NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F027632

Metagenome / Metatranscriptome Family F027632

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F027632
Family Type Metagenome / Metatranscriptome
Number of Sequences 194
Average Sequence Length 44 residues
Representative Sequence LQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA
Number of Associated Samples 159
Number of Associated Scaffolds 194

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.52 %
% of genes near scaffold ends (potentially truncated) 97.42 %
% of genes from short scaffolds (< 2000 bps) 94.33 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.742 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.536 % of family members)
Environment Ontology (ENVO) Unclassified
(22.165 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.938 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.96%    β-sheet: 0.00%    Coil/Unstructured: 91.04%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 194 Family Scaffolds
PF08044DUF1707 74.23
PF00580UvrD-helicase 0.52
PF14224DUF4331 0.52
PF03176MMPL 0.52
PF02768DNA_pol3_beta_3 0.52
PF12840HTH_20 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 194 Family Scaffolds
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.52
COG0592DNA polymerase III sliding clamp (beta) subunit, PCNA homologReplication, recombination and repair [L] 0.52
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.52
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.52
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.52
COG3973DNA helicase IVReplication, recombination and repair [L] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.74 %
UnclassifiedrootN/A25.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_120894028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2085Open in IMG/M
3300004472|Ga0068974_1054412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1278Open in IMG/M
3300004478|Ga0068972_1073356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales882Open in IMG/M
3300004977|Ga0072329_1049500All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300005329|Ga0070683_101300945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300005334|Ga0068869_101287524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae644Open in IMG/M
3300005355|Ga0070671_101389983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae620Open in IMG/M
3300005439|Ga0070711_101277139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae636Open in IMG/M
3300005439|Ga0070711_101331917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae623Open in IMG/M
3300005439|Ga0070711_101812252Not Available535Open in IMG/M
3300005440|Ga0070705_100345781All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300005537|Ga0070730_10682512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae652Open in IMG/M
3300005541|Ga0070733_10437980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia872Open in IMG/M
3300005610|Ga0070763_10765682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales569Open in IMG/M
3300005610|Ga0070763_10801377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300005615|Ga0070702_100456046All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300006031|Ga0066651_10432579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae699Open in IMG/M
3300006050|Ga0075028_100582082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae662Open in IMG/M
3300006059|Ga0075017_101147911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300006162|Ga0075030_100298650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1288Open in IMG/M
3300006172|Ga0075018_10453869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae661Open in IMG/M
3300006176|Ga0070765_101629292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300006755|Ga0079222_10519812All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300006804|Ga0079221_10827263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae668Open in IMG/M
3300006854|Ga0075425_101177022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia872Open in IMG/M
3300006903|Ga0075426_10590945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales828Open in IMG/M
3300009520|Ga0116214_1348701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales573Open in IMG/M
3300009523|Ga0116221_1251197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300009551|Ga0105238_12034497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales608Open in IMG/M
3300009698|Ga0116216_10278532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1020Open in IMG/M
3300009698|Ga0116216_10592554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia668Open in IMG/M
3300009764|Ga0116134_1029132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2199Open in IMG/M
3300010152|Ga0126318_10587733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii856Open in IMG/M
3300010152|Ga0126318_10843332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300010152|Ga0126318_10904289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1113Open in IMG/M
3300010320|Ga0134109_10192550Not Available750Open in IMG/M
3300010322|Ga0134084_10419677Not Available526Open in IMG/M
3300010360|Ga0126372_12628034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii555Open in IMG/M
3300010366|Ga0126379_12508379Not Available614Open in IMG/M
3300010371|Ga0134125_11873942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii652Open in IMG/M
3300010865|Ga0126346_1009355Not Available621Open in IMG/M
3300010865|Ga0126346_1255774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales701Open in IMG/M
3300010865|Ga0126346_1263846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales605Open in IMG/M
3300010880|Ga0126350_11981196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300011053|Ga0138531_178335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1244Open in IMG/M
3300011058|Ga0138541_1026692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1303Open in IMG/M
3300011120|Ga0150983_10927085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1137Open in IMG/M
3300012199|Ga0137383_10235684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1341Open in IMG/M
3300012400|Ga0134048_1270763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii678Open in IMG/M
3300012404|Ga0134024_1216087Not Available631Open in IMG/M
3300012929|Ga0137404_10764065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300012987|Ga0164307_11310818Not Available606Open in IMG/M
3300013307|Ga0157372_11824359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales699Open in IMG/M
3300014969|Ga0157376_11976606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii621Open in IMG/M
3300016270|Ga0182036_10942701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300016341|Ga0182035_11461082Not Available615Open in IMG/M
3300016371|Ga0182034_11974655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300016422|Ga0182039_10632823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium938Open in IMG/M
3300017928|Ga0187806_1291992Not Available573Open in IMG/M
3300017932|Ga0187814_10420510Not Available522Open in IMG/M
3300017946|Ga0187879_10438202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300017948|Ga0187847_10808062Not Available531Open in IMG/M
3300017959|Ga0187779_10463164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales834Open in IMG/M
3300017970|Ga0187783_10964434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300017970|Ga0187783_11242228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii537Open in IMG/M
3300017974|Ga0187777_10821026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales665Open in IMG/M
3300018012|Ga0187810_10224340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii767Open in IMG/M
3300018025|Ga0187885_10560352Not Available508Open in IMG/M
3300018037|Ga0187883_10620121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales562Open in IMG/M
3300018038|Ga0187855_10503134Not Available706Open in IMG/M
3300018044|Ga0187890_10151631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1328Open in IMG/M
3300018046|Ga0187851_10612276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300018468|Ga0066662_12690097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii526Open in IMG/M
3300020077|Ga0206351_10164551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii621Open in IMG/M
3300020081|Ga0206354_10328996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii711Open in IMG/M
3300020579|Ga0210407_10862762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii696Open in IMG/M
3300020581|Ga0210399_11364090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300021181|Ga0210388_10224059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1648Open in IMG/M
3300021401|Ga0210393_10049056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3318Open in IMG/M
3300021401|Ga0210393_10090605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2429Open in IMG/M
3300021401|Ga0210393_11073807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300021402|Ga0210385_10503494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300021404|Ga0210389_10819802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii726Open in IMG/M
3300021405|Ga0210387_10216295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1667Open in IMG/M
3300021407|Ga0210383_10517989Not Available1029Open in IMG/M
3300021420|Ga0210394_11144807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300021432|Ga0210384_11415206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300021474|Ga0210390_10479626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1048Open in IMG/M
3300021474|Ga0210390_11257156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300021476|Ga0187846_10006606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5801Open in IMG/M
3300021476|Ga0187846_10180934Not Available887Open in IMG/M
3300021479|Ga0210410_11567945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300022467|Ga0224712_10639692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii521Open in IMG/M
3300022522|Ga0242659_1081971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales615Open in IMG/M
3300022527|Ga0242664_1033482Not Available876Open in IMG/M
3300022527|Ga0242664_1041668Not Available811Open in IMG/M
3300022528|Ga0242669_1059591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales670Open in IMG/M
3300022528|Ga0242669_1071520Not Available629Open in IMG/M
3300022708|Ga0242670_1023737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales751Open in IMG/M
3300022709|Ga0222756_1027468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales766Open in IMG/M
3300022717|Ga0242661_1116735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii572Open in IMG/M
3300022718|Ga0242675_1089490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales577Open in IMG/M
3300022721|Ga0242666_1113704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales636Open in IMG/M
3300025898|Ga0207692_10198875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1177Open in IMG/M
3300025911|Ga0207654_10911049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii638Open in IMG/M
3300025914|Ga0207671_11051176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300026217|Ga0209871_1036331Not Available927Open in IMG/M
3300026911|Ga0209620_1006893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii910Open in IMG/M
3300027497|Ga0208199_1121661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales534Open in IMG/M
3300027590|Ga0209116_1052555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii881Open in IMG/M
3300027765|Ga0209073_10031234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1651Open in IMG/M
3300027853|Ga0209274_10027029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2640Open in IMG/M
3300027855|Ga0209693_10313467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300027855|Ga0209693_10351649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii715Open in IMG/M
3300027908|Ga0209006_10457417All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300028793|Ga0307299_10383779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales527Open in IMG/M
3300028877|Ga0302235_10422378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300028879|Ga0302229_10356526Not Available653Open in IMG/M
3300028906|Ga0308309_10935089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales752Open in IMG/M
3300028906|Ga0308309_11578679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300029636|Ga0222749_10166661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1083Open in IMG/M
3300029701|Ga0222748_1027084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii875Open in IMG/M
3300029701|Ga0222748_1033664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii815Open in IMG/M
3300030058|Ga0302179_10159893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria995Open in IMG/M
3300030545|Ga0210271_10321051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales746Open in IMG/M
3300030582|Ga0210261_1202039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300030595|Ga0210276_10637425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300030598|Ga0210287_1256026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300030626|Ga0210291_10022017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1232Open in IMG/M
3300030730|Ga0307482_1067535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300030730|Ga0307482_1248129Not Available558Open in IMG/M
3300030738|Ga0265462_10121204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1228Open in IMG/M
3300030738|Ga0265462_11114421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales694Open in IMG/M
3300030738|Ga0265462_11405264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales642Open in IMG/M
3300030743|Ga0265461_10192699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300030743|Ga0265461_11680614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales702Open in IMG/M
3300030743|Ga0265461_12338949Not Available624Open in IMG/M
3300030969|Ga0075394_10999234Not Available532Open in IMG/M
3300030973|Ga0075395_11467227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300031231|Ga0170824_100818238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii517Open in IMG/M
3300031231|Ga0170824_117250445Not Available833Open in IMG/M
3300031231|Ga0170824_124185125Not Available986Open in IMG/M
3300031236|Ga0302324_102914275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii572Open in IMG/M
3300031469|Ga0170819_13210695Not Available654Open in IMG/M
3300031469|Ga0170819_17411785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1218Open in IMG/M
3300031546|Ga0318538_10412898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii730Open in IMG/M
3300031561|Ga0318528_10812172Not Available500Open in IMG/M
3300031572|Ga0318515_10118841Not Available1396Open in IMG/M
3300031573|Ga0310915_10944863Not Available603Open in IMG/M
3300031616|Ga0307508_10768953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae578Open in IMG/M
3300031681|Ga0318572_10124696Not Available1473Open in IMG/M
3300031708|Ga0310686_107886485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium720Open in IMG/M
3300031708|Ga0310686_110192875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii639Open in IMG/M
3300031708|Ga0310686_113355014Not Available751Open in IMG/M
3300031713|Ga0318496_10005605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5698Open in IMG/M
3300031744|Ga0306918_10419395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1044Open in IMG/M
3300031753|Ga0307477_10792446Not Available630Open in IMG/M
3300031765|Ga0318554_10071689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1920Open in IMG/M
3300031765|Ga0318554_10165727Not Available1256Open in IMG/M
3300031771|Ga0318546_10948742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300031782|Ga0318552_10299588Not Available817Open in IMG/M
3300031792|Ga0318529_10043248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1918Open in IMG/M
3300031792|Ga0318529_10087880Not Available1391Open in IMG/M
3300031795|Ga0318557_10259786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria796Open in IMG/M
3300031797|Ga0318550_10351449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii714Open in IMG/M
3300031821|Ga0318567_10592073Not Available630Open in IMG/M
3300031832|Ga0318499_10138320Not Available949Open in IMG/M
3300031845|Ga0318511_10269728Not Available766Open in IMG/M
3300031938|Ga0308175_103181770Not Available509Open in IMG/M
3300031962|Ga0307479_10671670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1016Open in IMG/M
3300032010|Ga0318569_10442099Not Available606Open in IMG/M
3300032043|Ga0318556_10635499Not Available556Open in IMG/M
3300032044|Ga0318558_10263515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300032060|Ga0318505_10601047Not Available517Open in IMG/M
3300032066|Ga0318514_10043825Not Available2144Open in IMG/M
3300032067|Ga0318524_10234845Not Available942Open in IMG/M
3300032090|Ga0318518_10205864Not Available1007Open in IMG/M
3300032094|Ga0318540_10519049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii575Open in IMG/M
3300032119|Ga0316051_1022087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae589Open in IMG/M
3300032160|Ga0311301_12648028Not Available554Open in IMG/M
3300032515|Ga0348332_13485891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1358Open in IMG/M
3300032756|Ga0315742_11732664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii682Open in IMG/M
3300032782|Ga0335082_10999647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii701Open in IMG/M
3300032805|Ga0335078_10963221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1016Open in IMG/M
3300032805|Ga0335078_12077919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300032892|Ga0335081_10042325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales7220Open in IMG/M
3300032897|Ga0335071_10251352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1721Open in IMG/M
3300033134|Ga0335073_11143261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300033158|Ga0335077_11635924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300033158|Ga0335077_11675299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300033158|Ga0335077_12030754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales533Open in IMG/M
3300033158|Ga0335077_12203395Not Available506Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.54%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.15%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.12%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.09%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.58%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.58%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.06%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.06%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.06%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.06%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.06%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.06%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.55%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.03%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.03%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.03%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.52%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.52%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.52%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004472Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004478Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004977Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010865Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011053Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011058Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012404Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026911Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030973Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_12089402813300002568SoilKDPDAGAAAPEQARICLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA*
Ga0068974_105441233300004472Peatlands SoilSFIPDEARIRLEFTNPTKPALITGSAGPGDQSAPDYRYLVVPLRALTSA*
Ga0068972_107335613300004478Peatlands SoilLQFTSPAKPALITGSTGPGDESAPDYRYLVVPLRALASA*
Ga0072329_104950033300004977Peatlands SoilARICLQFTSPAKPALITGSTGPGDESAPDYRYLVVPLRALTSA*
Ga0070683_10130094523300005329Corn RhizosphereLQFTSPSKPALITGSAGDGDAAAAPDYRYLVVPLRALASA*
Ga0068869_10128752413300005334Miscanthus RhizosphereARIRLQFTSPTKPALITGSTGNGDKPTPDYRYLVVPLRALAGA*
Ga0070671_10138998323300005355Switchgrass RhizosphereEQARICLQFTSPSKPALITGSAGDGDAAAPDYRYLVVPLRALASA*
Ga0070711_10127713913300005439Corn, Switchgrass And Miscanthus RhizosphereCLQFTSPSKPALITGSAGDGDAAPDYRYLVVPLRALASA*
Ga0070711_10133191713300005439Corn, Switchgrass And Miscanthus RhizosphereLQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGT*
Ga0070711_10181225213300005439Corn, Switchgrass And Miscanthus RhizospherePAPEQARICLQFTSPSKPALITGSAGDGDAATPDYRYLVVPLRALASA*
Ga0070705_10034578133300005440Corn, Switchgrass And Miscanthus RhizospherePVPDEARIRLQFTSPTKPALITGSTGNGDKPTPDYRYLVVPLRALAGA*
Ga0070730_1068251223300005537Surface SoilLQFTSPTKPALITASTGDGDDRAPDYRYLVVPLRALASA*
Ga0070733_1043798033300005541Surface SoilPGPDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADA*
Ga0070763_1076568223300005610SoilFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV*
Ga0070763_1080137713300005610SoilPEKDATAAPAEGRIRLQFTSPTKPALITGSPGMKGAGEVGGESAPDYRYLVVPLRALTSA
Ga0070702_10045604613300005615Corn, Switchgrass And Miscanthus RhizospherePDEARIRLQFTSPTKPALITGSTGNGDKPTPDYRYLVVPLRALAGA*
Ga0066651_1043257913300006031SoilSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGT*
Ga0075028_10058208223300006050WatershedsDEARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRALASA*
Ga0075017_10114791123300006059WatershedsTSPTKPALITGSAGPGDQSAPDYRYLVVPLRALASA*
Ga0075030_10029865013300006162WatershedsAKEGRIRLQFTGPTKPALITGSPRMTGAGEVRGAIRGESAPDYRYLVVPLRALASA*
Ga0075018_1045386923300006172WatershedsQFTSPSKPALITGSTGNGDESAPDYRYLVVPLRALNGA*
Ga0070765_10162929213300006176SoilEARIRLQFTSPTKPALITGSPGPSDEADEAAPDYRYLVVPLRALAST*
Ga0079222_1051981213300006755Agricultural SoilARIRLQFTSPTKPALITGSTGDGDEPAPDYRYLVVPLRALAGA*
Ga0079221_1082726313300006804Agricultural SoilQFTSPTKPAVITGSTGNGDEPAPDYRYLVVPLRALAGA*
Ga0075425_10117702233300006854Populus RhizosphereQARICLQFTSPSKPALITGSAGDGDAAAPDYRYLVVPLRALASA*
Ga0075426_1059094513300006903Populus RhizospherePTKPALITGSIGNGDEPAPDYRYLVVPLRTLAGA*
Ga0116214_134870123300009520Peatlands SoilARIRLEFTSPTKPALITGRAGPGDQSVPDYRYLVVPLRALASA*
Ga0116221_125119713300009523Peatlands SoilGAAPGPDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADA*
Ga0105238_1203449713300009551Corn RhizospherePTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA*
Ga0116216_1027853233300009698Peatlands SoilNSEKPSSIPDEARIRLEFTSPTKPALITGSAGPGDQSAPDYRYLVVPLRTLASA*
Ga0116216_1059255413300009698Peatlands SoilRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADT*
Ga0116134_102913253300009764PeatlandKSERDGTATPAEGRIRLQFTSPAKPALITGSPRAGDESAPDYRYLVVPLRALTSA*
Ga0126318_1058773313300010152SoilPTKPALITGSTGNGDEPVPDYRYLVVPLRALAGA*
Ga0126318_1084333213300010152SoilAPEQARICLQFTSPSKPALITGSAGDGDDAAPDYRYLVVPLRALASA*
Ga0126318_1090428933300010152SoilTSPTRPALITGLKGRADSAPDYRYLVVPLRELVTA*
Ga0134109_1019255013300010320Grasslands SoilFTSPTKPALITGSTGNGDEPTPDYRYLVVPLRALAGA*
Ga0134084_1041967713300010322Grasslands SoilPEQARICLQFTSPTKPALITGSTGDGDDSTPDYRYLVVPLRALASA*
Ga0126372_1262803423300010360Tropical Forest SoilTSPTKPALITGSAGDDDETPDYRYLVVPLRALASA*
Ga0126379_1250837913300010366Tropical Forest SoilPDRDQTPVATQGRIRLQFTSPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTSA
Ga0134125_1187394213300010371Terrestrial SoilCLQFTSPSKPALITGSAGDGDAAAPDYRYLVVPLRALASA*
Ga0126346_100935513300010865Boreal Forest SoilAAPEQARICLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA*
Ga0126346_125577423300010865Boreal Forest SoilLQFTSPTKPALITGSPGMKGAGEAGGESAPDYRYLVVPLRALASA*
Ga0126346_126384613300010865Boreal Forest SoilSTKPALITGSSGADGQAAPDYRYLVVPLRSLASA*
Ga0126350_1198119623300010880Boreal Forest SoilSGKPDRDGTAAEGRIRLQFTSPTKPALITGSQGMKGAGEAGGQSAPDYRYLVVPLRALASA*
Ga0138531_17833513300011053Peatlands SoilRPTKPALITGRAGPGDQSVPDYRYLVVPLRALTSA*
Ga0138541_102669233300011058Peatlands SoilSEKPSSIPDEARIRLQFTSSTKPALITGSAGPDDESAPHYRYLVVPLRALTSA*
Ga0150983_1092708513300011120Forest SoilRLQFTSPTKPALITGRARAGDDSEPDYRYLVVPLRALVG*
Ga0150983_1516072833300011120Forest SoilRIRLQFTSPTKPAVITGGARAADEPVPDFRYLVVPLRSLTSA*
Ga0137383_1023568413300012199Vadose Zone SoilLQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALADA*
Ga0134048_127076313300012400Grasslands SoilLQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA*
Ga0134024_121608713300012404Grasslands SoilLQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGA*
Ga0137404_1076406523300012929Vadose Zone SoilVPGPEQARICLQFTSPTKPALITASAGDGDDSAPDYRYLVVPLRALASA*
Ga0164307_1131081813300012987SoilARICLQFTSPSKPALITGSAGDGDAAPDYRYLVVPLRALASA*
Ga0157372_1182435913300013307Corn RhizospherePTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGA*
Ga0157376_1197660613300014969Miscanthus RhizosphereQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA*
Ga0182036_1094270113300016270SoilVPAAKEGRIRLQFTSPTKPALITGRPQMKGAGEVGGESAPDYRYLVVPLRALTSA
Ga0182035_1146108213300016341SoilIRLQFTGPTKPALITGSPPMKGAAQENAPDYRYLVVPLRALASA
Ga0182034_1197465513300016371SoilKEGRIRLQFTGPTKPALITGSPAMNGAGGGGAASAPDYRYLVVPLRALASA
Ga0182039_1063282313300016422SoilVAKEGRIRLQFTSPTKPALITGSPRADDESAPDYRYLV
Ga0187806_129199213300017928Freshwater SedimentRLQFTGPTKPALITGSPRMTGAGEVGGESAPDYRYLVVPLRALASA
Ga0187814_1042051013300017932Freshwater SedimentATQGRIRLQFTGPTKPALITGSPRMTGAGEVGGEFAPDFRYLVVPLRALASA
Ga0187879_1043820213300017946PeatlandIRLQFTSPTKPALITGSARVGDDSDPDYRYLVVPLRALAG
Ga0187847_1080806213300017948PeatlandTSATKPALITGSARAGDDSVPDYRYLVVPLRALTG
Ga0187779_1046316413300017959Tropical PeatlandKPALITGSPSVKGAGEVGGESAPDYRYLVVPLRALTSA
Ga0187783_1096443413300017970Tropical PeatlandLGREGAAQGPGGRIRLQFTGPTKPALITGSAKAGDESAPDYRYLVVPLRALADA
Ga0187783_1124222823300017970Tropical PeatlandTGPTKPALITGSPKAGDEAAPDYRYLVVPLRALADA
Ga0187777_1082102613300017974Tropical PeatlandTKPALITGRPRMKGAGEVGGESAPDFRYLVVPLRALASA
Ga0187810_1022434013300018012Freshwater SedimentSPTKPALITGSPGADDESAPDYRYLVVPLRALTSA
Ga0187885_1056035223300018025PeatlandEEARIRLQFTSPTKPALITGSARVGDDSDPDYRYLVVPLRALAG
Ga0187883_1062012113300018037PeatlandKPALITGSPGSGSPGPDGPAVPDYRYLVVPLRSLASA
Ga0187855_1050313423300018038PeatlandFTSPTKPALITGRARADDEADPDYRYLVVPLRALVG
Ga0187890_1015163113300018044PeatlandPSPEEARIRLQFTSPTKPALITGSARVGDDSDPDYRYLVVPLRALAG
Ga0187851_1061227613300018046PeatlandRIRLQFTSPTKPALITGSARVGDDSDPDYRYLVVPLRTLAG
Ga0066662_1269009723300018468Grasslands SoilRICLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA
Ga0206351_1016455113300020077Corn, Switchgrass And Miscanthus RhizosphereICLQFTSPSKPALITGSAGDGDDAAPDYRYLVVPLRALASA
Ga0206354_1032899623300020081Corn, Switchgrass And Miscanthus RhizosphereCLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA
Ga0210407_1086276233300020579SoilSPTKPALITGSAGPGDESVPDYRYLVVPLRTLTSA
Ga0210399_1136409013300020581SoilAPAEGRIRLQFTSPTKPAVITGRPGMKRAGEAGGESAPDYRYLVVPLRALASG
Ga0210388_1022405943300021181SoilARIRLQFTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALAST
Ga0210393_1004905673300021401SoilTSPTKPALITASPRPGEESVPDYRYLVVPLRALADA
Ga0210393_1009060553300021401SoilERAASIPDEARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV
Ga0210393_1107380723300021401SoilEARIRLQFTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALASA
Ga0210385_1050349423300021402SoilTAAEGRIRLQFTSPTKPALITGSPGPGDTSAPDYRYLVVPLRALASA
Ga0210389_1081980213300021404SoilQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGA
Ga0210387_1021629523300021405SoilKPEKDATAAPAEGRIRLQFTSPTKPALITGSPGMEGAGEVGGESAPDYRYLVVPLRALAS
Ga0210383_1051798913300021407SoilTSPTKPALITGSPGPGDTSAPDYRYLVVPLRALASA
Ga0210394_1114480713300021420SoilGKPDRDGTAAEGRIRLQFTSPTKPALITGSPGPGDTSAPDYRYLVVPLRALASA
Ga0210384_1141520613300021432SoilTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGT
Ga0210390_1047962613300021474SoilPSQEGCVRLEFTSPTKPALITASPRPGEESVPDYRYLVVPLRALADA
Ga0210390_1125715613300021474SoilIPDEARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV
Ga0187846_1000660683300021476BiofilmQFTGPTKPALITGSPRAGDESVPDFRYLVVPLRALADA
Ga0187846_1018093423300021476BiofilmPALITGSPRMKGAGEVRGAIRGESDPDYRYLVVPLRSLASA
Ga0210410_1156794523300021479SoilKPDRDGTAAEGRIRLQFTSPTKPALITGSPGPGDPSAPDYRYLVVPLRALTSA
Ga0224712_1063969223300022467Corn, Switchgrass And Miscanthus RhizosphereLQFTSPTKPALITGSAGDGDDSAPDYRYLVVPLRALASA
Ga0242659_108197123300022522SoilAESAEDARIRLQFTSPTKPAVITGTVREHTGEAPDFRYLVVPLRALASA
Ga0242664_103348233300022527SoilTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALAST
Ga0242664_104166813300022527SoilLQFTSPTKPALITGSARPHDESAPDYRYLVVPLRALASA
Ga0242669_105959113300022528SoilTSPTKPALITGSSAADGQAVPDYRYLVVPLRSLASA
Ga0242669_107152013300022528SoilRICLQFTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALASA
Ga0242670_102373713300022708SoilTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGA
Ga0222756_102746813300022709SoilRIRLQFTSPTKPAVITGTVREHTGEAPDFRYLVVPLRALASA
Ga0242661_111673513300022717SoilRIRLQFTGPTEPALITGSPKAGDESAPDYRYLVVPLRALADA
Ga0242675_108949013300022718SoilTSPTKPAVITGTVREHTGEAPDFRYLVVPLRALASA
Ga0242666_111370413300022721SoilRIRLQFTSPTKPAVITGGARAADEPVPDFRYLVVPLRSLTSA
Ga0207692_1019887533300025898Corn, Switchgrass And Miscanthus RhizosphereFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA
Ga0207654_1091104913300025911Corn RhizosphereSPTKPALITGSTGDGDEPAPDYRYLVVPLRTLAGA
Ga0207671_1105117613300025914Corn RhizosphereRIRLQFTSPTKPALITGSTGDGDEPAPDYRYLVVPLRTLAGA
Ga0209871_103633133300026217Permafrost SoilQDTDPPPDEARICLQFTSPTKPALITGSARPGDESAPDYRYLVVPLRALTG
Ga0209620_100689333300026911Forest SoilRLQFTSPTKPALITGSTGNGDKPTPDYRYLVVPLRALAGA
Ga0208199_112166113300027497Peatlands SoilARIRLEFTSPTKPALITGRAGPGDQSVPDYRYLVVPLRALASA
Ga0209116_105255533300027590Forest SoilFTSPTKPALITGRARDDDDSDPDYRYLVVPLRALAG
Ga0209073_1003123413300027765Agricultural SoilSSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA
Ga0209274_1002702923300027853SoilSGKPEKDATAAPAEGRIRLQFTSPTKPALITGSPGPGEESAPDYRYLVVPLRALTST
Ga0209693_1031346723300027855SoilARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV
Ga0209693_1035164923300027855SoilQFTSPTKPALITGSPKPGDESAPDYRYLVVPLRALAS
Ga0209006_1045741733300027908Forest SoilSIPDQARIRLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASV
Ga0307299_1038377913300028793SoilLQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRALAGA
Ga0302235_1042237813300028877PalsaRIRLQFTSPTKPALITGSARAGDESDPDYRYLVVPLRALVG
Ga0302229_1035652613300028879PalsaRILLQFTSPTKPALITGSARAGDDSDPDYRYLVVPLRALVG
Ga0308309_1093508923300028906SoilEKAQNSEKAAPDEARIRLQFTSPTKPALITGSPGPSDEADEAAPDYRYLVVPLRALAST
Ga0308309_1157867913300028906SoilTAAPAEGRIRLQFTSPTKPALITGSPDMTGAGEVGGESAPDYRYLVVPLRALASG
Ga0222749_1016666113300029636SoilLQFTSPTKPALITGSTGNGDEPAPDYRYLVVPLRTLAGT
Ga0222748_102708423300029701SoilRIRLQFTSPTKPALITGSPGMKGAGEVGGESAPDYRYLVVPLRALTSA
Ga0222748_103366413300029701SoilFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLTSA
Ga0302179_1015989313300030058PalsaRIRLQFTSPTKPALITGIARVGDDSDPDYRYLVVPLRALVG
Ga0210271_1032105113300030545SoilTSPTKPALITGSARPGDEKTPDYRYLVVPLRTLSGT
Ga0210275_1014261823300030578SoilLLYHFISRLFFSSSPTKPALITGSAGGDDSDPDYRYLVVPLRALAG
Ga0210261_120203923300030582SoilDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADA
Ga0210276_1063742513300030595SoilYISLPKPGPDGRIRLQFTGPTKPALIAGSPKAGDESAPDYRYLVVPLRALADA
Ga0210287_125602613300030598SoilTAAPAEGRIRLQFTSPTKPALITGSPGMKGAGEVDGESAPDYRYLVVPLRALASA
Ga0210291_1002201733300030626SoilLQFTSPTKPALITGSAGPGDESAPDYRYLVVPLRALSSA
Ga0307482_106753513300030730Hardwood Forest SoilRIRLEFTSPTKPALITGSAGPGDQSAPDYRYLVVPLRTLTSA
Ga0307482_124812913300030730Hardwood Forest SoilLQFTSPTKPALITGSPDMKGAGEVGGESAPDYRYLVVPLRALASG
Ga0265462_1012120433300030738SoilEFTSPTKPALITGSARPGDEKAPDYRYLVVPLRTLAGT
Ga0265462_1111442123300030738SoilLEFTSPTKPALITGSAGPGDESAPDYRYLVVPLRTLASA
Ga0265462_1140526423300030738SoilLLFIYFFSPTKPALITGSSAADGQAVPDYRYLVVPLRSLASA
Ga0265461_1019269933300030743SoilLEFTSPTKPALITGSARPGDEKAPDYRYLVVPLRTLAGT
Ga0265461_1168061413300030743SoilSPTKPALITGRAGPGDHSVPDYRYLVVPLRALASA
Ga0265461_1233894913300030743SoilSPTKPALITGSAGPGDESAPDYRYLVVPLRALSSA
Ga0075394_1099923423300030969SoilQFTSPTKPALITGLKGRADSAPDYRYLVVPLRELVTA
Ga0075395_1146722733300030973SoilQNADKAPAVSDEARIRLQFTSPTKPALITGSTGNGGEPAPDYRYLVVPLRALAGA
Ga0170824_10081823823300031231Forest SoilFLFFQQFTSPTKPALITASTGDGDDSAPDYRYLVVPLRALASA
Ga0170824_11725044533300031231Forest SoilLQFTSPTKPALITGLKGRADSAPDYRYLVVPLRELVTA
Ga0170824_12418512513300031231Forest SoilIPDEARICLQFTSPTKPALITGSAGPGDDSAPDYRYLVVPLRALASA
Ga0302324_10291427513300031236PalsaAAPAADGDGDDGGGGGEARIRLQFTGPTKPAVITGTKRDCAGSAPDFRYLVVPLRSLASA
Ga0170819_1321069523300031469Forest SoilFTSPTKPALITGSTGNGGEPAPDYRYLVVPLRALAGA
Ga0170819_1741178513300031469Forest SoilSPTKPALITASTGDGDDSAPDYRYLVVPLRALASA
Ga0318538_1041289813300031546SoilSPTKPALITGSTGNGDEPAPDYRYLVVPLRALADA
Ga0318528_1081217213300031561SoilQDQDGTSAAKEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA
Ga0318515_1011884123300031572SoilAKEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA
Ga0310915_1094486323300031573SoilQFTGPTKPALITGSPRADDEPAPDYRYLVVPLRALTSA
Ga0307508_1076895313300031616EctomycorrhizaDAAEPGQARICLQFTSPTKPALITGSAGDGDGSAPDYRYLVVPLRALASA
Ga0318572_1012469623300031681SoilQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA
Ga0310686_10788648513300031708SoilPAEGRIRLQFTSPTKPALITGSPGMKGAGPGEESAPDYRYLVVPLRALASA
Ga0310686_11019287523300031708SoilGKPGREGAAPGPDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADA
Ga0310686_11335501423300031708SoilLQFTSPTKPALITGSPHMKGAGEVGGESDPDYRYLVVPLRALASG
Ga0318496_1000560563300031713SoilPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA
Ga0306918_1041939513300031744SoilFTSPTKPALITGSPKAGDESAPDYRYLVVPLRALAS
Ga0307477_1079244613300031753Hardwood Forest SoilGPTKPALITGSPRMTGAGEAGGESAPDFRYLVVPLRALASA
Ga0318554_1007168913300031765SoilQFTSPTKPALITGSPKAGDESAPDYRYLVVPLRALAS
Ga0318554_1016572713300031765SoilPSTPGSPAPQAQDGTTAAKEGRIRLQFTGPTKPALITGSPPMKGAAQENAPDYRYLVVPLRALASA
Ga0318546_1094874213300031771SoilGRIRLQFTSPTKPALITGSPGMKEAGEVGGESAPDYRYLVVPLRALASA
Ga0318552_1029958813300031782SoilLHLRAAKEGRIRLQFTSPTKPALITGRPQMKGAGEVGGESAPDYRYLVVPLRALASS
Ga0318529_1004324853300031792SoilAEKAPAAPDEARIRLEFTSPTKPALITGRTGNGDESAPDYRYLVVPLRALAGA
Ga0318529_1008788023300031792SoilRMRPSLAAASQDQDGTSAAKEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA
Ga0318557_1025978613300031795SoilAPDEARIRLEFTSPTKPALITGRTGNGDESAPDYRYLVVPLRALAGA
Ga0318550_1035144923300031797SoilSPTKPALITGSTGNADEPTPDYRYLVVPLRALAGA
Ga0318567_1059207313300031821SoilQFTGPTKPALITGSPPMKGAAQENAPDYRYLVVPLRALASA
Ga0318499_1013832013300031832SoilLQFTGPTKPALITGSPQMKGAGEVGGESAPDYRYLVVPLRALASS
Ga0318511_1026972813300031845SoilPAAASQDQDGTSAAKEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA
Ga0308175_10318177013300031938SoilAEGQNGDGGVPGPEQARICLQFTSPTKPALITGSAGDGDGSAPDYRYLVVPLRALASA
Ga0307479_1067167023300031962Hardwood Forest SoilDATAAPAEGRIRLQFTSPTKPALITGSPGLRGAGEGGESTPDYRYLVVPLRALASG
Ga0318569_1044209913300032010SoilFTGPTKPALITGSPRADDEPAPDYRYLVVPLRALTSA
Ga0318556_1063549913300032043SoilDQTPVATQGRIRLQFTSPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA
Ga0318558_1026351513300032044SoilDEARIRLEFTSPTKPALITGRTGNGDESAPDYRYLVVPLRALAGA
Ga0318505_1060104713300032060SoilLITGSPGMKGAGEVGGESAPDYRYLVVPLRALASA
Ga0318514_1004382523300032066SoilEGRIRLQFTGPTKPALITGSPQVKGAGEVGGEPAPDYRYLVVPLRALTTA
Ga0318524_1023484523300032067SoilLQFTSPTKPALITGSPRADAESAPDYRYLVVPLRALTSA
Ga0318518_1020586413300032090SoilLQFTGPTKPALITGSPRADDEPAPDYRYLVVPLRALTSA
Ga0318540_1051904923300032094SoilTSPAKPALITGSARPGDESAPDYRYLVVPLRALASA
Ga0316051_102208723300032119SoilLQFTSPTKPALITGSSGADSQVAPDYRYLVVPLRSLASA
Ga0311301_1264802823300032160Peatlands SoilGSPAPQAQDGTTTAKEGRIRLQFTGPTKPALITGSPRMTGAGEVGGESAPDYRYLVVPLRALASA
Ga0348332_1348589133300032515Plant LitterLLYDRFDLGNSYRPAPAEGRIRLQFTGPTKPALITGSPGADGEPALDYRYLVVPLRALAS
Ga0315742_1173266423300032756Forest SoilPSVSGAQDAPAPAEGRIRLQFTSPTKPALITGSPGADGEAALDYRYLVVPLRALASV
Ga0335082_1099964713300032782SoilLQFTSPTKPALITGSVGDGDGSSPDYRYLVVPLRALASA
Ga0335078_1096322113300032805SoilFTSPTKPALITASAGDGDDSAPDYRYLVVPLRTLASA
Ga0335078_1207791923300032805SoilFTSPTKPALITGSAGNNDESVPDYRYLVVPLRALAGA
Ga0335081_1004232513300032892SoilAEGRIRLQFTSPTKPALITGSPQVKGEGEVGGESDPDYRYLVVPLRVLASA
Ga0335071_1025135213300032897SoilPDEARIRLQFTSPTKPALITASARAGDDSAPDYRYLVVPLRALAST
Ga0335073_1114326133300033134SoilRIRLQFTSPTKPALITGSPRAGADSAPDYRYLVVPLRVLTSA
Ga0335077_1163592413300033158SoilEGRIRLQFTSPTKPALITGSPQVKGEGEVGGESDPDYRYLVVPLRVLASA
Ga0335077_1167529923300033158SoilKAPTTPDEARIRLEFTSPTKPALITGRTGNGDGSAPDYRYLVVPLRALAGA
Ga0335077_1203075413300033158SoilSPDEARIRLQFTSPTKPALITASARAGDDSAPDYRYLVVPLRALASA
Ga0335077_1220339513300033158SoilGKLVRESAAPGPDGRIRLQFTGPTKPALITGSPKAGDESAPDYRYLVVPLRALADG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.