Basic Information | |
---|---|
Family ID | F027474 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 194 |
Average Sequence Length | 45 residues |
Representative Sequence | MTDQSGNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 194 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 46.91 % |
% of genes near scaffold ends (potentially truncated) | 43.30 % |
% of genes from short scaffolds (< 2000 bps) | 78.35 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (90.206 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.835 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.216 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.402 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.43% β-sheet: 19.15% Coil/Unstructured: 40.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 194 Family Scaffolds |
---|---|---|
PF10397 | ADSL_C | 21.13 |
PF01865 | PhoU_div | 5.67 |
PF00004 | AAA | 5.15 |
PF08542 | Rep_fac_C | 2.58 |
PF13722 | CstA_5TM | 2.06 |
PF13177 | DNA_pol3_delta2 | 1.03 |
PF05916 | Sld5 | 1.03 |
PF12681 | Glyoxalase_2 | 1.03 |
PF13537 | GATase_7 | 1.03 |
PF03807 | F420_oxidored | 1.03 |
PF00733 | Asn_synthase | 0.52 |
PF02933 | CDC48_2 | 0.52 |
PF08519 | RFC1 | 0.52 |
PF01435 | Peptidase_M48 | 0.52 |
PF00270 | DEAD | 0.52 |
PF01243 | Putative_PNPOx | 0.52 |
PF01738 | DLH | 0.52 |
PF02602 | HEM4 | 0.52 |
PF02374 | ArsA_ATPase | 0.52 |
PF14551 | MCM_N | 0.52 |
PF13458 | Peripla_BP_6 | 0.52 |
PF14520 | HHH_5 | 0.52 |
COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
---|---|---|---|
COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 5.67 |
COG0470 | DNA polymerase III, delta prime subunit | Replication, recombination and repair [L] | 2.58 |
COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 2.58 |
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.24 % |
Unclassified | root | N/A | 8.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1005556 | All Organisms → cellular organisms → Archaea | 2211 | Open in IMG/M |
3300002557|JGI25381J37097_1020042 | All Organisms → cellular organisms → Archaea | 1172 | Open in IMG/M |
3300002558|JGI25385J37094_10009829 | All Organisms → cellular organisms → Archaea | 3408 | Open in IMG/M |
3300002558|JGI25385J37094_10018260 | All Organisms → cellular organisms → Archaea | 2510 | Open in IMG/M |
3300002558|JGI25385J37094_10019380 | All Organisms → cellular organisms → Archaea | 2431 | Open in IMG/M |
3300002558|JGI25385J37094_10062205 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1217 | Open in IMG/M |
3300002558|JGI25385J37094_10151659 | All Organisms → cellular organisms → Archaea | 623 | Open in IMG/M |
3300002558|JGI25385J37094_10202437 | All Organisms → cellular organisms → Archaea | 531 | Open in IMG/M |
3300002560|JGI25383J37093_10000439 | All Organisms → cellular organisms → Archaea | 9734 | Open in IMG/M |
3300002560|JGI25383J37093_10000920 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 7654 | Open in IMG/M |
3300002560|JGI25383J37093_10057447 | All Organisms → cellular organisms → Archaea | 1239 | Open in IMG/M |
3300002561|JGI25384J37096_10197093 | All Organisms → cellular organisms → Archaea | 594 | Open in IMG/M |
3300002562|JGI25382J37095_10071111 | All Organisms → cellular organisms → Archaea | 1296 | Open in IMG/M |
3300002562|JGI25382J37095_10267103 | All Organisms → cellular organisms → Archaea | 515 | Open in IMG/M |
3300002908|JGI25382J43887_10166327 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1101 | Open in IMG/M |
3300002908|JGI25382J43887_10241761 | All Organisms → cellular organisms → Archaea → TACK group | 836 | Open in IMG/M |
3300002909|JGI25388J43891_1078955 | All Organisms → cellular organisms → Archaea | 507 | Open in IMG/M |
3300002911|JGI25390J43892_10088215 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 696 | Open in IMG/M |
3300002914|JGI25617J43924_10095572 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1067 | Open in IMG/M |
3300005166|Ga0066674_10066226 | All Organisms → cellular organisms → Archaea | 1649 | Open in IMG/M |
3300005166|Ga0066674_10072861 | All Organisms → cellular organisms → Archaea | 1574 | Open in IMG/M |
3300005166|Ga0066674_10452136 | Not Available | 586 | Open in IMG/M |
3300005167|Ga0066672_10523859 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 768 | Open in IMG/M |
3300005174|Ga0066680_10258543 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1107 | Open in IMG/M |
3300005174|Ga0066680_10654209 | All Organisms → cellular organisms → Archaea | 651 | Open in IMG/M |
3300005178|Ga0066688_10208968 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300005178|Ga0066688_10768769 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 605 | Open in IMG/M |
3300005186|Ga0066676_10162408 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1412 | Open in IMG/M |
3300005445|Ga0070708_100012460 | All Organisms → cellular organisms → Archaea | 6941 | Open in IMG/M |
3300005445|Ga0070708_100661015 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 984 | Open in IMG/M |
3300005446|Ga0066686_11040491 | Not Available | 529 | Open in IMG/M |
3300005447|Ga0066689_10160862 | All Organisms → cellular organisms → Archaea | 1341 | Open in IMG/M |
3300005468|Ga0070707_100001388 | All Organisms → cellular organisms → Archaea | 23815 | Open in IMG/M |
3300005468|Ga0070707_100244163 | All Organisms → cellular organisms → Archaea | 1747 | Open in IMG/M |
3300005468|Ga0070707_101189266 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 728 | Open in IMG/M |
3300005468|Ga0070707_101983190 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 549 | Open in IMG/M |
3300005468|Ga0070707_102250260 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 512 | Open in IMG/M |
3300005540|Ga0066697_10368492 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 836 | Open in IMG/M |
3300005540|Ga0066697_10521987 | All Organisms → cellular organisms → Archaea | 670 | Open in IMG/M |
3300005542|Ga0070732_10000862 | All Organisms → cellular organisms → Archaea | 17333 | Open in IMG/M |
3300005552|Ga0066701_10371268 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 885 | Open in IMG/M |
3300005553|Ga0066695_10078706 | All Organisms → cellular organisms → Archaea | 2001 | Open in IMG/M |
3300005556|Ga0066707_10113445 | All Organisms → cellular organisms → Archaea | 1680 | Open in IMG/M |
3300005557|Ga0066704_10935784 | All Organisms → cellular organisms → Archaea | 535 | Open in IMG/M |
3300005558|Ga0066698_10623508 | All Organisms → cellular organisms → Archaea | 723 | Open in IMG/M |
3300005558|Ga0066698_11012004 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 527 | Open in IMG/M |
3300005559|Ga0066700_11036036 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 539 | Open in IMG/M |
3300005559|Ga0066700_11045973 | Not Available | 535 | Open in IMG/M |
3300005598|Ga0066706_10543607 | All Organisms → cellular organisms → Archaea | 924 | Open in IMG/M |
3300005598|Ga0066706_10819679 | Not Available | 732 | Open in IMG/M |
3300006031|Ga0066651_10007387 | All Organisms → cellular organisms → Archaea | 4329 | Open in IMG/M |
3300006034|Ga0066656_10502449 | All Organisms → cellular organisms → Archaea | 791 | Open in IMG/M |
3300006755|Ga0079222_10677709 | All Organisms → cellular organisms → Archaea | 809 | Open in IMG/M |
3300006794|Ga0066658_10173713 | All Organisms → cellular organisms → Archaea | 1118 | Open in IMG/M |
3300006794|Ga0066658_10597298 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 601 | Open in IMG/M |
3300006796|Ga0066665_10736187 | All Organisms → cellular organisms → Archaea | 780 | Open in IMG/M |
3300006796|Ga0066665_11107994 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 603 | Open in IMG/M |
3300006796|Ga0066665_11468989 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 530 | Open in IMG/M |
3300006797|Ga0066659_11121832 | Not Available | 657 | Open in IMG/M |
3300007255|Ga0099791_10430626 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 637 | Open in IMG/M |
3300007258|Ga0099793_10377691 | All Organisms → cellular organisms → Archaea | 695 | Open in IMG/M |
3300009038|Ga0099829_10291417 | All Organisms → cellular organisms → Archaea | 1337 | Open in IMG/M |
3300009038|Ga0099829_11286890 | Not Available | 605 | Open in IMG/M |
3300009038|Ga0099829_11329333 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 594 | Open in IMG/M |
3300009038|Ga0099829_11417406 | All Organisms → cellular organisms → Archaea | 574 | Open in IMG/M |
3300009088|Ga0099830_10048393 | All Organisms → cellular organisms → Archaea | 2988 | Open in IMG/M |
3300009088|Ga0099830_11537308 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 554 | Open in IMG/M |
3300009089|Ga0099828_10512475 | Not Available | 1081 | Open in IMG/M |
3300009089|Ga0099828_11602916 | Not Available | 573 | Open in IMG/M |
3300009137|Ga0066709_102115627 | All Organisms → cellular organisms → Archaea | 778 | Open in IMG/M |
3300009137|Ga0066709_102787693 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 649 | Open in IMG/M |
3300010106|Ga0127472_1083445 | All Organisms → cellular organisms → Archaea | 555 | Open in IMG/M |
3300010122|Ga0127488_1111985 | All Organisms → cellular organisms → Archaea | 888 | Open in IMG/M |
3300010132|Ga0127455_1054616 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 561 | Open in IMG/M |
3300010304|Ga0134088_10150329 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1108 | Open in IMG/M |
3300010321|Ga0134067_10133139 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 875 | Open in IMG/M |
3300010323|Ga0134086_10092264 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1064 | Open in IMG/M |
3300010335|Ga0134063_10035945 | All Organisms → cellular organisms → Archaea | 2124 | Open in IMG/M |
3300010336|Ga0134071_10231331 | All Organisms → cellular organisms → Archaea | 917 | Open in IMG/M |
3300011270|Ga0137391_10651091 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 879 | Open in IMG/M |
3300011271|Ga0137393_10098029 | All Organisms → cellular organisms → Archaea | 2388 | Open in IMG/M |
3300012189|Ga0137388_11481790 | All Organisms → cellular organisms → Archaea | 616 | Open in IMG/M |
3300012189|Ga0137388_11841214 | Not Available | 536 | Open in IMG/M |
3300012198|Ga0137364_10020214 | All Organisms → cellular organisms → Archaea | 4076 | Open in IMG/M |
3300012198|Ga0137364_10161838 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1624 | Open in IMG/M |
3300012198|Ga0137364_10913522 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 665 | Open in IMG/M |
3300012199|Ga0137383_10001705 | All Organisms → cellular organisms → Archaea | 13271 | Open in IMG/M |
3300012199|Ga0137383_11253891 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 531 | Open in IMG/M |
3300012201|Ga0137365_11104506 | All Organisms → cellular organisms → Archaea | 571 | Open in IMG/M |
3300012202|Ga0137363_10468197 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1056 | Open in IMG/M |
3300012202|Ga0137363_10681226 | All Organisms → cellular organisms → Archaea | 870 | Open in IMG/M |
3300012205|Ga0137362_10468061 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1091 | Open in IMG/M |
3300012205|Ga0137362_11416204 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 581 | Open in IMG/M |
3300012206|Ga0137380_10395570 | Not Available | 1228 | Open in IMG/M |
3300012206|Ga0137380_10615152 | All Organisms → cellular organisms → Archaea | 949 | Open in IMG/M |
3300012206|Ga0137380_10902778 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 759 | Open in IMG/M |
3300012206|Ga0137380_10967157 | Not Available | 729 | Open in IMG/M |
3300012206|Ga0137380_11278667 | All Organisms → cellular organisms → Archaea | 619 | Open in IMG/M |
3300012207|Ga0137381_11587613 | All Organisms → cellular organisms → Archaea | 545 | Open in IMG/M |
3300012209|Ga0137379_11204495 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 664 | Open in IMG/M |
3300012210|Ga0137378_10018452 | All Organisms → cellular organisms → Bacteria | 6096 | Open in IMG/M |
3300012211|Ga0137377_10525341 | All Organisms → cellular organisms → Archaea | 1121 | Open in IMG/M |
3300012349|Ga0137387_10692464 | Not Available | 738 | Open in IMG/M |
3300012351|Ga0137386_10316316 | All Organisms → cellular organisms → Archaea | 1123 | Open in IMG/M |
3300012351|Ga0137386_10427608 | All Organisms → cellular organisms → Archaea | 954 | Open in IMG/M |
3300012354|Ga0137366_10052293 | All Organisms → cellular organisms → Archaea | 3134 | Open in IMG/M |
3300012357|Ga0137384_10248563 | All Organisms → cellular organisms → Archaea | 1484 | Open in IMG/M |
3300012361|Ga0137360_10461302 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1078 | Open in IMG/M |
3300012376|Ga0134032_1130232 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
3300012384|Ga0134036_1172969 | All Organisms → cellular organisms → Archaea | 889 | Open in IMG/M |
3300012391|Ga0134035_1159415 | All Organisms → cellular organisms → Archaea | 725 | Open in IMG/M |
3300012400|Ga0134048_1259957 | All Organisms → cellular organisms → Archaea | 1328 | Open in IMG/M |
3300012405|Ga0134041_1339698 | All Organisms → cellular organisms → Archaea | 747 | Open in IMG/M |
3300012532|Ga0137373_10195373 | All Organisms → cellular organisms → Archaea | 1670 | Open in IMG/M |
3300012532|Ga0137373_10464673 | All Organisms → cellular organisms → Archaea | 972 | Open in IMG/M |
3300012918|Ga0137396_10464808 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 938 | Open in IMG/M |
3300012918|Ga0137396_11011603 | All Organisms → cellular organisms → Archaea | 601 | Open in IMG/M |
3300012918|Ga0137396_11201258 | Not Available | 534 | Open in IMG/M |
3300012922|Ga0137394_10324163 | All Organisms → cellular organisms → Archaea | 1316 | Open in IMG/M |
3300012925|Ga0137419_10810249 | All Organisms → cellular organisms → Archaea | 766 | Open in IMG/M |
3300012977|Ga0134087_10087971 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1284 | Open in IMG/M |
3300014150|Ga0134081_10151077 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 763 | Open in IMG/M |
3300014154|Ga0134075_10028823 | All Organisms → cellular organisms → Archaea | 2248 | Open in IMG/M |
3300014154|Ga0134075_10217155 | Not Available | 824 | Open in IMG/M |
3300014154|Ga0134075_10396713 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 609 | Open in IMG/M |
3300015358|Ga0134089_10002754 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 5011 | Open in IMG/M |
3300017656|Ga0134112_10176590 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 829 | Open in IMG/M |
3300017659|Ga0134083_10241056 | All Organisms → cellular organisms → Archaea | 755 | Open in IMG/M |
3300017659|Ga0134083_10257551 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 732 | Open in IMG/M |
3300017934|Ga0187803_10161567 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 881 | Open in IMG/M |
3300017934|Ga0187803_10309055 | Not Available | 632 | Open in IMG/M |
3300018431|Ga0066655_10075714 | All Organisms → cellular organisms → Archaea | 1818 | Open in IMG/M |
3300018431|Ga0066655_10247914 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1135 | Open in IMG/M |
3300018431|Ga0066655_10510964 | All Organisms → cellular organisms → Archaea | 797 | Open in IMG/M |
3300018431|Ga0066655_11326696 | Not Available | 518 | Open in IMG/M |
3300018433|Ga0066667_10118329 | All Organisms → cellular organisms → Archaea | 1805 | Open in IMG/M |
3300018433|Ga0066667_10177606 | All Organisms → cellular organisms → Archaea | 1537 | Open in IMG/M |
3300018433|Ga0066667_10315515 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1224 | Open in IMG/M |
3300018468|Ga0066662_10003282 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 7744 | Open in IMG/M |
3300018468|Ga0066662_10244727 | All Organisms → cellular organisms → Archaea | 1460 | Open in IMG/M |
3300018468|Ga0066662_10360526 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1256 | Open in IMG/M |
3300018482|Ga0066669_10000617 | All Organisms → cellular organisms → Archaea | 11866 | Open in IMG/M |
3300018482|Ga0066669_10062699 | All Organisms → cellular organisms → Archaea | 2415 | Open in IMG/M |
3300021046|Ga0215015_10161629 | All Organisms → cellular organisms → Archaea | 2074 | Open in IMG/M |
3300021046|Ga0215015_10237152 | All Organisms → cellular organisms → Archaea | 598 | Open in IMG/M |
3300021046|Ga0215015_10623781 | All Organisms → cellular organisms → Archaea | 1550 | Open in IMG/M |
3300021046|Ga0215015_10933175 | All Organisms → cellular organisms → Archaea | 838 | Open in IMG/M |
3300021086|Ga0179596_10284292 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 823 | Open in IMG/M |
3300021088|Ga0210404_10000191 | All Organisms → cellular organisms → Archaea | 38346 | Open in IMG/M |
3300022531|Ga0242660_1125715 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 651 | Open in IMG/M |
3300024330|Ga0137417_1409918 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 942 | Open in IMG/M |
3300025922|Ga0207646_10000001 | All Organisms → cellular organisms → Archaea | 1242027 | Open in IMG/M |
3300025922|Ga0207646_10033199 | All Organisms → cellular organisms → Archaea | 4670 | Open in IMG/M |
3300025922|Ga0207646_10192885 | All Organisms → cellular organisms → Archaea | 1840 | Open in IMG/M |
3300025922|Ga0207646_11013520 | All Organisms → cellular organisms → Archaea | 733 | Open in IMG/M |
3300026277|Ga0209350_1000379 | All Organisms → cellular organisms → Archaea | 26812 | Open in IMG/M |
3300026295|Ga0209234_1004837 | All Organisms → cellular organisms → Archaea | 5115 | Open in IMG/M |
3300026295|Ga0209234_1045229 | All Organisms → cellular organisms → Archaea | 1674 | Open in IMG/M |
3300026295|Ga0209234_1088940 | All Organisms → cellular organisms → Archaea | 1169 | Open in IMG/M |
3300026296|Ga0209235_1022268 | All Organisms → cellular organisms → Archaea | 3369 | Open in IMG/M |
3300026296|Ga0209235_1038169 | All Organisms → cellular organisms → Archaea | 2415 | Open in IMG/M |
3300026296|Ga0209235_1072892 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1559 | Open in IMG/M |
3300026296|Ga0209235_1276122 | All Organisms → cellular organisms → Archaea | 514 | Open in IMG/M |
3300026297|Ga0209237_1250820 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 543 | Open in IMG/M |
3300026298|Ga0209236_1044578 | All Organisms → cellular organisms → Archaea | 2256 | Open in IMG/M |
3300026301|Ga0209238_1023336 | All Organisms → cellular organisms → Archaea | 2345 | Open in IMG/M |
3300026306|Ga0209468_1103015 | All Organisms → cellular organisms → Archaea | 910 | Open in IMG/M |
3300026308|Ga0209265_1009288 | All Organisms → cellular organisms → Archaea | 3063 | Open in IMG/M |
3300026310|Ga0209239_1033562 | All Organisms → cellular organisms → Archaea | 2419 | Open in IMG/M |
3300026313|Ga0209761_1000433 | All Organisms → cellular organisms → Archaea | 25175 | Open in IMG/M |
3300026322|Ga0209687_1313930 | All Organisms → cellular organisms → Archaea | 501 | Open in IMG/M |
3300026325|Ga0209152_10094107 | All Organisms → cellular organisms → Archaea | 1121 | Open in IMG/M |
3300026328|Ga0209802_1139091 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1042 | Open in IMG/M |
3300026334|Ga0209377_1048868 | All Organisms → cellular organisms → Archaea | 1902 | Open in IMG/M |
3300026343|Ga0209159_1019542 | All Organisms → cellular organisms → Archaea | 3842 | Open in IMG/M |
3300026343|Ga0209159_1061831 | All Organisms → cellular organisms → Archaea | 1771 | Open in IMG/M |
3300026343|Ga0209159_1139627 | All Organisms → cellular organisms → Archaea | 978 | Open in IMG/M |
3300026354|Ga0257180_1040706 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 649 | Open in IMG/M |
3300026371|Ga0257179_1022056 | All Organisms → cellular organisms → Archaea | 742 | Open in IMG/M |
3300026514|Ga0257168_1034102 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1095 | Open in IMG/M |
3300026524|Ga0209690_1279085 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 527 | Open in IMG/M |
3300026528|Ga0209378_1140788 | All Organisms → cellular organisms → Archaea | 990 | Open in IMG/M |
3300026532|Ga0209160_1078681 | All Organisms → cellular organisms → Archaea | 1747 | Open in IMG/M |
3300027643|Ga0209076_1161904 | All Organisms → cellular organisms → Archaea | 623 | Open in IMG/M |
3300027842|Ga0209580_10041060 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2132 | Open in IMG/M |
3300027846|Ga0209180_10268499 | All Organisms → cellular organisms → Archaea | 980 | Open in IMG/M |
3300027846|Ga0209180_10647573 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 579 | Open in IMG/M |
3300027875|Ga0209283_10300204 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1060 | Open in IMG/M |
3300027875|Ga0209283_10523835 | Not Available | 760 | Open in IMG/M |
3300028536|Ga0137415_10086914 | All Organisms → cellular organisms → Archaea | 2983 | Open in IMG/M |
3300031720|Ga0307469_10023008 | All Organisms → cellular organisms → Archaea | 3438 | Open in IMG/M |
3300031753|Ga0307477_10000264 | All Organisms → cellular organisms → Archaea | 67575 | Open in IMG/M |
3300031753|Ga0307477_10243769 | All Organisms → cellular organisms → Archaea | 1246 | Open in IMG/M |
3300032180|Ga0307471_100037221 | All Organisms → cellular organisms → Archaea | 3845 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 23.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.16% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.34% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.06% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.06% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.03% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.03% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10055562 | 3300002557 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
JGI25381J37097_10200421 | 3300002557 | Grasslands Soil | MTDQSSNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKY |
JGI25385J37094_100098293 | 3300002558 | Grasslands Soil | MTDQSSNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
JGI25385J37094_100182603 | 3300002558 | Grasslands Soil | MTDQSSNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASS* |
JGI25385J37094_100193803 | 3300002558 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
JGI25385J37094_100622052 | 3300002558 | Grasslands Soil | MTDQASNWKIHVKKGSYEVQVEGPNPERVEKMFDELVKKYMKKIASP* |
JGI25385J37094_101516592 | 3300002558 | Grasslands Soil | MTDQAANWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYM |
JGI25385J37094_102024372 | 3300002558 | Grasslands Soil | SFGGDSYCLIHDGFYILLMPDQSGNWKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIAKP* |
JGI25383J37093_100004394 | 3300002560 | Grasslands Soil | MPDQSGNWKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIAKP* |
JGI25383J37093_100009205 | 3300002560 | Grasslands Soil | MTDQSGNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASS* |
JGI25383J37093_100574473 | 3300002560 | Grasslands Soil | MTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASQ* |
JGI25384J37096_101970931 | 3300002561 | Grasslands Soil | MTDQSANWRIHVKKGSYEVEVEGPSPERVEKMFDELVKRYMKKIASP* |
JGI25382J37095_100711111 | 3300002562 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKK |
JGI25382J37095_102671031 | 3300002562 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMK |
JGI25382J43887_101663272 | 3300002908 | Grasslands Soil | MTDQSAHWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP* |
JGI25382J43887_102417611 | 3300002908 | Grasslands Soil | MTDHSGNWKIRVKKGNYEVEVEGPTPERVEKMFDELVKKYMKRIAAP* |
JGI25388J43891_10789552 | 3300002909 | Grasslands Soil | MTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
JGI25390J43892_100882151 | 3300002911 | Grasslands Soil | RIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP* |
JGI25617J43924_100955722 | 3300002914 | Grasslands Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP* |
Ga0066674_100662261 | 3300005166 | Soil | MPDQSANWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0066674_100728611 | 3300005166 | Soil | QSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066674_104521361 | 3300005166 | Soil | MPDQSGNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0066672_105238592 | 3300005167 | Soil | MTDQAANWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066680_102585431 | 3300005174 | Soil | NWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066680_106542092 | 3300005174 | Soil | MPDQSGNWKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIA |
Ga0066688_102089682 | 3300005178 | Soil | MTDQPSNWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASS* |
Ga0066688_107687691 | 3300005178 | Soil | KIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066676_101624083 | 3300005186 | Soil | MPARLMTDQAANWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0070708_1000124605 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQAGNWKIHVKKGSYEVEVEGPTPERVEKMFDELVKKYMKKIASP* |
Ga0070708_1006610151 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
Ga0066686_110404911 | 3300005446 | Soil | SMTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066689_101608622 | 3300005447 | Soil | MTDQAVNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0070707_1000013883 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQAGNWRIHVKKGSYEVEVEGPTAERVEKMFDELVKKYMKKIASP* |
Ga0070707_1002441633 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQGANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP* |
Ga0070707_1011892662 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
Ga0070707_1019831902 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQAGNWRIHVKKGSYEVEVEGPTPERVEKMFDELVKKYMKKIASP* |
Ga0070707_1022502602 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ANWRIHVKKGSYEVEVEGPNPERVEKMFDELVRKYMKKIASP* |
Ga0066697_103684921 | 3300005540 | Soil | PARLMTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
Ga0066697_105219871 | 3300005540 | Soil | LYILLMPDQSGNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0070732_100008628 | 3300005542 | Surface Soil | MPDQSGNWRIHVKKGSYEVEVEGPTAERVEKMFDELVKKYMKKIAAP* |
Ga0066701_103712682 | 3300005552 | Soil | IHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066695_100787061 | 3300005553 | Soil | GSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066707_101134453 | 3300005556 | Soil | LYILLMPDQSANWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0066704_109357842 | 3300005557 | Soil | MTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDDLVKKYMKKIASP* |
Ga0066698_106235081 | 3300005558 | Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVK |
Ga0066698_110120042 | 3300005558 | Soil | PARLMTDQAANWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066700_110360362 | 3300005559 | Soil | IHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASS* |
Ga0066700_110459732 | 3300005559 | Soil | VKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
Ga0066706_105436073 | 3300005598 | Soil | MPDQSGNWKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIAK |
Ga0066706_108196792 | 3300005598 | Soil | KGSYEVEVEGPNHERVEKMFDELVKKYMKKIASP* |
Ga0066651_100073872 | 3300006031 | Soil | LPARLMTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
Ga0066656_105024493 | 3300006034 | Soil | MTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYM |
Ga0079222_106777093 | 3300006755 | Agricultural Soil | MTDQAGNWRIHVKKGSYEVEVEGPIAERVEKMFDELVKKYMKKIASP* |
Ga0066658_101737133 | 3300006794 | Soil | MTDQSSNWKIHVKKGSYEVEVEGPTPERVEKMFDELVKKYMKKIASP* |
Ga0066658_105972981 | 3300006794 | Soil | WKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0066665_107361873 | 3300006796 | Soil | MTDQSSNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIAS |
Ga0066665_111079941 | 3300006796 | Soil | MTDRAGSWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIAAP* |
Ga0066665_114689891 | 3300006796 | Soil | MTDQASNWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
Ga0066659_111218322 | 3300006797 | Soil | PSMTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0099791_104306262 | 3300007255 | Vadose Zone Soil | MTDLSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASS* |
Ga0099793_103776912 | 3300007258 | Vadose Zone Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASS* |
Ga0099829_102914174 | 3300009038 | Vadose Zone Soil | MTDHSSNWKIRVRKGNYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0099829_112868901 | 3300009038 | Vadose Zone Soil | MVDHSGNWKIRVKKGNYEVEVEGPTPERVEKMFDELVKKYMKRIAAP* |
Ga0099829_113293332 | 3300009038 | Vadose Zone Soil | MTDQSGSWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASS* |
Ga0099829_114174061 | 3300009038 | Vadose Zone Soil | VKKGNYEVEVEGPSPERVEKMFDELVKKYMKRIAAP* |
Ga0099830_100483932 | 3300009088 | Vadose Zone Soil | MTDQSGSWKIHVKNGSYEVEVEGPNPERVEKMFDELVKKYMKKIASS* |
Ga0099830_115373081 | 3300009088 | Vadose Zone Soil | MTGQSGNWKIRVKKGNYEVEVEGPSPERVEKMFDELVKKYMKRIAAP* |
Ga0099828_105124752 | 3300009089 | Vadose Zone Soil | MPDHIGNWKIRVKKGSQEVEVEGPAPERVEKMFDELVKKYMKKIASA* |
Ga0099828_116029161 | 3300009089 | Vadose Zone Soil | GNWKIRVKKGNYEVEVAGPTPERVEKMFDELVKKYMKKIARP* |
Ga0066709_1021156273 | 3300009137 | Grasslands Soil | MTDQSSNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIA |
Ga0066709_1027876932 | 3300009137 | Grasslands Soil | DQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0127472_10834451 | 3300010106 | Grasslands Soil | GNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0127488_11119852 | 3300010122 | Grasslands Soil | ANWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0127455_10546161 | 3300010132 | Grasslands Soil | MTDQSGNWKIHVTKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASS* |
Ga0134088_101503292 | 3300010304 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVDGPSPERVEKMFDELVKKYMKKIASP* |
Ga0134067_101331391 | 3300010321 | Grasslands Soil | MPDQSANWKIRMKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0134086_100922642 | 3300010323 | Grasslands Soil | VKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0134063_100359452 | 3300010335 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVGVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0134071_102313312 | 3300010336 | Grasslands Soil | MTDQSGNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0137391_106510911 | 3300011270 | Vadose Zone Soil | MTDQSANWRIHVKKGSYKVEVEGPNPERVEKMFDELVKRYMKKIASS* |
Ga0137393_100980292 | 3300011271 | Vadose Zone Soil | MTDQSANWRIHVKKGSYEVEVEGPSPECVEKMFDELVKRYMKKIASS* |
Ga0137388_114817902 | 3300012189 | Vadose Zone Soil | LSFPMTGQSGNWKIRVKKGNYEVEVEGPSPERVEKMFDELVKKYMKRIAAP* |
Ga0137388_118412142 | 3300012189 | Vadose Zone Soil | GNWKIRVKKGSQEVEVEGPAPERVEKMFDELVKKYMKKIASA* |
Ga0137364_100202141 | 3300012198 | Vadose Zone Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDE |
Ga0137364_101618381 | 3300012198 | Vadose Zone Soil | SGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0137364_109135221 | 3300012198 | Vadose Zone Soil | GPSMTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0137383_100017057 | 3300012199 | Vadose Zone Soil | MPDQSGNWKIRVKKGSYEVEVEGPTPERVEKMFDDLVKKYMKRIAKP* |
Ga0137383_112538912 | 3300012199 | Vadose Zone Soil | AGLPARLMTDQAANWKIHVKKGSYEVEDEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0137365_111045062 | 3300012201 | Vadose Zone Soil | MPDQGGNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0137363_104681971 | 3300012202 | Vadose Zone Soil | MTDQIANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASS* |
Ga0137363_106812261 | 3300012202 | Vadose Zone Soil | MTDQSVNWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASS* |
Ga0137362_104680611 | 3300012205 | Vadose Zone Soil | MADQSVNWRIHVKKGSYEVEVEGPSPERVEKMFDELVKRYMKKIASP* |
Ga0137362_114162042 | 3300012205 | Vadose Zone Soil | MSDQSGSWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
Ga0137380_103955703 | 3300012206 | Vadose Zone Soil | MPEHTGNWKIRVKKGNYEVEVEGPTPERVEKMFDELVKKYMKKIARP* |
Ga0137380_106151522 | 3300012206 | Vadose Zone Soil | MPGQSGNWKIRVKKGSYEVEVEGPTAERVEKMFDELVKKYMKRIAKP* |
Ga0137380_109027782 | 3300012206 | Vadose Zone Soil | MTDQGANWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0137380_109671573 | 3300012206 | Vadose Zone Soil | MTGQSGNWKIRVKKGNYEVEVEGPSPERVEKMFDELVKKYMKR |
Ga0137380_112786671 | 3300012206 | Vadose Zone Soil | MPDQTVNWKIRVKKGNYEVEVEGPTPERVEKMFDELVKKYMKKIARP* |
Ga0137381_115876133 | 3300012207 | Vadose Zone Soil | MTDQASNWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKI |
Ga0137379_112044952 | 3300012209 | Vadose Zone Soil | MTDQAANWKIHVKKGGYEVEVEGPNPERVEKMFDELVKKYMKKIASP* |
Ga0137378_100184524 | 3300012210 | Vadose Zone Soil | MHDQSGNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0137377_105253411 | 3300012211 | Vadose Zone Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDEL |
Ga0137387_106924641 | 3300012349 | Vadose Zone Soil | YHYGIYVSLMPEQSVNWKIRVKKGNYEVEVEGPSPERVEKMFDELVKKYMKKIARP* |
Ga0137386_103163162 | 3300012351 | Vadose Zone Soil | MTGQSGNWKIRVKKGNYEVEVEGPSPERVEKMFDELVKKYMNRIAAP* |
Ga0137386_104276083 | 3300012351 | Vadose Zone Soil | MPDQSGNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKY |
Ga0137366_100522934 | 3300012354 | Vadose Zone Soil | MPDQSGNCKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIAKP* |
Ga0137384_102485632 | 3300012357 | Vadose Zone Soil | MTDQAANWKIHVKKGSYEVEVEGPSPERVEKMFDEHVKKYMKKIASP* |
Ga0137360_104613022 | 3300012361 | Vadose Zone Soil | MTDQSVNWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP* |
Ga0134032_11302321 | 3300012376 | Grasslands Soil | KIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0134036_11729692 | 3300012384 | Grasslands Soil | WKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0134035_11594152 | 3300012391 | Grasslands Soil | GNWKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIAKP* |
Ga0134048_12599573 | 3300012400 | Grasslands Soil | NWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP* |
Ga0134041_13396982 | 3300012405 | Grasslands Soil | ANWKIRVKKGSYEVEVEGPTPERVEKMFDELVNKYMKRIAKP* |
Ga0137373_101953734 | 3300012532 | Vadose Zone Soil | MPEQSANWKIRVKKGSYEVEVEGPTPERVEKMFDDLVKKYMKRIAKP* |
Ga0137373_104646732 | 3300012532 | Vadose Zone Soil | DQSGNWKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIAKP* |
Ga0137396_104648082 | 3300012918 | Vadose Zone Soil | MTDQSANWRIHVKKGGYEVEVEGPNPERVEKMFDELVKRYMKKIASP* |
Ga0137396_110116032 | 3300012918 | Vadose Zone Soil | MTDPGSNWRIHVRKGSYEVEVEGPNPERVEKMFDELVKRYMKKITSP* |
Ga0137396_112012581 | 3300012918 | Vadose Zone Soil | ANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP* |
Ga0137394_103241631 | 3300012922 | Vadose Zone Soil | VKKGSYEVEVEGPNPERVEKIFDELVKRYMKKIASS* |
Ga0137419_108102491 | 3300012925 | Vadose Zone Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIA |
Ga0134087_100879712 | 3300012977 | Grasslands Soil | MTDQAANWKIHVKKGSYEVEVEGPNLERVEKMFDELVKKYMKKIASP* |
Ga0134081_101510772 | 3300014150 | Grasslands Soil | CLMTDQAANWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0134075_100288234 | 3300014154 | Grasslands Soil | MPDQSANWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIA |
Ga0134075_102171553 | 3300014154 | Grasslands Soil | MTNQSSNWKIRVRKGNYEVEVEGPAPDRVEKMFDELVKKYMKKIASP* |
Ga0134075_103967132 | 3300014154 | Grasslands Soil | VNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP* |
Ga0134089_100027546 | 3300015358 | Grasslands Soil | MPDQSANWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYM |
Ga0134112_101765902 | 3300017656 | Grasslands Soil | MTDQSGNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0134083_102410563 | 3300017659 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKIFDELVKKYMK |
Ga0134083_102575512 | 3300017659 | Grasslands Soil | MTDQSGNWKIYVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASS |
Ga0187803_101615671 | 3300017934 | Freshwater Sediment | MTDQAGNWRIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP |
Ga0187803_103090552 | 3300017934 | Freshwater Sediment | MPDQSGNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKRYMKKIASS |
Ga0066655_100757142 | 3300018431 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0066655_102479142 | 3300018431 | Grasslands Soil | MTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP |
Ga0066655_105109642 | 3300018431 | Grasslands Soil | MPDQSGNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP |
Ga0066655_113266962 | 3300018431 | Grasslands Soil | MPDQSANWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP |
Ga0066667_101183293 | 3300018433 | Grasslands Soil | MPDQSGNWKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIAKP |
Ga0066667_101776063 | 3300018433 | Grasslands Soil | MTDQSSNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0066667_103155152 | 3300018433 | Grasslands Soil | MTDQAANWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0066662_100032826 | 3300018468 | Grasslands Soil | MTDQSGNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASS |
Ga0066662_102447271 | 3300018468 | Grasslands Soil | MTDQAVNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0066662_103605261 | 3300018468 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP |
Ga0066669_100006179 | 3300018482 | Grasslands Soil | LPARLMTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP |
Ga0066669_100626993 | 3300018482 | Grasslands Soil | LYILLMPDQSANWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP |
Ga0215015_101616291 | 3300021046 | Soil | VKKGSYEVAVEGPNPERVEKMFDELVKKYMKKIAAP |
Ga0215015_102371521 | 3300021046 | Soil | MTDQAPNWRIHVKKGSYEVAVEGPNPERVEKMFDELVKKYMKKIASP |
Ga0215015_106237812 | 3300021046 | Soil | MTDQAPNWRIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP |
Ga0215015_109331752 | 3300021046 | Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP |
Ga0179596_102842922 | 3300021086 | Vadose Zone Soil | HVKKGSYEVEVEGPNPERVEKMFHELVKRYMKKIASP |
Ga0210404_1000019126 | 3300021088 | Soil | MTDQAPNWRIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASS |
Ga0242660_11257151 | 3300022531 | Soil | PNWRIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASS |
Ga0137417_14099181 | 3300024330 | Vadose Zone Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASS |
Ga0207646_10000001522 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQAGNWRIHVKKGSYEVEVEGPTAERVEKMFDELVKKYMKKIASP |
Ga0207646_100331994 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVRKYMKKIASP |
Ga0207646_101928851 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PMTDQGANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP |
Ga0207646_110135201 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQGANWRIHVKKGSYEVEVEGPNPERVEKMFDELVK |
Ga0209350_10003798 | 3300026277 | Grasslands Soil | MTDQASNWKIHVKKGSYEVQVEGPNPERVEKMFDELVKKYMKKIASP |
Ga0209234_10048371 | 3300026295 | Grasslands Soil | WKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209234_10452293 | 3300026295 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKK |
Ga0209234_10889403 | 3300026295 | Grasslands Soil | MTDQSSNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKK |
Ga0209235_10222684 | 3300026296 | Grasslands Soil | MTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASQ |
Ga0209235_10381694 | 3300026296 | Grasslands Soil | MTDQSSNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASS |
Ga0209235_10728922 | 3300026296 | Grasslands Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVRRYMKKIASP |
Ga0209235_12761221 | 3300026296 | Grasslands Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKY |
Ga0209237_12508201 | 3300026297 | Grasslands Soil | NWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209236_10445783 | 3300026298 | Grasslands Soil | KIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209238_10233363 | 3300026301 | Grasslands Soil | MTDQVANWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209468_11030153 | 3300026306 | Soil | MTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIA |
Ga0209265_10092882 | 3300026308 | Soil | LYILLMPDQSGNWKIRVKKGSYEVEVEGPTPERVEKMFDELVKKYMKRIAKP |
Ga0209239_10335622 | 3300026310 | Grasslands Soil | MTDQSANWRIHVKKGSYEVEVEGPSPERVEKMFDELVKRYMKKIASP |
Ga0209761_100043314 | 3300026313 | Grasslands Soil | LPARLMTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASQ |
Ga0209687_13139302 | 3300026322 | Soil | MTDQAANWKIHVKKGSYEVEVEGPSPERVEKMFDELV |
Ga0209152_100941073 | 3300026325 | Soil | MTDQSSNWKIHVKKGSYEVEVEGPTPERVEKMFDELVKKYMKKIASP |
Ga0209802_11390912 | 3300026328 | Soil | FMTDQAVNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209377_10488683 | 3300026334 | Soil | VKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209159_10195425 | 3300026343 | Soil | GLPARLMTDQAVNWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209159_10618311 | 3300026343 | Soil | QSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209159_11396273 | 3300026343 | Soil | MTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKI |
Ga0257180_10407062 | 3300026354 | Soil | ANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP |
Ga0257179_10220561 | 3300026371 | Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYM |
Ga0257168_10341022 | 3300026514 | Soil | MPDQSATWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP |
Ga0209690_12790852 | 3300026524 | Soil | GPSMTDQSGSWKIHVKKGSYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0209378_11407882 | 3300026528 | Soil | DQSGNWKIRVKKGSYEVEVEGPTPERVERMFDELVKKYMKRIAKP |
Ga0209160_10786812 | 3300026532 | Soil | MTDQAANWKIHVKKGSYEVEVEGPNPERVEKMFDDLVKKYMKKIASP |
Ga0209076_11619042 | 3300027643 | Vadose Zone Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELV |
Ga0209580_100410602 | 3300027842 | Surface Soil | MPDQSGNWRIHVKKGSYEVEVEGPTAERVEKMFDELVKKYMKKIAAP |
Ga0209180_102684992 | 3300027846 | Vadose Zone Soil | MTGQSGNWKIRVKKGNYEVEVEGPSPERVEKMFDELVKKYMKRIAAP |
Ga0209180_106475732 | 3300027846 | Vadose Zone Soil | MTDQSGSWKIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASS |
Ga0209283_103002042 | 3300027875 | Vadose Zone Soil | SANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIASP |
Ga0209283_105238353 | 3300027875 | Vadose Zone Soil | MTDHSSNWKIRVRKGNYEVEVEGPSPERVEKMFDELVKKYMKKIASP |
Ga0137415_100869144 | 3300028536 | Vadose Zone Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKRYMKKIAS |
Ga0307469_100230083 | 3300031720 | Hardwood Forest Soil | MTDQSANWRIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP |
Ga0307477_1000026451 | 3300031753 | Hardwood Forest Soil | VKKGSYEVEVEGPTAERVEKMFDELVKKYMKKIAAP |
Ga0307477_102437692 | 3300031753 | Hardwood Forest Soil | MTDQAGNWRIHVKKGSYEVEVEGPTAERVERMFDELVKKYMKKIASP |
Ga0307471_1000372212 | 3300032180 | Hardwood Forest Soil | MADQAPNWRIHVKKGSYEVEVEGPNPERVEKMFDELVKKYMKKIASP |
⦗Top⦘ |