182192_1150608	Not Available	528
3300017430|Ga0182192_1174370	Not Available	501
3300017433|Ga0182206_1094657	Not Available	594
3300017433|Ga0182206_1137862	Not Available	527
3300017436|Ga0182209_1167847	Not Available	508
3300017438|Ga0182191_1078567	Not Available	668
3300017442|Ga0182221_1087824	Not Available	618
3300017442|Ga0182221_1118501	Not Available	564
3300017442|Ga0182221_1142176	Not Available	532
3300017443|Ga0182193_1135455	Not Available	573
3300017443|Ga0182193_1174626	Not Available	524
3300017443|Ga0182193_1185324	Not Available	513
3300017680|Ga0182233_1093843	Not Available	551
3300017683|Ga0182218_1069751	Not Available	642
3300017683|Ga0182218_1144962	Not Available	512
3300017684|Ga0182225_1084189	Not Available	595
3300017684|Ga0182225_1117896	Not Available	536
3300017685|Ga0182227_1061532	Not Available	681
3300017686|Ga0182205_1080013	Not Available	650
3300017686|Ga0182205_1125624	Not Available	559
3300017686|Ga0182205_1155171	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	520
3300017690|Ga0182223_1016853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	865
3300017690|Ga0182223_1068916	Not Available	593
3300017690|Ga0182223_1074572	Not Available	580

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	98.45%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.55%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	98.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.55%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	98.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.55%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	98.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.55%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0157374_123639702	3300013296	Miscanthus Rhizosphere	MDHLAPLPRDSSMRVMNHAEGEQLRRAKEDKRKKK*
Ga0157378_126373641	3300013297	Miscanthus Rhizosphere	MDHLAPLPRDSTVRTANRTEGERLRKAKEDKRKKK*
Ga0157378_128305192	3300013297	Miscanthus Rhizosphere	MDHPAPLSRDSAVRTANHAEGEWLRKAKEDKKRKKQWKL*
Ga0182122_10665362	3300015267	Miscanthus Phyllosphere	MDHPTLLPRDSAVRMANHVEGERLRKAKEDKNRKKQQKL*
Ga0182113_10632101	3300015269	Miscanthus Phyllosphere	MDHPVPLPRDSSMRAANRAKGERLRKAKEDKKRNRQWKL*
Ga0182113_10672131	3300015269	Miscanthus Phyllosphere	MDPPTPLLRDSAMRMANCAKGERLRKAKEDRKRKK*
Ga0182188_10531431	3300015274	Miscanthus Phyllosphere	FTDHLAPLPRDSSVRALNHAEGERLRKAKEGKRKKK*
Ga0182172_10585522	3300015275	Miscanthus Phyllosphere	MDHPAPLSRDLTVRVANCAEGERLRKAKEGKKRKK*
Ga0182172_10692362	3300015275	Miscanthus Phyllosphere	MDHPASLPRDLAMRAVNRVEGERLRKVKEDKKRKKQ*
Ga0182172_10762181	3300015275	Miscanthus Phyllosphere	MLLLRDSSMRAANHVEGERLRKAKEDMRKKRQQKLLA*
Ga0182170_10238061	3300015276	Miscanthus Phyllosphere	MDHPAPLSRDSAVRTTNRAEGERLRKVKEDKKRKK*
Ga0182170_10336222	3300015276	Miscanthus Phyllosphere	MDHLAPLSRDLAVRVANRAGGKWLWKAKEDKKRKK*
Ga0182128_10587602	3300015277	Miscanthus Phyllosphere	MDHLALLPKDLSMRAMNHAEGERLRKKEDKKRKKQ*
Ga0182128_10646832	3300015277	Miscanthus Phyllosphere	MDHPTPLPRDSAVRTANHTEGEWLRKAKEDKKRKKQ
Ga0182160_10662951	3300015281	Miscanthus Phyllosphere	HMDHPALLPRGLAMRAVNHTDGERLKKAKEDKKRKK*
Ga0182156_10276702	3300015283	Miscanthus Phyllosphere	MDHSAPLPRDSSVRVVNHAEGERLRKAKEDKKRKR*
Ga0182156_10875122	3300015283	Miscanthus Phyllosphere	PRDLIIMDHQAPLLRDSAMRATNHVEVERLRKAKEDKKRKK*
Ga0182186_10241562	3300015285	Miscanthus Phyllosphere	MDHPVPLPRDSAMRVVNRTKGERLRKAKEDKKRKK*
Ga0182186_10746401	3300015285	Miscanthus Phyllosphere	MDHLASLPRDSSVRAANHAEGERLRKAKEDKRKKKH*
Ga0182176_10258242	3300015286	Miscanthus Phyllosphere	MDHLAPLPRDSAMRIANHAEGERLRKAKEDRKRKKQ*
Ga0182176_10476182	3300015286	Miscanthus Phyllosphere	MDHLALLPRDLAMRAANRAESERLRKVKEDKKRKK*
Ga0182176_10513872	3300015286	Miscanthus Phyllosphere	MDHPMPLPRDSDMRVANRAKGERLRKAKEDKKRKK*
Ga0182176_10803001	3300015286	Miscanthus Phyllosphere	MDHPVPLLRDLAMRVANHTKGEWLREAKEDKKRKKQRKLQAWE*
Ga0182171_10067504	3300015287	Miscanthus Phyllosphere	MDHSAPLPRDSSVRAVNHAEGEQLRKEKEDKKRKR
Ga0182171_10137693	3300015287	Miscanthus Phyllosphere	MDHPTPLPRDSSMRAMNYALGKWLRKAKEDKKRKR*
Ga0182171_10312801	3300015287	Miscanthus Phyllosphere	MDDLAPLPRDSTMRAANHAEGKWLRKEKEGKRKKKQ
Ga0182173_10331711	3300015288	Miscanthus Phyllosphere	MDDLALLPRDSSVRVANRAEGERLRKAKEDKRRKRQ*
Ga0182173_10618232	3300015288	Miscanthus Phyllosphere	MDHLAPLPRDSAVRTMNRAEGERLRKAKKDRKRKRQWKL*
Ga0182138_10184081	3300015289	Miscanthus Phyllosphere	MDHIAPLPRDSSVRVANHVEGEQLRKAKEDKKRKKQWKLRVRE*
Ga0182125_10161442	3300015291	Miscanthus Phyllosphere	MDHPALLPRGLAMRAVNHTDGERLKKAKEDKKRKK*
Ga0182125_10309782	3300015291	Miscanthus Phyllosphere	MDHPSSLPRDSSVRVANHAEGERLRKAKEDKRKKRQRKLQAQE*
Ga0182125_10447221	3300015291	Miscanthus Phyllosphere	MDHPAPLPRDSAMRTANHTEGERPRKVKEDKKRKKQWKL*
Ga0182125_10604961	3300015291	Miscanthus Phyllosphere	VVPLPRDLAVRTANHAEGERLRRAKEDRKRKKKWKL*
Ga0182141_10209882	3300015292	Miscanthus Phyllosphere	MDHPAPLSRDSAMRAANHAEGERLWKAKEDKKRKK*
Ga0182141_10788411	3300015292	Miscanthus Phyllosphere	MDHPAPLPRDSSMRAASHAEGKWLRKAKEDKKRKQQQKL*
Ga0182126_10270831	3300015294	Miscanthus Phyllosphere	MDHLAPLLRDSTVRTVNRAEGEWLRKVNEDRKRKK*
Ga0182126_10786521	3300015294	Miscanthus Phyllosphere	MDHPAPLPRDSSMRVVNHVEGEWLRKVKEDKRKKKQRRL*
Ga0182126_10840782	3300015294	Miscanthus Phyllosphere	MEHPALLPRDSATRMMNCAEGEWLRKAKEDRKRKKQQKLQA*
Ga0182175_10165611	3300015295	Miscanthus Phyllosphere	MDHPTLLPRDSAMRLANYAKAEWLKKAKEDKMRKRQQKLRA
Ga0182175_10383431	3300015295	Miscanthus Phyllosphere	MDHLAPLPRDLSVRAVNHAEGERLKKAKEDKRKKRQWKL*
Ga0182175_10747782	3300015295	Miscanthus Phyllosphere	MDHPAPLPRDLAMRVANRAEGERLRKAKDDKKRKKQWKL*
Ga0182157_10585601	3300015296	Miscanthus Phyllosphere	MNHSAPLPRDSFVRAANHAEGERLRKAKVDKKRKRQRKLQAQE*
Ga0182157_10798421	3300015296	Miscanthus Phyllosphere	MDHPAPLPRDLAVRAVNRAEGEWLRKAKEDKKREKQ*
Ga0182106_10276241	3300015298	Miscanthus Phyllosphere	MDHPASLPRDLSMRAANHVKGERLRKTKEDKRKKKQ*
Ga0182106_10298381	3300015298	Miscanthus Phyllosphere	MDHPAPLPRDSAVRVANRAKGEWLRKAKEDKKRKKQWKLRVRE*
Ga0182106_10301741	3300015298	Miscanthus Phyllosphere	MDHPTPLPRDSAMRMANHAKGEWLRKAKEDKKRNNQQKLLA*
Ga0182106_10326692	3300015298	Miscanthus Phyllosphere	MDLIFMDHPAPLPRDSSVRVANHAEGEWLRKAKEDKRKKKHQKL*
Ga0182106_10659862	3300015298	Miscanthus Phyllosphere	MRDLIFMDHPAPLPRDSSMRVVNHAKGERLRKAKEDKKRKR*
Ga0182106_10847161	3300015298	Miscanthus Phyllosphere	MDHPASLPRDSSMRAANRAEGERLRKAKEDKRKKK*
Ga0182107_10426142	3300015299	Miscanthus Phyllosphere	MDHPTPLPRDLAMRLVNHAEGEWLRKAKDDKKRKKQWKL*
Ga0182107_10480831	3300015299	Miscanthus Phyllosphere	MDHPMPLLRDSSVRAVNRAKGEWLRKAKEDKRKKK*
Ga0182107_10955551	3300015299	Miscanthus Phyllosphere	PRELVFTDHPALLPRDSSMRAANRAEGERLRKAKEDKRKKKQ*
Ga0182108_10200892	3300015300	Miscanthus Phyllosphere	LPRDSFVRATNHVEGERLRKAKEDKKRNRQWKLQAWK*
Ga0182108_10229831	3300015300	Miscanthus Phyllosphere	MPPTDLILMDHPAPLLRDSTVRVANHTEGEQLRKAKEDKKRKK*
Ga0182108_10495211	3300015300	Miscanthus Phyllosphere	MDHPVALPRDSSMRAANRAEGERVRKAKEDKKRKK*
Ga0182108_10803442	3300015300	Miscanthus Phyllosphere	MDHPAPLPRDSAVRAANRAEGKRLRKVKEDWKRKKQRKLQVQER
Ga0182108_10819541	3300015300	Miscanthus Phyllosphere	MDHPMPLLRDLAMRMVNHAEGERLRKAKEDKKRKK*
Ga0182143_10830992	3300015302	Miscanthus Phyllosphere	MDHPVPLPRDSCVRAVNRAEGERLRKAKEDKKRKRQQKL*
Ga0182143_11028311	3300015302	Miscanthus Phyllosphere	MDHPTPLPRDSVVRTANRAEGERLRKAKEDKKRKKQQ
Ga0182123_10215162	3300015303	Miscanthus Phyllosphere	MDHSVSLPRDSAMRMANRIEGEWLRKAKEDKKRKRQRKL*
Ga0182123_10239572	3300015303	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKMKKE*
Ga0182123_10945391	3300015303	Miscanthus Phyllosphere	MDHPVPLPRDSAVRVVNRAEGERLRKVKEDKKRKKMWKLWS*
Ga0182123_10954572	3300015303	Miscanthus Phyllosphere	MDHLAPLPRELAMRVANRAEGEWLRKAKEGKKRKKKWKLRA*
Ga0182112_10191642	3300015304	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQWKL*
Ga0182112_10690582	3300015304	Miscanthus Phyllosphere	MDHPVPLLRDSDVRVANRAEGERLRKAKDDKKRKRQQKL*
Ga0182158_11003612	3300015305	Miscanthus Phyllosphere	MDHLVPLPRDSTMRVANSAEGKRLRKAKEDKKRKK
Ga0182158_11011192	3300015305	Miscanthus Phyllosphere	MDHLAPLLRDSSMRAVNHVVGKGLRKAKEDKRKKKQWKL*
Ga0182142_10509301	3300015308	Miscanthus Phyllosphere	MDHPVLLLRDSAMRTMNHAEGERLRKAKEDRKRKKQRKLQVQE*
Ga0182142_10606352	3300015308	Miscanthus Phyllosphere	MDHPAPLPRDLAVRAVNRAEGEWLRKAKEDKKRKKQ*
Ga0182142_10777612	3300015308	Miscanthus Phyllosphere	MDPPTSLPRDSTVRMANHTEGERLRKAKEDKKGKKQWKL*
Ga0182142_10794122	3300015308	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNHIEGEMLRKAKEDEERKKQRKL*
Ga0182142_10908081	3300015308	Miscanthus Phyllosphere	MDHPAPLLRDSSMRVVNCVEGERLRKAKEDKRKKQQQKL*
Ga0182140_10478212	3300015314	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAANRAEGEWLRKAKEDKKRKKQ*
Ga0182140_10562801	3300015314	Miscanthus Phyllosphere	FMDYLAPLPWDSSMRAANHAEGKRLRKAKEDKKRKR*
Ga0182140_10814722	3300015314	Miscanthus Phyllosphere	MDHLASLSRDLAVSAANRAEGEQLRKAKEDKKRKK*
Ga0182127_10887141	3300015321	Miscanthus Phyllosphere	MDHPAPLPRDSSMRVVNHVEGEWLRKVKEDKRKKKQWKLQA*
Ga0182110_10766552	3300015322	Miscanthus Phyllosphere	MDHLVPLLRDSTMNTVNHAEGEPLRKAKDDKKRTKQRKL*
Ga0182110_10878551	3300015322	Miscanthus Phyllosphere	MDHPVPLLRDSSVRAANHTEGERLRKAKEDKRKNKQ*
Ga0182110_10890551	3300015322	Miscanthus Phyllosphere	LILTDHLAPLPRDSSMRVANRAEGERLRKAKEDKRKKK*
Ga0182110_10930822	3300015322	Miscanthus Phyllosphere	MDHPTPLSRDSTMRTANHTKGEWLRKAKEDRKRKKQ*
Ga0182129_10319171	3300015323	Miscanthus Phyllosphere	MDHPTLLPRDSFVRAANHAEGEWLRKAKEDKRKKKQPKLQARE*
Ga0182129_10594012	3300015323	Miscanthus Phyllosphere	LRDLIFLDHPAPLPRDSSMRAVNDAKGMRLRKAKEDKKRKRQWKL*
Ga0182129_11172502	3300015323	Miscanthus Phyllosphere	MDHPVSLPRDSFMRAVNHAEGERLRKAKEDKKRKK*
Ga0182187_10223312	3300015341	Miscanthus Phyllosphere	MDHPTLLLRDLAMRVANSAKGERLGKAKLDKKRKKQRKLWA*
Ga0182187_10612182	3300015341	Miscanthus Phyllosphere	MDHPAPLPRDSTMRVANLAKGEWLRKAKEDKKRKKQ*
Ga0182187_10897332	3300015341	Miscanthus Phyllosphere	MDHPTLLPRDSTMRATNRTEGERLRKAKEDKKRKRQ*
Ga0182187_11273712	3300015341	Miscanthus Phyllosphere	MDHLDLLPRDSSVRVVNRAKGERMRKAKDDKRRKR*
Ga0182187_11510361	3300015341	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKKRKKQWKLQVRE*
Ga0182187_11710161	3300015341	Miscanthus Phyllosphere	MDHPASLLRDSSVRVANHVEGEWLRKAKEDKRKKKQWKL*
Ga0182109_11259172	3300015342	Miscanthus Phyllosphere	MDHPALLPRDSSVRAANRAEGERLRKAEEDKRKKKQQKL*
Ga0182109_11479461	3300015342	Miscanthus Phyllosphere	MDHPALLPRDLAMRAANCAEGEWLRKAKEDKKRKK*
Ga0182109_12018422	3300015342	Miscanthus Phyllosphere	MDHPMPLLRDSSVRAVNRAKGEWLRKAKEDKMRKKQWKLRA*
Ga0182109_12031831	3300015342	Miscanthus Phyllosphere	MDHLAPLPRDSFMRVANHVEGKRLRKAKEDKKRKR
Ga0182109_12179531	3300015342	Miscanthus Phyllosphere	MDHPTPLPRVSSMRVVNHAEGEQLRMVKEDKKKKK*
Ga0182155_10533151	3300015343	Miscanthus Phyllosphere	MDHPAPLPRDSGVRVVNHIEGEWLSKAKEDKKRKKQWKL*
Ga0182155_10636591	3300015343	Miscanthus Phyllosphere	LTDHPMPLLRDSAMRTVNRAEGEWLRKAKEDRKRKK*
Ga0182155_11010532	3300015343	Miscanthus Phyllosphere	MDHPAPLPRDSVVRVANHAKGERLRKAKEDKKRKK*
Ga0182155_11043861	3300015343	Miscanthus Phyllosphere	MDHPVPLPRDSSMRAANHAKCEWLRKTKEDNKRKRQRKL*
Ga0182155_11355661	3300015343	Miscanthus Phyllosphere	MDHPAPLLRDSSMRAVNRAEGERLRKAKEDKKRKRQRKL*
Ga0182155_11571142	3300015343	Miscanthus Phyllosphere	MDHMTLLLRDLAMRVVNHAEGERLRKTKEDKKRKKQWKL*
Ga0182155_12051591	3300015343	Miscanthus Phyllosphere	MDHPVPLLRYSSVRVANHARGKQLRKAKEDKKRKKQW
Ga0182189_10888552	3300015344	Miscanthus Phyllosphere	MDHLAPLPRDSAVWAANHAQGERLRKVKEDKRKKKQWKL*
Ga0182189_11278822	3300015344	Miscanthus Phyllosphere	MDHPAPLPRDSAVRAANHAEGERLRKVKEDKKGKKQRKLQAWE*
Ga0182111_11172162	3300015345	Miscanthus Phyllosphere	MDHPMPLPRDSIVRTANHAEGEQLRKAKDDKKRKKQ*
Ga0182111_11433912	3300015345	Miscanthus Phyllosphere	MDHPAPLPRDSSVRAANHDEGERLRKAKEDKKRKRQRKL*
Ga0182111_11536551	3300015345	Miscanthus Phyllosphere	MDHLTPLPRDLAVRVVNHAEGERLRKVKEDEKRKK*
Ga0182111_12139121	3300015345	Miscanthus Phyllosphere	MDHPAPLLRDLAMRAGNRTEGERLRKANEDKRKKRWWKLLA*
Ga0182139_10160071	3300015346	Miscanthus Phyllosphere	MDHLAPLPRDSVMRAANHIEGEWLRKAKEDKKKKK*
Ga0182139_10751862	3300015346	Miscanthus Phyllosphere	MDHSALLPRDLAMRAMNRAEGERLRKAKEDKKRKKQ*
Ga0182139_10907961	3300015346	Miscanthus Phyllosphere	MDHLPPWLRDSSMRAVNRAEGERLRKAKEDKRKKKQWKL*
Ga0182139_11783701	3300015346	Miscanthus Phyllosphere	MDHPAPLLRDSSMRVVNCAEGERLRKVKEDKRKKKQWKL*
Ga0182139_11921311	3300015346	Miscanthus Phyllosphere	MDHPVLLPRDLAMRTVNHAEGKRLRKEKEDRKRKKQ*
Ga0182139_12423842	3300015346	Miscanthus Phyllosphere	MDHLALLPRDSSVRAANRAEGKRLRKAMEDKRKKRPQKL*
Ga0182177_10646072	3300015347	Miscanthus Phyllosphere	MDHPVSLPRDSTVRAANRAEGKRLRKAKEDKKRKKQ*
Ga0182177_10950832	3300015347	Miscanthus Phyllosphere	MDHPMPLLRDSAVRMANHAEDERPRKAKEDKNRKKQQKL*
Ga0182177_11702382	3300015347	Miscanthus Phyllosphere	MDHPTPLLRDSAVRMANRTEGERLRKAKEDKKRKKQQGLWAWE*
Ga0182177_12125581	3300015347	Miscanthus Phyllosphere	MDHPAPLPRDSSMRAANRAVCERLRKAEEDKRKKKQQKL*
Ga0182177_12128691	3300015347	Miscanthus Phyllosphere	MDHLAPLLRDSSIRAVNHIEGERLRKEKEDKRKKQQKLQT*
Ga0182177_12379362	3300015347	Miscanthus Phyllosphere	MDHPVPLSRDSTVRAANRAKGEQLRKAKEDKKRKL*
Ga0182177_12385642	3300015347	Miscanthus Phyllosphere	MDHLAPLPRDSTVRVVNHAEGERLRKVKEDEGKKRQRKL*
Ga0182177_12500252	3300015347	Miscanthus Phyllosphere	MDHPTPLSRDLVVRMANHAEGEWLRKVKEDKKRKK*
Ga0182161_11468291	3300015351	Miscanthus Phyllosphere	MDHSTPLLRDSSVRATNRAKGERLRKAKEDKKRKRQ*
Ga0182161_11928693	3300015351	Miscanthus Phyllosphere	MDHPAPLPRDSFVRAVNHAEGERLRKAKEDKKRKRQ*
Ga0182161_12374142	3300015351	Miscanthus Phyllosphere	MDHPTPLLRDSAMRAANHAEDERLRKVKEDKKKKR*
Ga0182159_10626433	3300015355	Miscanthus Phyllosphere	MDHLVPLPRDSTVRVANHAKGEQLRKAKEDNKTKKQRKLRARE*
Ga0182159_10649692	3300015355	Miscanthus Phyllosphere	MDHPVPLPRDSAVRTVNHTEGERLRKAKEDKKRKK*
Ga0182159_10800382	3300015355	Miscanthus Phyllosphere	MDHPAPLLRDSSMRVVNHAEGEWLRKAKEDKKRKR*
Ga0182159_11792921	3300015355	Miscanthus Phyllosphere	MDHLAPLLRDSAMRTVNHVKGEWLRKAKEDKKRKKQW*
Ga0182159_11990272	3300015355	Miscanthus Phyllosphere	MDHSALLLRDSAMRMVNHAMGERLRKAKEDRKRKKQ*
Ga0182145_10304251	3300015361	Miscanthus Phyllosphere	MDHPVPLPRDLSVRAANHAEGERLRKAKEDKGKKRQ*
Ga0182145_11637771	3300015361	Miscanthus Phyllosphere	MDHLAPLLRDSSMRAVNHAEGEWLRKAKEDKKRKRQ*
Ga0182145_11683031	3300015361	Miscanthus Phyllosphere	MDHPVPLPRDSSMRAANHAEGERLRKAKADKNRKRQRKLQARE*
Ga0182145_11879151	3300015361	Miscanthus Phyllosphere	MDHLAPLPRDSSVRVANHAEGEQLRKAKEDKKRKK*
Ga0182203_10500112	3300017404	Miscanthus Phyllosphere	MDHPALLPRDSVVREANRAEGEQLRKAKEDKKRKK
Ga0182203_11160642	3300017404	Miscanthus Phyllosphere	MDHPALLPRDSSMRAMNHVEGERLMKAKEDRRKKR
Ga0182203_11259541	3300017404	Miscanthus Phyllosphere	MDHPAPLPRDSAGRTVNRAEGKRLRKAKEDKERKKQ
Ga0182220_10720561	3300017407	Miscanthus Phyllosphere	MDHLAPLPRDPAVRMVNRAKGERLRKVKEDKKRKKH
Ga0182204_10303332	3300017409	Miscanthus Phyllosphere	MDHSAPLPRDSTVRMANRAEGERLRKVKEDKKRKKMWKLWS
Ga0182204_10564502	3300017409	Miscanthus Phyllosphere	MDHLVPLPRDSTVRVANHAKGEQLRKAKEDNKTKKQRKLRARE
Ga0182207_10321761	3300017410	Miscanthus Phyllosphere	MDHPVPLLRDSAMMMMNRVEGKRLRKAKEDKKSKKQWKL
Ga0182207_10387933	3300017410	Miscanthus Phyllosphere	MDHLMLLLRDSAMRAANHAEGERLRKAKEDKKKKKQ
Ga0182207_10985551	3300017410	Miscanthus Phyllosphere	DLILMDHPALLLRDSSMRVTNHAEGERLRKVKEDKRKKR
Ga0182207_11116732	3300017410	Miscanthus Phyllosphere	MDYTASLLRDSSMRVVNRAEGERLRKTKEDKKRKRQ
Ga0182207_11601692	3300017410	Miscanthus Phyllosphere	MDHPVPLPRDLAVRMANRAGGERLRKAKEDKKRKKQWKL
Ga0182207_11719681	3300017410	Miscanthus Phyllosphere	MDHPTPLSRDSTMRTANHAKGERLRKAKEDRKRKKQ
Ga0182208_10457221	3300017411	Miscanthus Phyllosphere	LMRDLIFMDHLAPLPRDSSMRALNHAKGERLRKAKEDKRKKKQ
Ga0182208_11062081	3300017411	Miscanthus Phyllosphere	MDHLAPLPRDSSMRVMNHAEGEQLRRAKEDKRKKK
Ga0182208_11283773	3300017411	Miscanthus Phyllosphere	MDHSAPLPRDSTVRAANHAEGEWLRKAKEDKKRKKQ
Ga0182222_10603591	3300017413	Miscanthus Phyllosphere	MDHPALLPRDLTVRTVNHADGERLRRVTEDKKRKKRWKL
Ga0182222_10682992	3300017413	Miscanthus Phyllosphere	MDHPAPLPRDSSVRATNHAEGERLRKAKEDKRRKRQ
Ga0182202_10251902	3300017415	Miscanthus Phyllosphere	MDHPALLLRDSSMRTANHVEGKRLRKAKEDKNRKKQWKL
Ga0182202_10287202	3300017415	Miscanthus Phyllosphere	MDHPALLPRDLAMRAANHAEGERSRNAKEDKKRKKQQKL
Ga0182202_10958152	3300017415	Miscanthus Phyllosphere	MDHPVPLLRDSSVMVANHVEGERLRKVKEDKRKKKQWKL
Ga0182228_10743042	3300017420	Miscanthus Phyllosphere	MDDPVLLPRDLAMRTANRAEGEQLRKTKEDKKRKK
Ga0182228_11309752	3300017420	Miscanthus Phyllosphere	MDHPAPLPRDSVMRAANRAEGERLRKAKEDKKRKK
Ga0182219_10328421	3300017424	Miscanthus Phyllosphere	MDHPAPLPRDSSMRVVNSTEGEWLRKAKEDQKRKW
Ga0182219_10507222	3300017424	Miscanthus Phyllosphere	MDHPVLLLRDSAMRTMNHAEGERLRKAKEDKKRKKQWKL
Ga0182219_10849481	3300017424	Miscanthus Phyllosphere	MDHPTPLPRDLFVRAANHDEGERLRKEKEDKRKNKQWKL
Ga0182219_11197301	3300017424	Miscanthus Phyllosphere	MDHPAPLLRDLAVRTANHLEGEQLRKAKDKKRKKE
Ga0182224_10330561	3300017425	Miscanthus Phyllosphere	RDLILMDHPMPLPRDSTMRTANHTEGELLRKAKEDKKRKK
Ga0182224_10523421	3300017425	Miscanthus Phyllosphere	MDHLALLPRDSAMRTVNHAKGERLRKAKEDKRKKRQ
Ga0182224_10639562	3300017425	Miscanthus Phyllosphere	MDHPASLPRDSAVRTANHAEGEWLRKAKEDKKRKKQWKL
Ga0182224_10841601	3300017425	Miscanthus Phyllosphere	MDHPVSLPRDSSMRATNCAEGERLRKAKGDKKRKKQQNL
Ga0182224_10919841	3300017425	Miscanthus Phyllosphere	MDHPTLLPRDSFVRAANHAEGEWLRKAKEDKRKKKQPKLQARE
Ga0182224_11255512	3300017425	Miscanthus Phyllosphere	MDHPTPLPRDSAVRVANRVKGERLRKAEVDKKRKKQ
Ga0182190_10550352	3300017427	Miscanthus Phyllosphere	MDHLAPLPRDSTVRTANRTEGERLRKAKEDKKRKKQ
Ga0182190_11113642	3300017427	Miscanthus Phyllosphere	MDHPTLLLRDSVMRMMNHAKGERLRKAKEDKKRKK
Ga0182190_11375272	3300017427	Miscanthus Phyllosphere	MDHSAPLPRESAMRAANRVEGERLSKAKENKKRKKQ
Ga0182192_11506081	3300017430	Miscanthus Phyllosphere	MDLILMDHSAPLSRDLAVRMANRAEGEQLRKAKEDQKRKKQ
Ga0182192_11743702	3300017430	Miscanthus Phyllosphere	MDHLTPLLRDSTMRAVNRAEGERLRKAKEDKKRKK
Ga0182206_10946571	3300017433	Miscanthus Phyllosphere	MDHLAPLPRDSSVRAVNHAEGEQLRKAKEDKKRKRQRKL
Ga0182206_11378621	3300017433	Miscanthus Phyllosphere	MDHLAPLPRDSAVRMANRTEGERLRKAKEDKKRKKQWKLQAWGMRGGH
Ga0182209_11678472	3300017436	Miscanthus Phyllosphere	MDHPAPLLRDSAMRTANHAEGEWPMKAKEDKRRKRQRKL
Ga0182191_10785672	3300017438	Miscanthus Phyllosphere	MDHLALLPRDSAMRTANGIEGEQLRKAKEDKERKK
Ga0182221_10878242	3300017442	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNHIEGEMLRKAKEDEERKKQRKL
Ga0182221_11185012	3300017442	Miscanthus Phyllosphere	MDHPMPLLRDSAVRVVNRAEGERLRKAKEDKKRKK
Ga0182221_11421763	3300017442	Miscanthus Phyllosphere	DHPALLPRDSSMRAANRTKGEQLRKAKEDKRKKRQ
Ga0182193_11354552	3300017443	Miscanthus Phyllosphere	MDHLASLPRDSAVRTVNRAEGEWLRKAREDKKRKKQLKL
Ga0182193_11746262	3300017443	Miscanthus Phyllosphere	MDHLAPLLRDSSMRVAIRTEGERLRKEKEDNRRKR
Ga0182193_11853241	3300017443	Miscanthus Phyllosphere	MDHPAPLLRDSTVRTVNRAKGEWLRKVNEDRKRKK
Ga0182233_10938432	3300017680	Miscanthus Phyllosphere	MDHPAPLPRDSAMRAVNRAEGEWLRKAKEDKKRKKQWKLQARE
Ga0182218_10697512	3300017683	Miscanthus Phyllosphere	MDHLAPLPREPSGREANHAKAEQLRKAKEDKKRKK
Ga0182218_11449622	3300017683	Miscanthus Phyllosphere	MDHPAPLLRDSSMRVVNHAEGEWLRKAKEDKKRKR
Ga0182225_10841891	3300017684	Miscanthus Phyllosphere	TDQPMPLPWDLAVRTMNHAEDERLRRAKEDKKRKKQQKLQAWE
Ga0182225_11178961	3300017684	Miscanthus Phyllosphere	LMDHLAPLPRDSSMRTVNHAEGERMRKAKEDKRKKQQQKL
Ga0182227_10615321	3300017685	Miscanthus Phyllosphere	MDHPTPLPRYSAVRTANRAEGERLSKAKKDMKRKRQ
Ga0182227_11245931	3300017685	Miscanthus Phyllosphere	MDHLAPLLRDSSVRAANRAKGERLRKVKEDKRRKRQQKLQVHE
Ga0182205_10800131	3300017686	Miscanthus Phyllosphere	LMDHPTPLSRDSTMRTANHAKGERLRKAKEDRKRKK
Ga0182205_11256241	3300017686	Miscanthus Phyllosphere	MDHPALLLRDSSVRVANHVEGERLRKTKEDKKRKRQ
Ga0182205_11551711	3300017686	Miscanthus Phyllosphere	MDLILMDHPAPLLRDSSMRAVNHAKGEQLWKAKEDKRNKR
Ga0182223_10168531	3300017690	Miscanthus Phyllosphere	MDHLTPLLRDSAMRAANHAEGERLRKAKEDKKAKK
Ga0182223_10689161	3300017690	Miscanthus Phyllosphere	PRDLIFTDHPTLLPRDSSVRVANCAEGEWLRQVKEDKKRKRQRKL
Ga0182223_10745721	3300017690	Miscanthus Phyllosphere	MDHPTPLSRDSAVRVANRAKGERLRKAMEDKKRKRRRKL