NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027641

Metagenome / Metatranscriptome Family F027641

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027641
Family Type Metagenome / Metatranscriptome
Number of Sequences 194
Average Sequence Length 167 residues
Representative Sequence CRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISEVEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS
Number of Associated Samples 172
Number of Associated Scaffolds 194

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.03 %
% of genes near scaffold ends (potentially truncated) 97.42 %
% of genes from short scaffolds (< 2000 bps) 89.18 %
Associated GOLD sequencing projects 157
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(17.526 % of family members)
Environment Ontology (ENVO) Unclassified
(26.289 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.175 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 69.89%    β-sheet: 0.00%    Coil/Unstructured: 30.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 194 Family Scaffolds
PF12911OppC_N 0.52
PF12974Phosphonate-bd 0.52
PF00092VWA 0.52
PF00361Proton_antipo_M 0.52
PF07452CHRD 0.52
PF00857Isochorismatase 0.52
PF12833HTH_18 0.52
PF05721PhyH 0.52
PF00144Beta-lactamase 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 194 Family Scaffolds
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.52
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.52
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.52
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.52
COG2367Beta-lactamase class ADefense mechanisms [V] 0.52
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886013|SwBSRL2_contig_9853828All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium863Open in IMG/M
2228664022|INPgaii200_c1040356All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium618Open in IMG/M
3300000787|JGI11643J11755_11268790All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300000890|JGI11643J12802_11590247All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1235Open in IMG/M
3300000956|JGI10216J12902_124835513All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium852Open in IMG/M
3300002562|JGI25382J37095_10143990All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium785Open in IMG/M
3300002912|JGI25386J43895_10140994All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium599Open in IMG/M
3300003267|soilL1_10043086All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium5927Open in IMG/M
3300003324|soilH2_10274169All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1854Open in IMG/M
3300004157|Ga0062590_100378496All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1148Open in IMG/M
3300004157|Ga0062590_100957860All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium808Open in IMG/M
3300004281|Ga0066397_10153834All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium528Open in IMG/M
3300004463|Ga0063356_105429242All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium547Open in IMG/M
3300004643|Ga0062591_100825375All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium859Open in IMG/M
3300004643|Ga0062591_101445371All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium684Open in IMG/M
3300005167|Ga0066672_10025377All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3166Open in IMG/M
3300005171|Ga0066677_10195333All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1130Open in IMG/M
3300005174|Ga0066680_10941752All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium509Open in IMG/M
3300005177|Ga0066690_10591501All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium741Open in IMG/M
3300005177|Ga0066690_10843794All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300005178|Ga0066688_10233080All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1175Open in IMG/M
3300005178|Ga0066688_10583526All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium718Open in IMG/M
3300005186|Ga0066676_11122529All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300005187|Ga0066675_10190421All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1435Open in IMG/M
3300005289|Ga0065704_10172758All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1282Open in IMG/M
3300005289|Ga0065704_10300519All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium886Open in IMG/M
3300005294|Ga0065705_10276874All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1115Open in IMG/M
3300005332|Ga0066388_100760683All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1567Open in IMG/M
3300005343|Ga0070687_100583861All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium765Open in IMG/M
3300005347|Ga0070668_100735260All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium872Open in IMG/M
3300005353|Ga0070669_101309670All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium627Open in IMG/M
3300005367|Ga0070667_102337461All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium503Open in IMG/M
3300005440|Ga0070705_100523738All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium904Open in IMG/M
3300005445|Ga0070708_100798038All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium887Open in IMG/M
3300005447|Ga0066689_10223542All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1150Open in IMG/M
3300005447|Ga0066689_10876493All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300005454|Ga0066687_10144946All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1250Open in IMG/M
3300005459|Ga0068867_101196768All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium698Open in IMG/M
3300005518|Ga0070699_100683275All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium937Open in IMG/M
3300005518|Ga0070699_100791746All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium868Open in IMG/M
3300005529|Ga0070741_10048924All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium5186Open in IMG/M
3300005540|Ga0066697_10632378All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300005546|Ga0070696_100393179All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1083Open in IMG/M
3300005546|Ga0070696_100401549All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1072Open in IMG/M
3300005549|Ga0070704_100586125All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium978Open in IMG/M
3300005552|Ga0066701_10365434All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium893Open in IMG/M
3300005554|Ga0066661_10230721All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1147Open in IMG/M
3300005554|Ga0066661_10357797All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium893Open in IMG/M
3300005555|Ga0066692_10091541All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1787Open in IMG/M
3300005558|Ga0066698_10646765All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium706Open in IMG/M
3300005713|Ga0066905_100353052All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1176Open in IMG/M
3300005718|Ga0068866_10646896All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium719Open in IMG/M
3300005718|Ga0068866_11047832All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium582Open in IMG/M
3300005719|Ga0068861_100715893All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium932Open in IMG/M
3300005764|Ga0066903_107047405All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium583Open in IMG/M
3300006169|Ga0082029_1758551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1814Open in IMG/M
3300006173|Ga0070716_100929291All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium683Open in IMG/M
3300006755|Ga0079222_10534853All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium871Open in IMG/M
3300006800|Ga0066660_10047892All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2770Open in IMG/M
3300006800|Ga0066660_10301433All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1279Open in IMG/M
3300006844|Ga0075428_100326009All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1650Open in IMG/M
3300006846|Ga0075430_100076489All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2806Open in IMG/M
3300006847|Ga0075431_100124778All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2657Open in IMG/M
3300006853|Ga0075420_100110881All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2419Open in IMG/M
3300006854|Ga0075425_102800427All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium536Open in IMG/M
3300006871|Ga0075434_100033730All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium5053Open in IMG/M
3300006903|Ga0075426_10846035All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium689Open in IMG/M
3300006904|Ga0075424_101425842All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium735Open in IMG/M
3300006904|Ga0075424_102714221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300006914|Ga0075436_100732206All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium734Open in IMG/M
3300007004|Ga0079218_13733882All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300007076|Ga0075435_100382505All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1209Open in IMG/M
3300007255|Ga0099791_10268871All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium810Open in IMG/M
3300009147|Ga0114129_12531834All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium613Open in IMG/M
3300009176|Ga0105242_11553957All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium694Open in IMG/M
3300009177|Ga0105248_11238121All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium844Open in IMG/M
3300009812|Ga0105067_1079552All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300009814|Ga0105082_1024879All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium926Open in IMG/M
3300009819|Ga0105087_1017987All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium999Open in IMG/M
3300009820|Ga0105085_1073526All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300009822|Ga0105066_1169050All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300010047|Ga0126382_12317882All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300010360|Ga0126372_12103650All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium612Open in IMG/M
3300010361|Ga0126378_11119426All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium888Open in IMG/M
3300010362|Ga0126377_10404950All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1376Open in IMG/M
3300010375|Ga0105239_11235682All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium861Open in IMG/M
3300010376|Ga0126381_100715031All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1433Open in IMG/M
3300010398|Ga0126383_11784459All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium704Open in IMG/M
3300010403|Ga0134123_10824497All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium924Open in IMG/M
3300012199|Ga0137383_11105393All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium574Open in IMG/M
3300012206|Ga0137380_10112130All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2493Open in IMG/M
3300012285|Ga0137370_10909790All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300012356|Ga0137371_10491125All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium948Open in IMG/M
3300012357|Ga0137384_10103303All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2379Open in IMG/M
3300012923|Ga0137359_10648681All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium923Open in IMG/M
3300012923|Ga0137359_11644726All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium530Open in IMG/M
3300012960|Ga0164301_11174703All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium615Open in IMG/M
3300012971|Ga0126369_10465201All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1316Open in IMG/M
3300012986|Ga0164304_11804790All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium512Open in IMG/M
3300012989|Ga0164305_11871982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium ciceri544Open in IMG/M
3300013306|Ga0163162_11462743All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium778Open in IMG/M
3300013306|Ga0163162_11998722All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium664Open in IMG/M
3300014154|Ga0134075_10045568All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1805Open in IMG/M
3300014326|Ga0157380_11422724All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium744Open in IMG/M
3300015052|Ga0137411_1138999All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1215Open in IMG/M
3300015372|Ga0132256_101030821All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium938Open in IMG/M
3300015372|Ga0132256_102330957All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium638Open in IMG/M
3300015373|Ga0132257_101663613All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium818Open in IMG/M
3300016294|Ga0182041_10736050All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium877Open in IMG/M
3300017656|Ga0134112_10404061All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium565Open in IMG/M
3300017966|Ga0187776_10144155All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1459Open in IMG/M
3300018052|Ga0184638_1001898All Organisms → cellular organisms → Bacteria6354Open in IMG/M
3300018060|Ga0187765_10264016All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1019Open in IMG/M
3300018064|Ga0187773_11209390All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300018431|Ga0066655_10848459All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium622Open in IMG/M
3300025899|Ga0207642_10483694All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium755Open in IMG/M
3300025899|Ga0207642_10539835All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium719Open in IMG/M
3300025918|Ga0207662_11051557All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium578Open in IMG/M
3300025923|Ga0207681_10943816All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium723Open in IMG/M
3300025933|Ga0207706_10037799All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium4285Open in IMG/M
3300025934|Ga0207686_10716925All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium796Open in IMG/M
3300025937|Ga0207669_11418776All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300025961|Ga0207712_11531319All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium597Open in IMG/M
3300025972|Ga0207668_10843887All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium813Open in IMG/M
3300025972|Ga0207668_11639095All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium581Open in IMG/M
3300025986|Ga0207658_11708547All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium575Open in IMG/M
3300026035|Ga0207703_11988844All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium557Open in IMG/M
3300026075|Ga0207708_10697950All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium867Open in IMG/M
3300026326|Ga0209801_1375471All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium501Open in IMG/M
3300026334|Ga0209377_1164233All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium819Open in IMG/M
3300026342|Ga0209057_1247168All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300026475|Ga0257147_1050666All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium620Open in IMG/M
3300026524|Ga0209690_1092972All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1249Open in IMG/M
3300026532|Ga0209160_1001020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria23319Open in IMG/M
3300026537|Ga0209157_1002115All Organisms → cellular organisms → Bacteria16005Open in IMG/M
3300026537|Ga0209157_1341874All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium540Open in IMG/M
3300026540|Ga0209376_1264504All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium724Open in IMG/M
3300026542|Ga0209805_1002221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium11349Open in IMG/M
3300026547|Ga0209156_10276729All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium766Open in IMG/M
3300026552|Ga0209577_10252882All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1329Open in IMG/M
3300027013|Ga0209884_1005650All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1119Open in IMG/M
3300027068|Ga0209898_1001765All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2342Open in IMG/M
3300027324|Ga0209845_1033155All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium829Open in IMG/M
3300027490|Ga0209899_1072336All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium687Open in IMG/M
3300027543|Ga0209999_1087505All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium603Open in IMG/M
3300027577|Ga0209874_1087119All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium758Open in IMG/M
3300027654|Ga0209799_1153056All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium525Open in IMG/M
3300027880|Ga0209481_10025996All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2621Open in IMG/M
3300027903|Ga0209488_10962955All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300027950|Ga0209885_1037221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium551Open in IMG/M
3300028592|Ga0247822_11554907All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium560Open in IMG/M
3300028792|Ga0307504_10350177All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium569Open in IMG/M
3300028809|Ga0247824_11067093All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
(restricted) 3300031150|Ga0255311_1039315All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium991Open in IMG/M
3300031184|Ga0307499_10286034All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium538Open in IMG/M
3300031198|Ga0307500_10116896All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium732Open in IMG/M
3300031455|Ga0307505_10296058All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium758Open in IMG/M
3300031548|Ga0307408_101552772All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium627Open in IMG/M
3300031561|Ga0318528_10371377All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium768Open in IMG/M
3300031573|Ga0310915_10815699All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium656Open in IMG/M
3300031668|Ga0318542_10018340All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2827Open in IMG/M
3300031720|Ga0307469_10455913All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1108Open in IMG/M
3300031720|Ga0307469_10597911All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium985Open in IMG/M
3300031720|Ga0307469_11750725All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium600Open in IMG/M
3300031744|Ga0306918_11237494All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium575Open in IMG/M
3300031747|Ga0318502_10135301All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1395Open in IMG/M
3300031769|Ga0318526_10309454All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium646Open in IMG/M
3300031778|Ga0318498_10279099All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium751Open in IMG/M
3300031781|Ga0318547_10579228All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium696Open in IMG/M
3300031820|Ga0307473_10448005All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium859Open in IMG/M
3300031832|Ga0318499_10162733All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium870Open in IMG/M
3300031833|Ga0310917_10331645All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1031Open in IMG/M
3300031847|Ga0310907_10113156All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1192Open in IMG/M
3300031852|Ga0307410_10274679All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1320Open in IMG/M
3300031852|Ga0307410_11207994All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium659Open in IMG/M
3300031858|Ga0310892_10103075All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1566Open in IMG/M
3300031894|Ga0318522_10063998All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1320Open in IMG/M
3300031912|Ga0306921_10141985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2805Open in IMG/M
3300031941|Ga0310912_10506148All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium941Open in IMG/M
3300032004|Ga0307414_11853169All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium563Open in IMG/M
3300032005|Ga0307411_11102459All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium715Open in IMG/M
3300032025|Ga0318507_10025478All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2151Open in IMG/M
3300032043|Ga0318556_10016746All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3203Open in IMG/M
3300032052|Ga0318506_10448674All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium572Open in IMG/M
3300032055|Ga0318575_10531870All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium597Open in IMG/M
3300032126|Ga0307415_102495397All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium509Open in IMG/M
3300032174|Ga0307470_11364348All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium583Open in IMG/M
3300032180|Ga0307471_102324964All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium676Open in IMG/M
3300032180|Ga0307471_102598502All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium641Open in IMG/M
3300032205|Ga0307472_100291575All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1306Open in IMG/M
3300032421|Ga0310812_10394187All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium622Open in IMG/M
3300033289|Ga0310914_10313395All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1416Open in IMG/M
3300034676|Ga0314801_200961All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium510Open in IMG/M
3300034818|Ga0373950_0026996All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1045Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil17.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.70%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand5.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.12%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.06%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.03%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.03%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.03%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.03%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.03%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.03%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.52%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.52%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.52%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009819Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027013Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027068Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027490Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027950Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SwBSRL2_0112.000026402162886013Switchgrass RhizosphereGYGELDRELIARRTSYEAAKAEYCRLVDQVFDRLLQEQARLLSDVKSNIEYYQQLVSRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLIKPPEAISESEERLSQSYESAVKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVK
INPgaii200_104035622228664022SoilYGELDRELNARRTSSEAAKVDYCRRVDQVFERILQEQARLLSDVXSNIEXYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEALSESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRR
JGI11643J11755_1126879023300000787SoilVDQVFDRLLQEQARLLSDVKSNIEYYQQLVSRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLIKPPEAISESEERLSQSYESAVKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
JGI11643J12802_1159024723300000890SoilLIARRTSYEAAKAEYCRLVDQVFDRLLQEQARLLSDVKSNIEYYQQLVSRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLIKPPEAISESEERLSQSYESAVKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
JGI10216J12902_12483551313300000956SoilRELRRRRATYEAAKVAYCRVVDHVFDRTLQEQAHLLSEVKSNLEYYQQLVSKSEDERRAFARDAAELHDACNIVLKRYRQTNLRVRVSPAPTYFNDGIDFEPYLIRAPAGISENEQRLSRSYESAMKDFSDLARQNNATVQGLRTAEIRRRDYYFSKLERDIREKLAREEWEAKS*
JGI25382J37095_1014399023300002562Grasslands SoilPIGFEDVFSWILVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDAXNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISESEERLSRSYESAVKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
JGI25386J43895_1014099413300002912Grasslands SoilRAARLAWQRFARNPVGFEDVFSWILVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISEVEERLSRSYESAMKDFSDIARQNDATVQNLRT
soilL1_1004308683300003267Sugarcane Root And Bulk SoilPGYGELDRELKRRRAMYEAAKAEYCAEIDRVFEKTLKEQAHLLSDVKSNIEYYQQLASRTDEQRRTFIREAAEIQDACNVVLKGYRQTNLRVRVSPAPVYFNDVVVFDDRLVKPPAGMSETEEWLSRSYENAMKEFSDLARQNDTTVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEAKS*
soilH2_1027416923300003324Sugarcane Root And Bulk SoilSNIEYYQQLASRTDEQRRTFIREAAEIQDACNVVLKGYRQTNLRVRVSPAPVYFNDVVVFDDRLVKPPAGMSETEEWLSRSYENAMKEFSDLARQNDTTVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEAKS*
Ga0062590_10037849623300004157SoilYEGRKAEYCRLIDQVFDGIVHEQARLFSDVKANIEYYQELVGKSDDERRAFAHETAELQDACNILLKGYREANARARKSAAPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLEREVRERLVREAWEIKS*
Ga0062590_10095786023300004157SoilPGYGELDRELKRRRAIYEASKVEYCRLVDQVFDRTLQEQAHLLSEVKSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNLRVRVSPAPAYFNDTITFGFQLVKPPAGVSESEEWLARSYENAMKEFSDIARQNDATVQTLRTSEIRRRDYYLSKLERDIKEKLVREEYEVKS*
Ga0066397_1015383413300004281Tropical Forest SoilRILDEQARLLTDVKANIEYYQQLVGKSDDERRAFVHEAAEIQDACNILLKRYRQANARARTSPAPFYFNNSVAFEGSLVGPPEAISEDEARLSRSYESAIKDFSDIARQNDATVQNLRTAEIRRREYYFSKLERDIRERLIREAWETKS*
Ga0063356_10542924213300004463Arabidopsis Thaliana RhizosphereVKANIEYYQELVGKSDDERRAFAHETAELQDACNILLKGYREANARARKSAAPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLEREVRERLVREAWEIKS*
Ga0062591_10082537513300004643SoilEQAHLLADVKSNIEYYQQLASRTDEQRRAFIREAAEIQDACNVVVKGYRQTNLRVRVSPAPTYFNDVVVFDDRLVKPPAGMSETEEWLSRSYENAMKEFSDLARQNDTTVQNLRTAEIRRRDYYFAKLERDIREKLVREEWETKS*
Ga0062591_10144537113300004643SoilARNPVGFDDVFSWILVVLAVIFGIFASYKGYRLDDAYPGYGELDRELNARRTSSEAAKVDYCRRVDQVFERILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0066672_1002537733300005167SoilGFEDVFSWILVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0066677_1019533313300005171SoilYEVAKVGYCRVVDHVFDRTLQEQAHLLSEVKSNLEYYQQLVSKTEDDRRAFARDAAELHDACNIVLKRYRQTNQRVRVSPAPTYFNDGIDFEPYLVRPPAGISENEQRLSRSYESAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0066680_1094175213300005174SoilYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARARQSPAPFYFNNSFTFDGHLVRPPEAISESEERLSRSYESAVKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERD
Ga0066690_1059150123300005177SoilDRELNARRARYEAVKAEYCRLVDQVFDRILDEQAHLLSDVKANIEYYEQLISRSDDQRRTFVHEVAEIQDACNILLKRYRQTNARVRVSPAPYYFGNSFTFEGHLVRPPDAISEDEERLSRSYESAMKDFSEIARQNDATVQNLRTAEIRRRDYHFNKLERDVRERLIREAWEIKS*
Ga0066690_1084379413300005177SoilLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISEVEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS*
Ga0066688_1023308013300005178SoilYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0066688_1058352623300005178SoilYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISEVEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS*
Ga0066676_1112252913300005186SoilRILQEQARLLSDVKSNIEYYQQLISRGVDERRTFVHDAAEIQDACNIVLKRYRQTNARMRQSPTPFYFNNSFTFEGHLVTSPEAISESEERLSRSYESAVKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0066675_1019042123300005187SoilTYEAAKVGYCRVVDHVFDRTLQEQAHLLSEVKSNLEYYQQLVSKTEDDRRAFARDAAELHDACNIVLKRYRQTNQRVRVSPAPTYFNDGIDFEPYLVRPPAGISENEQRLSRSYESAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0065704_1017275813300005289Switchgrass RhizosphereSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNLRIRVSPAPSYFNDTITFGFQLVKPPPGVPESEEWLARSYESAMKEFSDIARQNDATVQTLRTAEIRRRDYYLGKLEKDIREKLVREEWEAKS*
Ga0065704_1030051913300005289Switchgrass RhizosphereAYPGYGELDRELIARRTSYEAAKAEYCRLVDQVFDRLLQEQARLLSDVKSNIEYYQQLVSRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLIKPPEAISESEERLSQSYESAVKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0065705_1027687413300005294Switchgrass RhizosphereRAIYEAAKSEYCRLVDQVFDRTLQEQAHLLSEVKSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNLRIRVSPAPSYFNDTITFGFQLVKPPPGVPESEEWLARSYESAMKEFSDIARQNDATVQTLRTAEIRRRDYYLGKLEKDIREKLVREEWEAKS*
Ga0066388_10076068313300005332Tropical Forest SoilDRELKRRQAIYEAAKAEYCRVVDQMFDRALQEQARLLSDVKSNIEYYQQLVSRSDDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSENEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0070687_10058386123300005343Switchgrass RhizosphereDRELNARRALYEGQKAEYCRLVDQVFDRILAEQVRLFSDVKANIEHYQELVSQSDDERRVFVHEVAEMQDACNILLKRYRQTNARARTSPAPYYFQHSFAFDAHAMRPPDGISEDELRLSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS*
Ga0070668_10073526013300005347Switchgrass RhizosphereELNARRASSEAAKVEYCRLVDQVFDRILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0070669_10130967023300005353Switchgrass RhizosphereVFERILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNSRVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0070667_10233746113300005367Switchgrass RhizosphereRVVDLMFDRALQEQARLLSDVKSNIEYYQQLVSRSDDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0070705_10052373823300005440Corn, Switchgrass And Miscanthus RhizosphereIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0070708_10079803813300005445Corn, Switchgrass And Miscanthus RhizosphereYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNGFTFDGHLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0066689_1022354223300005447SoilYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARARQSPAPFYFNNSFTFDGHLVRPPEAISESEERLSRSYESAVKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0066689_1087649313300005447SoilLQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0066687_1014494613300005454SoilNLEYYQQLVSKTEDDRRAFARDAAELHDACNIVLKRYRQTNQRVRVSPAPTYFNDGIDFEPYLVRPPAGISENEQRLSRSYESAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0068867_10119676813300005459Miscanthus RhizosphereYCRLIDQVFDRIVHEQARLFSDVKANIEYYQELVGKSDDERRAFAHETAELQDACNVLLKRYREANARARISPTPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLDREVRERLVREAWEIKS*
Ga0070699_10068327523300005518Corn, Switchgrass And Miscanthus RhizosphereVFSWILVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNGFTFDGHLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0070699_10079174623300005518Corn, Switchgrass And Miscanthus RhizosphereLLSDVKSNIEYYQQLISRSDDQRRIFVHDADEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNRFTFDDQLIRPPEAFSESDERLSRSYENAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS*
Ga0070741_1004892413300005529Surface SoilPYPGYGELDREWKRRRAMYEAAKTEYCRLADQVFDRTLQEQAHLLAEVKSNVEYYQQLSSRTEDQRRTFVRDAAELQDACNIVLKGYRQTNARVRASAPPAYFADSMTFGFSLVKPPAGVSESEEWLARSYDSAMKEFSEIARQNDATVQGLRTADIRRRDYYFAKLERDVREKLAREDWEVKS*
Ga0066697_1063237813300005540SoilLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0070696_10039317923300005546Corn, Switchgrass And Miscanthus RhizosphereEQARLLSDVKSNIEYYQQLVSRSDDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0070696_10040154923300005546Corn, Switchgrass And Miscanthus RhizospherePGYGELDRELNARRAFYEGRKAEYCRLIDQVFDHIVEEQARLFADVKANIEYYQQLVGKSDDERRAFAHETAELQDACNVLLKRYREANARARTSPTPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLDREVRERLVREAWEIKS*
Ga0070704_10058612513300005549Corn, Switchgrass And Miscanthus RhizosphereAFYEGRKAEYCRLIDQVFDHIVEEQARLFADVKANIEYYQQLVGKSDDERRAFAHETAELQDACNVLLKRYREANARARTSPTPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLDREVRERLVREAWEIKS*
Ga0066701_1036543413300005552SoilYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS*
Ga0066661_1023072113300005554SoilDYCRRIDRVFDRILEEQAQLLSDVKANIEYYQQLVSRSDDQRRTFVHEGAEIQDACNILLKRYRQTNARVRVSPAPYYFNNGFAFDAHLTRPPEAISEDEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEIKS*
Ga0066661_1035779713300005554SoilPGYGELDRELNARRTSYEAAKADYCRLVDQVFDRVLQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0066692_1009154133300005555SoilLLSDVKSNIEYYQQLISRSDDQRRTFVHDADEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNRFTFDGQLIRPPEAFSESDERLSRSYENAMKDFSDVARQNDATVQNLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS*
Ga0066698_1064676513300005558SoilVFSWILVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISEGEERLSRSYESAMKDFSDIARQNDATVQNLRTTEIRRRDYYFNKLERDVREKLIREAWEVKS*
Ga0066905_10035305213300005713Tropical Forest SoilKAEYCRLVDQVFDRTLQEQAHLLSEAKSNIEYYQQLLSNTDEQRRAFAREAAELQDACNVVLKGYRQTNVRARTSPPPPYFSQNVSFDGYLVRPPAGVADSEERLSRSYESAMKDFSDLAQKNNATAQNLRTVEIRRRDFYFTKLEKDIREKLSREEWELKG*
Ga0068866_1064689623300005718Miscanthus RhizosphereASYKGYRLDDAYPGYGELDRELNARRASSEAAKVEYCRLVDQVFDRILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0068866_1104783223300005718Miscanthus RhizosphereILDEQARLFADVKANIEHYQELVSQSDDERRVFVHEVAEMQDACNILLKRYRQTNARARTSPAPYYFQHSFAFDTHALRPPDAISEDELRLSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS*
Ga0068861_10071589323300005719Switchgrass RhizosphereYPGYGELDRELNARRAFYEGRKAEYCRLIDQVFDRIVHDQARLFSDVKANIEYYQELVGKSDDERRAFAHETAELQDACNILLKGYREANARARKSAAPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLEREVRERLVREAWEIKS*
Ga0066903_10704740513300005764Tropical Forest SoilAEYEAAKAEYCRLVDQVFDRTLQEQAHLLSEVKSNIDYYQQLISNTEEQRRTFAREAAELQDACNVVLKGYRQANVRARKSPAPPYFNESVSFESYLVRPPAGASESEERLSRFYESAMKNFSDIARQNNATVQNLRTAEIRRRDFYFNKLERDIREKLSREEWELKG*
Ga0082029_175855113300006169Termite NestYCRLIDQVFDRILDQQARLLADVKAHIEHYQELVSKSDDERRAFMHEVAELQDACNILLKRYRHTNARTRTSPTPHYFQNSFAFDGDVVRRPATISEDEQRRSGSYESAMKDFSDIARQNDATVQSLRTGEIRRRDFYFTKLERDVRERLVREAWEIKS*
Ga0070716_10092929113300006173Corn, Switchgrass And Miscanthus RhizosphereVDDAYPGYGELDRELKARRAVYEAAKAEYCRLVDQVFDRTLQEQAHLLSDVKSNIEYYQQLLSNTDEQRRTFAREAAELQDACNVVLKGYRQANVRARRSPAPFYFNESVSFESYLIRPPAGASESEERLARFYDSAMKNFSDIARQNNATAQNLRTAEIRRRDFYFNKLEREIREKLSREEWELKG*
Ga0079222_1053485313300006755Agricultural SoilRVDRVFDRILEEQAQLLSDVKSNIDVYQQLVSRSSDQRRTFMNEAAEIQDACNILLKRYRQTNARARNSPAPFYFNNSFAFDGHLVKAPEAISESEERLSRSYESAMKDFSDIARQNDVTVHTLRTAEIRRRDYYFNKLDRDVREKLIREAWEVKS*
Ga0066660_1004789233300006800SoilGFEDVFSWILVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKADYCRLVDQVFDRVLQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0066660_1030143313300006800SoilELKRRRATYEVAKVGYCRVVDHVFDRTLQEQAHLLSEVKSNLEYYQQLVSKTEDDRRAFARDAAELHDACNIVLKRYRQTNQRVRVSPAPTYFNDGIDFEPYLVRPPAGISENEQRLSRSYESAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS*
Ga0075428_10032600913300006844Populus RhizosphereVDQVFDRTLHEQAHLLSEVKSNIEYYQQLSGRTEDQRRTFIRDAAELQDACNIVLKGYRQTNARVRPSATPSYFNDTINFTFQLVKPPAGIGESEEWLARSYENAMKEFSEIARQNDATLQSLRTEVIRRRDYYFTKLEKDIREKLVREDWEAKS*
Ga0075430_10007648913300006846Populus RhizosphereQVFDRTLHEQAHLLSEVKSNIEYYQQLSGRTEDQRRTFIRDAAELQDACNIVLKGYRQTNARVRPSATPSYFNDTINFTFQLVKPPAGIGESEEWLARSYENAMKEFSEIARQNDATLQSLRTEVIRRRDYYFTKLEKDIREKLVREDWEAKS*
Ga0075431_10012477833300006847Populus RhizosphereRLLQEQARLLSDVKSNIEYYQQLVSRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLIKPPEAISESEERLSQSYESAVKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0075420_10011088133300006853Populus RhizosphereRELKRQRAAYETAKTQYCRLVDQVFDRTLHEQAHLLSEVKSNIEYYQQLSGRTEDQRRTFIRDAAELQDACNIVLKGYRQTNARVRPSATPSYFNDTINFTFQLVKPPAGIGESEEWLARSYENAMKEFSEIARQNDATLQSLRTEVIRRRDYYFTKLEKDIREKLVREDWEAKS*
Ga0075425_10280042713300006854Populus RhizosphereEYCRVVDQMFDRALQEQARLLSDVKSNIEYYQQLVSRSDDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0075434_10003373013300006871Populus RhizosphereIDQVFDRIVDEQARLFSDVKANIEYYQQLVGKSDDERRAFAHETAELQDACNVLLKRYREANARARTSPTPYYFKDSFAFDGDLMRPPEAISADEARLLAFYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLEREVRERLVREAWEIKS*
Ga0075426_1084603513300006903Populus RhizospherePYPGYGELDRELNAKRASYEAAKVDYCRRVDRVFDRILEEQAQLLSDVKSNIDVYQQLVSRSSDQRRTFMHEAAEIQDACNILLKRYRQTNARARNSPAPFYFNNNYAFDVHLVKPPEAVSESEERLSRSYESAMKDFSDIARQNDVTVHNLRTAEIRRRDYHFNKLDRDVREKLIREAWEVKS*
Ga0075424_10142584213300006904Populus RhizosphereLSDVKSNIEYYQQLVSRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLIKPPEAISESEERLSQSYESAVKDFSDIARQNDATLQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0075424_10271422113300006904Populus RhizosphereLSEVKSNIEYYQQLIANTDEQRRTFTREAAELQDACNIVLKGYRQANVRARTSPPPRYFNDSVSFEGYLIRPPAGVSESEERLSRSYDSAMKDFSDIAQKNNATVQNLRLVEIRRRDFHFNKLEKDIREKLSREEWELKG*
Ga0075436_10073220623300006914Populus RhizosphereASYEAAKVDYCRRVDRVFDRILEEQAQLLSDVKSNIDVYQQLVSRSSDQRRTFMNEAAEIQDACNILLKRYRQTNARARNSPAPFYFNNSFAFDGHLVKAPEAISESEERLSRSYESAMKDFSDIARQNDVTVHTLRTAEIRRRDYYFNKLDRDVREKLIREAWEVKS*
Ga0079218_1373388213300007004Agricultural SoilAHLLAEIKSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNMRVRVSPAPGYFNDTVTFGYQLVKPPAGISESEEWLARSYENAMKEFSDIARQNDATVQNLRTAEIRRRDYHLSKLERDIREKLVREEYEVKS*
Ga0075435_10038250513300007076Populus RhizosphereDVFSWILVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRASYEAAKAEYCRLVDQVFDRVLQDQARLLSDLKSNIEYYQQLISRSVDERRTFVHDVAEVQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0099791_1026887113300007255Vadose Zone SoilDVKSNIEYYQQLISRGVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPTPFYFNNSFTFEGHLVTSPEAISESEERLARSYESAVKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0114129_1253183413300009147Populus RhizosphereFGIFASYKGYRLDDVYPGYGELDRELNARRASYEAAKAEYCRLVDQVFDRVLQDQARLLSDLKSNIEYYQQLISRSVDERRTFVHDVAEVQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS*
Ga0105242_1155395723300009176Miscanthus RhizosphereYCRLIDQVFDHIVEEQARLFADVKANIEYYQQLVGKSDDERRAFAHETAELQDACNVLLKRYREANARARTSPTPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLDREVRERLVREAWEIKS*
Ga0105248_1123812113300009177Switchgrass RhizosphereVLEQLDRELNARRALYEGQKAEYCRRVDQVFDRILAEQVRLFSDVKANIEHYQELVSQSDDERRVFVHEVAEIQDACNILLKRYRQTNARARTSPAPYYFQHSFAFDAHAMRPPDGISEDELRLSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS*
Ga0105067_107955223300009812Groundwater SandAHLLSEVKSNIEYYQQLISRSDDQRRTFVHDVAEIQDACNIVLKRYRQTNLRVRVSPAPFYFNNSIAFDGDLISQPAGITEIEGRLSRSYESAIKDFGDIARQNNATVQNLRTTHIRHRDYYFGKLERDVREKLIREAWELKS*
Ga0105082_102487913300009814Groundwater SandHLFADVKSNIDYYQQLLSQSDDQRRAFVHDVAEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNSFTFDGHLVKPPEAIAEDEDWLSRSYQSAMKDFNDIARQNDTTVQNLRTAEIRRREYHFNKLERDVRERLIREAWEIKS*
Ga0105087_101798713300009819Groundwater SandEYCRLGDQVFDRTLQEQAHLFADVKSNIDYYQQLLSQSDDQRRAFVHDVAEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNSFTFDGHLVKPPEAIAEDEDWLSRSYQSAMKDFNDIARQNDTTVQNLRTAEIRRREYHFNKLERDVRERLIREAWEIKS*
Ga0105085_107352613300009820Groundwater SandYGELDRELNGRRAIYEAAKAEYSRVVDQVFDRTLQEQAHLLSEVKSNIEYYQQLISRSDDQRRAFVHDAAEIQDACNILLKRYRQTNLRVRVSPAPFYFNNSITFDDPLIRPPAGISESEEGLSRSYESAMKDFSDIARQNNATVQNLRTAEIRSRDYYFGKLERDVREKLTREAWELKS
Ga0105066_116905013300009822Groundwater SandVKSNIEYYQQLISRSDDQRRTFVHDVAELQDACNIVLKRYRQTNLRVRVSPAPFYFNNSITFDDPLIRPPAGISESEEGLSRSYESAMKDFSDIARQNNATVQNLRTAEIRSRDYYFGKLERDVREKLTREAWELKS*
Ga0126382_1231788213300010047Tropical Forest SoilPGYGELDRELKRRQASYESAKAEYCRVVDQMFDRALQEQARLLSDVKSNIEYYQQLVSRSDDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSENEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREK
Ga0126372_1210365023300010360Tropical Forest SoilVFDRTLQEQAHLLSEVKSNIEYYQQLISTTEEQRRTFGREAAELQDACNVVIKGYRQANVRARKSPAPMYFKESVSFESYLVRPPAGVSENEERLSRFYESAMKSFSDIARQNNTTVQNLRTAEIRRRDFYFTKLEREIKEKLSREEWELQG*
Ga0126378_1111942613300010361Tropical Forest SoilRRTDYETAKAEYCRLVDHVFDRTLQEQAHLLSEVKSNIEYYQQLISTTEEQRRTFGREAAELQDACNVVIKGYRQANVRARKSPAPMYFKESVSFESYLVRPPAGASENEERLSRFYESAMKSFSDIARQNNTTVQNLRTAEIRRRDFYFTKLDREIKEKLSREEWELKG*
Ga0126377_1040495023300010362Tropical Forest SoilAKAEYCRVVDQMFDRALQEQARLLSDVKSNIEYYQQLVSRSDDHCRTFLHDSAEIQDACNIVLKHYRQTNLRVRVSPAPTYFKESFRFDAHLVTPAPGLSESEARLSRSYETAMKDFSEMARQNNATLQNLRTAEIRRRDYYFSKLERDIREKLVREEWEFKG*
Ga0105239_1123568223300010375Corn RhizosphereRALQEQARLLSDVKSNIEYYQQLVSRSGDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG*
Ga0126381_10071503113300010376Tropical Forest SoilGYGELDRELKTRRTDYETAKAEYCRLVDHVFDRTLQEQAHLLSEVKSNIEYYQQLISTTEEQRRTFGREAAELQDACNVVIKGYRQANVRARKSPAPMYFKESVSFESYLVRPPAGVSENEERLSRFYESAMKSFSDIARQNNTTVQNLRTAEIRRRDFYFTKLDREIKEKLSREEWELKG*
Ga0126383_1178445913300010398Tropical Forest SoilYGELDREVKTRRAAYEAAKAEYCRLVDQVFDRTLQEQAHLLSEVKSNIEYYQQLLSNTEEQRRTFAREAAELQDACNIVLKGYRQANVRARTSPPPPYFSQNVSFEGYLVRPPAGVADNEERLSRSYESAMKDFSDLAQKNNATAQNLRTVEIRRRDFYFTKLEKDIREKLSREEWELKG
Ga0134123_1082449723300010403Terrestrial SoilALYEGRKAQYCRLIDQVFDRILDEQARLFADVKANIEHYQELVSKSDDERRAFVHEVAEMQDACNILLKRYRQTNARARTSPAPYYFQNSFAFEAQVVRPPEALSAEEQRLSGSYESAIKDFSDIARQNDVTVQNLRTGEIRRREYYFNKLERDVRERLVREAWEIKS*
Ga0137383_1110539323300012199Vadose Zone SoilILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNNFTFDGHLVRPPEAISEGEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS*
Ga0137380_1011213013300012206Vadose Zone SoilKAEYCGLVDQVFDRILQEQAHLLSEVKSNIEYYQQLIGRSNEQRRAFLHDAAEIQDACNIVLKRYRHTNVRVRVSPAPFYFNNSFAFDGQLIRPPEAISECEERLSRSYESAMKDFSDIARHNNVTVQNLRTTEIRRREYYFNKLERDVREKLVREAWEIKS*
Ga0137370_1090979013300012285Vadose Zone SoilVLALIFGVFASYKGYRLDDAYPGYGELDRELNARRASSEAAKVEYCRRVDQVFDRILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPVPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIK
Ga0137371_1049112513300012356Vadose Zone SoilLVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYEGAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS*
Ga0137384_1010330333300012357Vadose Zone SoilFGVFASYKGYRLDDAYPGYGELDRELNARRASSEAAKVEYCRRVDQVFDRILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0137359_1064868123300012923Vadose Zone SoilLDDAYPGYGELDRELNARRASSEAAKVEYCRRVDQVFDRILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0137359_1164472613300012923Vadose Zone SoilDVFSWILVVLALIFGIFASYKGYRLDDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISEVEERLSRSYESAMKDFSDIARQNDATV
Ga0164301_1117470313300012960SoilLSATPLVQTLHHAPTPPEVALWSRYQEVPFIAISQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAVKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0126369_1046520113300012971Tropical Forest SoilKQAYEAAKADYCRRVDQVFDHILLKQAHLFSEVKSNIEYYQQLVSQSSDQRRAFLHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEAPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEIKS*
Ga0164304_1180479013300012986SoilWILVVLAVIFGIFASYKGYRLDDAYPGYGELDRELNARRTSSEAAKVEYCRRVDQVFDRILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAVKDFSDIARQNDA
Ga0164305_1187198213300012989SoilELDRELNARRAFYEGRKAEYCRLIDQVFDHIVEEQARLFADVKANIEYYQQLVGKSDDERRAFAHETAELQDACNVLLKRYREANARARTSPTPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLDREVRERLVREAWEIKS*
Ga0163162_1146274323300013306Switchgrass RhizosphereDPRNYPGYGELDRELNARRASSEAAKVEYCRLVDQVFDRILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0163162_1199872213300013306Switchgrass RhizosphereQVRLFSDVKANIEHYQELVSQSDDERRVFVHEVAEMQDACNILLKRYRQTTARARTSPAPYYFQNSFAFEAQVLRPPEALSEDEQRLSGSYESAMKDFSDIARQNDATVQNLRTGEIRRREYYFNKLDREVRERLVREAWEIKS*
Ga0134075_1004556813300014154Grasslands SoilQVFDRILQEQAHLLSDVKSNIEYYQQLISRSDDQRRTFVHDADEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNRFTFDGQLIRPPEAFSESDERLSRSYENAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLVREAWEIKS*
Ga0157380_1142272413300014326Switchgrass RhizosphereLVVLAVIFGIFASYKGYWLDDVYPGYGELDRELIARRTSSEAAKVDYCHRVDQVFERILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0137411_113899913300015052Vadose Zone SoilVIFGIFASYKGYRLDDSYPGYGELDRELNARRTLYEAAKAEYCGLVDQVFDRILQEQAHLLSEVKSNIEYYQQLLSRSGDQRRAFVHDAAEIQDACNTLLKRYRHNNVRVRVSPAPFYFNNSFTFDGQLIRPPEAISESEERLSRSYESAMKDFNDIARQNDATVQNLRTAEIRRREYSFNKLERDVRERLIREAWEIKS*
Ga0132256_10103082123300015372Arabidopsis RhizosphereEAARAQYCRAVDQVFDRTLQEQAHLLSEVKSNIEYYQQLVGKTDDERRAFARDAAELQDACNVVVRRYRQTNQSVRLSPAPTYFNDGIDLDPYLVRAPGGVSESEQRVSRSYESAMKDFSELARQNNATVQGLRTAEIRRRDYYFAKLEKDIREKLAREEWEAKS*
Ga0132256_10233095713300015372Arabidopsis RhizosphereLAVIFGIFASYKGYRLDDAYPGYGELDRELNARRTSSEAAKVEYCRRVDQVFDRILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS*
Ga0132257_10166361313300015373Arabidopsis RhizosphereGHEAARAQYCRAVDQVFDRTLQEQAHLLSEVKSNIEYYQQLVGKTDDERRAFARDAAELQDACNVVVRRYRQTNQSVRLSPAPTYFNDGIDLDPYLVRAPGGVSESEQRVSRSYESAMKDFSELARQNNATVQGLRTAEIRRRDYYFAKLEEDIREKLAREEWEAKS*
Ga0182041_1073605023300016294SoilRLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0134112_1040406113300017656Grasslands SoilNARRTTYEAAKAEYCRLVDQVFDRILQEQAHLLSDVKSNIEYYQQLISRSDDQRRTFVHDADEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNRFTFDGQLIRPPEAFSESDERLSRSYENAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS
Ga0187776_1014415513300017966Tropical PeatlandRIDQVFERILQEQAQLLSEVKSNIDIYRQLVSRSSDQRRAFVHETAEIQDACNILLKRYRQTNARVRVSPAPFYFNNSFAFDNYLVRPPDAISESEEQLARSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFGKLDRDVREKLIREAWEVKS
Ga0184638_100189883300018052Groundwater SedimentAKAEYCRLVDQVFDRILQEQAHLLLDVKSNIEYYQQLLSRSDDQRRTFVHDAAEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNRFTFDGQLITPPEAISESDERLSRSYESAMVHFSDIARQNDATVQNLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS
Ga0187765_1026401613300018060Tropical PeatlandTDYCRRVDQVFDHILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRAFMRDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTGEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0187773_1120939013300018064Tropical PeatlandGELDRELDARRASYETARAEYCRRIDRVFDRILQEQAQLLSEVKSNIEIYQQLVSRSSDERRAFVHEAAEIQDACNILLKRYRQTNARVRVSPAPFYFNNSFAFDNHLVRPPEAISESEERLARSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFGKLDRDVRE
Ga0066655_1084845923300018431Grasslands SoilPGYGELDRELNARRTSYEAAKADYCRLVDQVFDRVLQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS
Ga0207642_1048369413300025899Miscanthus RhizospherePVGFDDVFSWILVVLAVIFGIFASYKGYRLDDAYLGYGELDRELNARRTSSEAAKVDYCRRVDQVFERILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0207642_1053983523300025899Miscanthus RhizosphereILAEQVRLFSDVKANIEQYQELVSQSDDERRVFVHEVAEMQDACNILLKRYRQTNARARTSPAPYYFQHSFAFDTHALRPPDAISEDELRLSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS
Ga0207662_1105155713300025918Switchgrass RhizosphereDRELNARRALYEGQKAEYCRLVDQVFDRILAEQVRLFSDVKANIEHYQELVSQSDDERRVFVHEVAEMQDACNILLKRYRQTNARARTSPAPYYFQHSFAFDAHAMRPPDGISEDELRLSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS
Ga0207681_1094381613300025923Switchgrass RhizosphereELDRELNARRANSEAAKVGYCRLVDQVFDRILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0207706_1003779943300025933Corn RhizosphereLAEQARLFSDVKANIEHYQELVSQSDDERRVFVHEVAEMQDACNILLKRYRQTNARARTSPAPYYFQHSFAFDAHAMRPPDGISEDELRLSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS
Ga0207686_1071692513300025934Miscanthus RhizosphereARLFADVKANIEYYQQLVGKSDDERRAFAHETAELQDACNVLLKRYREANARARTSPTPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKIERDVRGRLVREAWEIKS
Ga0207669_1141877613300025937Miscanthus RhizosphereDAYPGYGELDRELNARRASSEAAKVEYCRLVDQVFDRILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0207712_1153131913300025961Switchgrass RhizosphereYPGYGELDRELNARRTSSEAAKVDYCHRVDQVFERILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS
Ga0207668_1084388713300025972Switchgrass RhizosphereLQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0207668_1163909513300025972Switchgrass RhizosphereMFDRALQEQARLLSDVKSNIEYYQQLVSRSDDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG
Ga0207658_1170854713300025986Switchgrass RhizosphereQAIYEAAKSEYCRVVDLMFDRALQEQARLLSDVKSNIEYYQQLVSRSDDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVRELGIEPTAESRGLEHAILRHDPDLAPPTR
Ga0207703_1198884413300026035Switchgrass RhizosphereAYPGYGELDRELNARRTSSEAAKVDYCHRVDQVFERILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0207708_1069795023300026075Corn, Switchgrass And Miscanthus RhizosphereEYCRLIDQVFDRIVHDQARLFSDVKANIEYYQELVGKSDDERRAFAHETAELQDACNILLKGYREANARARKSAAPYYFKDSFAFDGDLMRPPEAISADEARLLASYESAMKDFSDIARHNDATVQNLRTGEIRRREYYFNKLEREVRERLVREAWEIKS
Ga0209801_137547113300026326SoilYRLDDVYPGYGELDRELNARRTSYEAAKADYCRLVDQVFDRVLQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRD
Ga0209377_116423313300026334SoilNARRTTYEAAKAEYCRLVDQVFDRILQEQAHLLSDVKSNIEYYQQLISRSDDQRRTFVHDADEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNRFTFDGQLIRPPEAFSESDERLSRSYENAMKDFSDVARQNDATVQNLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS
Ga0209057_124716813300026342SoilGYGEIDRELKRRRATYEVAKVGYCRVVDHVFDRTLQEQAHLLSEVKSNLEYYQQLVSKTEDDRRAFARDAAELHDACNIVLKRYRQTNQRVRVSPAPTYFNDGIDFEPYLVRPPAGISENEQRLSRSYESAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIR
Ga0257147_105066613300026475SoilFARNPVGFDDVFSWILVVLAVIFGIFASYKGYRLDDAYPGYGELDRELNARRASSEVAKVEYCRRVDQVFDRILQEQARLLSDVRSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERD
Ga0209690_109297223300026524SoilCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISEVEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDVREKLIREAWEVKS
Ga0209160_1001020213300026532SoilDVYPGYGELDRELNARRTSYEAAKAEYCRLVDQVFDRILQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLVRPPEAISEVEERLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0209157_1002115183300026537SoilLVDQVFDRILQEQAHLLSEVKSNIEYYQQLIGRSNEQRRAFPHDAAEIQDACNIVLKRYRHTNVRVRVSPAPFYFNNSFAFDGQLIRPPEAISECEERLSRSYESAMKDFSDIARHNNVTVQNLRTTEIRRREYYFNKLERDVREKLVREAWEIKS
Ga0209157_134187413300026537SoilYEVAKVGYCRVVDHVFDRTLQEQAHLLSEVKSNLEYYQQLVSKTEDDRRAFARDAAELHDACNIVLKRYRQTNQRVRVSPAPTYFNDGIDFEPYLVRPPAGISENEQRLSRSYESAMKDFSDLARQNNASVQGLSTAEIRRRDYYFSKLEKDIREKLAREEWEAKS
Ga0209376_126450413300026540SoilNARRARYEAVKAEYCRLVDQVFDRILDEQAHLLSDVKANIEYYEQLISRSDDQRRTFVHEVAEIQDACNILLKRYRQTNARVRVSPAPYYFGNSFTFEGHLVRPPDAISEDEERLSRSYESAMKDFSEIARQNDATVQNLRTAEIRRRDYHFNKLERDVRERLIREAWEIKS
Ga0209805_100222113300026542SoilADYCRLVDQVFDRVLQDQARLLSDVKSNIEYYQQLISRSVDERRTFVHDVAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGQLVRPPEAISESEERLSRSYESAMKDFSDIARQNDATVQSLRTAEIRRRDYYFNKLERDIRERLIREAWEVKS
Ga0209156_1027672913300026547SoilSSQQIESYVARLKPLALRFAYVAEALPSLLLQSENYEQLISRSDDQRRTFVHEVAEIQDACNILLKRYRQTNARVRVSPAPYYFGNSFTFEGHLVRPPDAISEDEERLSRSYESAMKDFSEIARQNDATVQNLRTAEIRRRDYHFNKLERDVRERLIREAWEIKS
Ga0209577_1025288213300026552SoilGEVDRELKRRRATYEVAKVGYCRVVDHVFDRTLQEQAHLLSEVKSNLEYYQQLVSKTEDDRRAFARDAAELHDACNIVLKRYRQTNQRVRVSPAPTYFNDGIDFEPYLVRPPAGISENEQRLSRSYESAMKDFSDLARQNNASVQGLRTAEIRRRDYYFSKLEKDIREKLAREEWEAKS
Ga0209884_100565013300027013Groundwater SandLDRELEARRARYETAKAEYCRLGDQVFDRTLQEQAHLFADVKSNIDYYQQLLSQSDDQRRAFVHDVAEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNSFTFDGHLVKPPEAIAEDEDWLSRSYQSAMKDFNDIARQNDTTVQNLRTAEIRRREYHFNKLERDVRERLIREAWEIKS
Ga0209898_100176513300027068Groundwater SandTLQEHAHLLSEVKSNIEYYQQLISRSDDQRRTFVHDVAEIQDACNIVLKRYRQTNLRVRVSPAPFYFNNSIAFDGDLISQPAGITEIEGRLSRSYESAIKDFGDIARQNNATVQNLRTTHIRHRDYYFGKLERDVREKLIREAWELKS
Ga0209845_103315513300027324Groundwater SandHLFADVKSNIDYYQQLLSQSDDQRRAFVHDVAEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNSFTFDGHLVKPPEAIAEDEDWLSRSYQSAMKDFNDIARQNDTTVQNLRTAEIRRREYHFNKLERDVRERLIREAWEIKS
Ga0209899_107233623300027490Groundwater SandFADVKSNIDYYQQLLSQSDDQRRAFVHDVAEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNSFTFDGHLVKPPEAIAEDEDWLSRSYQSAMKDFNDIARQNDTTVQNLRTAEIRRREYHFNKLERDVRERLIREAWEIKS
Ga0209999_108750523300027543Arabidopsis Thaliana RhizosphereYCAEIDRVFEKTLQEQAHLFADVKSNIEYYQQLASRTDEQRRTFIREAAEIQDACNVVLKGYRQTNLRVRVSPAPTYFNDVVVFDDHLVKPPAGMSETEEWLSRSYENAMKEFSDLARQNDTTVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEAKS
Ga0209874_108711913300027577Groundwater SandDGRRAIYEAAKAEYSRVVDQVFDRTLQEQAHLLSEVKSNIEYYQQLISRSDDQRRTFVHDAAEIQDACNILLKRYRQTNLRVRVSPAPFYFNNSITFDDPLIRPPAGISESEEGLSRSYESAMKDFSDIARQNNATVQNLRTAEIRSRDYYFGKLERDVREKLTREAWELKS
Ga0209799_115305613300027654Tropical Forest SoilFDRTLQEQAHLLSEVKSNIEYYQQLISTTEEQRRTFGREAAELQDACNVVIKGYRQANVRARKSPAPMYFKESVSFEGYLVRPPAGVSESEERLSRFYESAMKSFSDIARQNNTTAQNLRTAEIRRRDFYFSKLERDIKEKLSREEWELKG
Ga0209481_1002599633300027880Populus RhizosphereTFQEQAHLLSEVKSNIEYYQQLVTRTEDERRTFIRGAAELQDACNIVLKRYRQANQRVRESPAPAYFNDSVTFGFPLTKPPAGVAESDEWLARSYESAIKEFSEIARQNDAALQNLRTADIRRREYYFSKLEKDTKEKLVREEWEAKS
Ga0209488_1096295513300027903Vadose Zone SoilEYCRLVDQVFDRILQEQARLLSDVKSNIEYYQQRISRSDDQRRTFLHDAAEIQDACNIVLKRYRQTNVRVRVSPAPFYFNNRFTFDGQLIRPPEAISESDERLSRSYESAMKDFSDIARQNDAAVQNLRTAEIRRRDYYFNKLDRDVRERLIREAWEIKS
Ga0209885_103722113300027950Groundwater SandELNRRRAIYEAAKAEYCRVVDQVFDRTLQEHAHLLSEVKSNIEYYQQLISRSDDQRRTFVHDVAEIQDACNIVLKRYRQTNLRVRVSPAPFYFNNSITFDDPLIRPPAGISESEEGLSRSYESAMKDFSDIARQNNATVQNLRTAEIRSRDYYFGKLERDVREKLTREAWELKS
Ga0247822_1155490713300028592SoilVFDRTLQEQAHLLSEVKSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNLRIRVSPAPSYFNDTITFGFQLVKPPPGVPESEEWLARSYESAMKEFSDIARQNDATVQTLRTAEIRRRDYYLGKLEKDIREKLVREEWEAKS
Ga0307504_1035017713300028792SoilEQARLFSEVKSNIEYYQQLISRSDDQRRTFIHDIAEIQDACNILLKRYRQTNARARVSPAPFYFNNSFAFDQPLIRPPEAISESDERLSRSYETAMKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0247824_1106709323300028809SoilSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNLRIRVSPAPSYFNDTITFGFQLVKPPPGVPESEEWLARSYESAMKEFSDIARQNDATVQTLRTAEIRRRDYYLGKLEKDIREKLVREEWEAKS
(restricted) Ga0255311_103931523300031150Sandy SoilWRLVDQVFDRILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGHLLRPPEAISESEERLSRSYESAIKNFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0307499_1028603413300031184SoilLDDAYPGYGELDRELNAKRTSSEAAKVEYCRLVDQVFDRILQEQARLLSDVKSSIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLIGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLI
Ga0307500_1011689613300031198SoilARRALYEGQKAEYCRRVDQVFDRILAEQVRLFSDVKANIEHYQELVSQSDDERRVFVHEVAEMQDACNILLKRYRQTNARARTSPAPYYFQHSFAFDTHALRPPDAISEDELRLSGSYESAMKDFSNIARQNDATVQNLRTGEIRRREYYFNKIERDVRERLVREAWEIKS
Ga0307505_1029605823300031455SoilEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRIVGPPEAISDSEERLSQSYESAIKDFSEIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0307408_10155277223300031548RhizosphereYGELDRELKRRRAIYEAAKAEYCRLGDQIFDRTLQEQAHLFSEVKSNIEYYQQLCSRTEDLRRTFMRDAAEIQDACNIVLKGYRQTNLRVRVSPAPTYFNDSVSFNFALVKPPAGIPESEEWLARSYTSAMKEFSEMARQNDATVQNLRTAEIRRRDYYFSKLERDIREKLVREEWEAKS
Ga0318528_1037137723300031561SoilTDYCRRVDQVFDHILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0310915_1081569923300031573SoilELDREVNARRTAYEAAKTDYCHRVDQVFDRILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0318542_1001834033300031668SoilVRRTVYETRKAEYCRLVDQVFDRILDEQARLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0307469_1045591313300031720Hardwood Forest SoilQVFDRILGEQARLLADVKANIEYYQQLVSKSDDERRAFVHEAAEIQDACNILLKRYRQANARARTSPAPFYFNNGFAFEAPLVRPPEAISDDEARLSRSYESAMKDFSDIARQNDATVQNLRTAEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0307469_1059791113300031720Hardwood Forest SoilELNAKRTSSEAAKVEYCRRVDQVFDRILQEQARLLSDVKSNIEYYQQLVSRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSRSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0307469_1175072513300031720Hardwood Forest SoilYPGYGQLDRELNARRALYESRKAEYCRLVDQVFDRILDEQARLLSDVKANIERYQELVSKSDDERRAFVHEVAEMQDACNILLKRYRQTNARARTSPAPYYFTNSFAFDAHLVRPLEAISEDEQRLSGSYESAVKDFSNIARQNDATVQNLRTGEFRRREYYFNKLERDVRERLVREAWEIKS
Ga0306918_1123749423300031744SoilYCRLVDQVFDRILDEQARLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0318502_1013530113300031747SoilRRVDQVFDHILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0318526_1030945413300031769SoilYGELDREVNARRTAYEAAKTDYCRRVDQVFDHILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0318498_1027909923300031778SoilAYEAAKTDYCRRVDQVFDHILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0318547_1057922813300031781SoilLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0307473_1044800513300031820Hardwood Forest SoilQVFERTLQEQAHLVSEVKSNIEYYQQLLSNTDEQRRTFAREAAELQDACNVVLKGYRQANVRARRSPAPPYFNESVSFEGYLVRPPAGASESEERLSRFYESAMKNFSDIARQNNATAQNLRTAEIRRRDFYFNKLERDIREKLTREEWELKG
Ga0318499_1016273323300031832SoilELDRELNVRRTVYETRKAEYCRLVDQVFDRILDEQARLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0310917_1033164513300031833SoilKTDYCRRVDQVFDHILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0310907_1011315623300031847SoilAHLFSDVKSNIEYFQQLVSRSDDQRRTFVRDVAEIQDACNILLQRYRQTNARARVSPAPLYFNKGFALEYKLAQAPEAIPESDERLSRSYDSAMKDFSEIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0307410_1027467913300031852RhizosphereDRELKQRRAMYEAAKADYCAQIDHVFEKTLQEQAHLLADVRSNIEYYQQLASRTDEQRRGFIRDAAELQDACNVVLKGYRQTNLRVRVSPAPTYFNDVVVFDDHLVKPPVGMSETEEWLSRSYENAMKEFSDLARQNDTTVQNLRTAEIRRREYYFSKLERDIREKLVREEWEAKS
Ga0307410_1120799423300031852RhizosphereAAKAQYSQLVDHVFDRTLQEQAHLLAEIKSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNMRVRVSPTPGYFNDSVTFGYQLVKPPAGISESEEWLARSYENAMKEFSEIARQNDATVQTVRTAEIRRRDYYLSKLERDIKEKLVREEYEVKS
Ga0310892_1010307533300031858SoilAHLFSDVKSNIEYFQQLVSRSDDQRRTFVRDVAEIQDACNILLQRYRQTNARARVSPAPLYFNKGFALEYKLAQAPEAIPESDERLSRSYDSAMKDFSEIARQNDSTVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0318522_1006399813300031894SoilRRTVYETRKAEYCRLVDQVFDRILDEQSRLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0306921_1014198513300031912SoilQARLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0310912_1050614823300031941SoilRRTVYETRKAEYCRLVDQVFDRILDEQARLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0307414_1185316913300032004RhizosphereYPGYGELDRELKRRRTIYEASKVEYCRLVDQVFDRALQEQAHLLSELKSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNVVLKGYRQTNLRVRVSPAPAYFNDTITFGFQLVKPPAGVSESEEWLARSYESATKEFSDIARQNDATVQNLRTAEIRRRDYYLSKLERDIKEKLVREEYEVKS
Ga0307411_1110245913300032005RhizosphereEYCRLVDQVFDRALQEQAHLLSELKSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNLRVRVSPAPAYFNDTITFGFQLVKPPAGVSESEEWLARSYESATKEFSDIARQNDATVQNLRTAEIRRRDYYLSKLERDIKEKLVREEYEVKS
Ga0318507_1002547833300032025SoilLDRELNVRRTVYETRKAEYCRLVDQVFDRILDEQARLFSDVKANIEYYQQLISKSDEQRRAFLHEAAEIQDACNILLKRYRQTNARARTSPAPYYFNNAFAFDAPLMRPPEATSEDEERLSRSYETAMKDFSDIARQNDATVQNLRTGEIRRREYYFSKLERDIRERLIREAWEIKS
Ga0318556_1001674643300032043SoilPGYGELDREVNARRTAYEAAKTDYCRRVDQVFDHILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0318506_1044867413300032052SoilGYGELDREVNARRTAYEAAKTDYCHRVDQVFDRILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRAFLHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIK
Ga0318575_1053187013300032055SoilKTDYCHRVDQVFDRILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0307415_10249539713300032126RhizospherePGYGELDRELKRRRTIYEASKVEYCRLVDQVFDRALQEQAHLLSELKSNIEYYQQLSSRTEDQRRTFIRDAAELQDACNIVLKGYRQTNLRVRVSPAPAYFNDTITFGFQLVKPPAGVSESEEWLARSYESATKEFSDIARQNDATVQNLRTAEIRRRDYYLSKLERDI
Ga0307470_1136434813300032174Hardwood Forest SoilYPGYGELDRELNARRASSEAAKVEYCRLVDQVFDRILQEQARLLSDVKSNIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS
Ga0307471_10232496423300032180Hardwood Forest SoilERTLQEQAHLLSEVKSNIEYYQQLLSNTDEQRRTFAREAAELQDACNVVLKGYRQANVRARRSPAPPYFNESVSFEGYLVRPPAGASESEERLSRFYESAMKNFSDIARQNNATAQNLRTAEIRRRDFYFNKLERDIREKLTREEWELKG
Ga0307471_10259850223300032180Hardwood Forest SoilQARLLSEVKSNIEYYQQLVSRSDDHCRTFVHDAAEIQDACNIVLKHYRQTNLRVRVSPAPPYFKESVRFDAHLVTPAPGLSESEARLSRSYESAMKEFSEMARQNNATLQNLRTAEIRRRDYYFGKLERDIREKLVREEWEFKG
Ga0307472_10029157513300032205Hardwood Forest SoilGQLDRELNVQRALYEGRKAEYCRLIDQVFDRILDEQARLFSDVKANIEHYHELISKSDDERRAFGHEVAEMQDACNILLKRYRQTNARARTSPAPYYFQNSFTFEAHVVRPPEAISEEEQRLFGSYESAMKDFSDIARQNDVTVQNLRTGEIRRREYYFNKLDRDVRERLVREAWEIKS
Ga0310812_1039418713300032421SoilVFDRTLQEQAHLLSEVKSNIEYYQQLVGKTDDERRAFARDAAELQDACNVVVRRYRQTNQSVRLSPAPTYFNDGIDLDPYLVRAPGGVSETEQRVSRSYESAMKDFSELARQNNATVQGLRTAEIRRRDYYFAKLEKDIREKLAREEWEAKS
Ga0310914_1031339533300033289SoilAKTDYCRRVDQVFDHILKEQAHLFSEVKSNIEYYQQLVSQSSDQRRTFMHDTAELQDACNILLKRYRQTNARARTSPAPFYFNNAFAFEGPLVRPPEAISDSEERLLQSYESAMKDFSDIARQNDETVQNLRTAEIRRRDYHFNKLERDIREKLIREAWEIKS
Ga0314801_200961_2_5083300034676SoilGYGELDRELNTRRAAYETAKAAYSRRVDEVFDRVLQEQAHLFSDVKSNIEYFQQLVSRSDDQRRTFVRDVAEIQDACNILLQRYRQTNARARVSPAPLYFNKGFALEYKLAQAPEAIPESDERLSRSYDSAMKDFSEIARQNDSTVQNLRTAEIRRRDYYFNKLERDIR
Ga0373950_0026996_1_4863300034818Rhizosphere SoilVEYCRRVDQVFDRILQEQARLLSDVKSSIEYYQQLISRSVDERRTFVHDAAEIQDACNIVLKRYRQTNARVRQSPAPFYFNNSFTFDGRLVGPPEAISESEERLSQSYESAIKDFSDIARQNDATVQNLRTAEIRRRDYYFNKLERDIREKLIREAWEVKS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.