Metagenome Family F027067

Overview

Basic Information

• Family ID: F027067
• Family Type: Metagenome
• Number of Sequences: 195
• Average Sequence Length: 35 residues
• Representative Sequence: MGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSR
• Number of Associated Samples: 19
• Number of Associated Scaffolds: 191

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Eukaryota
• % of genes with valid RBS motifs: 42.05 %
• % of genes near scaffold ends (potentially truncated): 8.21 %
• % of genes from short scaffolds (< 2000 bps): 41.54 %
• Associated GOLD sequencing projects: 19
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Eukaryota (39.487 % of family members)
• NCBI Taxonomy ID: 2759
• Taxonomy: All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (75.897 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (66.154 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 50.79%
  β-sheet: 0.00%
  Coil/Unstructured: 49.21%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 191 Family Scaffolds
PF00078	RVT_1	5.76
PF03732	Retrotrans_gag	5.24
PF00665	rve	3.66
PF14372	DUF4413	1.57
PF09337	zf-H2C2	1.05
PF14392	zf-CCHC_4	1.05
PF13639	zf-RING_2	0.52
PF00612	IQ	0.52
PF14244	Retrotran_gag_3	0.52
PF14833	NAD_binding_11	0.52
PF13292	DXP_synthase_N	0.52
PF00098	zf-CCHC	0.52
PF13961	DUF4219	0.52
PF07727	RVT_2	0.52
PF00626	Gelsolin	0.52
PF00069	Pkinase	0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 191 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	3.66
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	3.66
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	3.66
COG4584	Transposase	Mobilome: prophages, transposons [X]	3.66
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.09

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.82 %
Unclassified	root	N/A	27.18 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.82 %
Unclassified	root	N/A	27.18 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	39.49 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	33.33 %
Unclassified	root	N/A	27.18 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	36.41 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	32.31 %
Unclassified	root	N/A	27.18 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.03 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	36.41 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	32.31 %
Unclassified	root	N/A	27.18 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.03 %

Level 6

Name	Rank	Taxonomy	Distribution
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	32.31 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	31.79 %
Unclassified	root	N/A	27.18 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	1.03 %

Level 7

Name	Rank	Taxonomy	Distribution
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	32.31 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	31.79 %
Unclassified	root	N/A	27.18 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	1.03 %

Level 8

Name	Rank	Taxonomy	Distribution
Klebsiella/Raoultella group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group	32.31 %
Unclassified	root	N/A	27.18 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	26.15 %
Lactobacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae	1.03 %

Level 9

Name	Rank	Taxonomy	Distribution
Klebsiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella	32.31 %
Unclassified	root	N/A	27.18 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	26.15 %
Weissella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella	1.03 %

Level 10

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	26.15 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Level 11

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	26.15 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Level 12

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Level 13

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Level 14

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Level 15

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Level 16

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	21.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Level 17

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	20.00 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %

Level 18

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	16.92 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	2.56 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Rosales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales	0.51 %

Level 19

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	16.92 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	2.56 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Level 20

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	14.36 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	2.56 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Level 21

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	12.82 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	2.56 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	1.54 %
Salix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Level 22

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Level 23

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Level 24

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Level 25

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Level 26

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Level 27

Name	Rank	Taxonomy	Distribution
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	32.31 %
Unclassified	root	N/A	27.18 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	10.77 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	2.56 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	1.54 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.03 %
Salix suchowensis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	0.51 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.51 %
Salix purpurea	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	0.51 %
Salix viminalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	0.51 %
Rosaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	0.51 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300028786|Ga0307517_10003520	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24339
3300028786|Ga0307517_10007106	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16420
3300028786|Ga0307517_10014937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10370
3300028786|Ga0307517_10015549	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	10101
3300028786|Ga0307517_10017899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	9198
3300028786|Ga0307517_10019523	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8688
3300028786|Ga0307517_10024927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	7341
3300028786|Ga0307517_10028812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	6594
3300028786|Ga0307517_10028812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	6594
3300028786|Ga0307517_10029999	Not Available	6394
3300028786|Ga0307517_10033684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5868
3300028786|Ga0307517_10033684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5868
3300028786|Ga0307517_10035593	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5631
3300028786|Ga0307517_10039133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5220
3300028786|Ga0307517_10042036	Not Available	4916
3300028786|Ga0307517_10042329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	4888
3300028786|Ga0307517_10043566	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	4775
3300028786|Ga0307517_10046197	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4553
3300028786|Ga0307517_10049752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4279
3300028786|Ga0307517_10052993	Not Available	4050
3300028786|Ga0307517_10057862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3746
3300028786|Ga0307517_10060002	Not Available	3630
3300028786|Ga0307517_10062708	Not Available	3490
3300028786|Ga0307517_10075204	Not Available	2965
3300028786|Ga0307517_10090004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2521
3300028786|Ga0307517_10101439	Not Available	2265
3300028786|Ga0307517_10107665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2145
3300028786|Ga0307517_10119330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1958
3300028786|Ga0307517_10123594	Not Available	1900
3300028786|Ga0307517_10150263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1600
3300028786|Ga0307517_10168248	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1449
3300028786|Ga0307517_10183277	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1346
3300028786|Ga0307517_10262428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1001
3300028786|Ga0307517_10308661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	882
3300028786|Ga0307517_10326120	Not Available	846
3300028786|Ga0307517_10341085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	818
3300028786|Ga0307517_10356076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	792
3300028786|Ga0307517_10483890	Not Available	633
3300028786|Ga0307517_10489276	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	628
3300028786|Ga0307517_10511616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	608
3300028794|Ga0307515_10008752	All Organisms → cellular organisms → Eukaryota	19670
3300028794|Ga0307515_10008857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19538
3300028794|Ga0307515_10015500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	14037
3300028794|Ga0307515_10040611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7350
3300028794|Ga0307515_10041073	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7287
3300028794|Ga0307515_10042561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7098
3300028794|Ga0307515_10059040	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	5507
3300028794|Ga0307515_10063854	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	5160
3300028794|Ga0307515_10068486	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	4874
3300028794|Ga0307515_10087479	Not Available	3953
3300028794|Ga0307515_10088911	All Organisms → cellular organisms → Eukaryota	3897
3300028794|Ga0307515_10113276	Not Available	3146
3300028794|Ga0307515_10132070	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2742
3300028794|Ga0307515_10139058	Not Available	2617
3300028794|Ga0307515_10141785	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2572
3300028794|Ga0307515_10147561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	2481
3300028794|Ga0307515_10194094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1929
3300028794|Ga0307515_10200749	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1870
3300028794|Ga0307515_10202829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1853
3300028794|Ga0307515_10224455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1687
3300028794|Ga0307515_10238873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1592
3300028794|Ga0307515_10376214	Not Available	1054
3300028794|Ga0307515_10478007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	858
3300028794|Ga0307515_10635375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	679
3300028794|Ga0307515_10709053	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	622
3300028794|Ga0307515_10769167	Not Available	583
3300030521|Ga0307511_10007543	All Organisms → cellular organisms → Eukaryota	10941
3300030521|Ga0307511_10018726	Not Available	6603
3300030521|Ga0307511_10018844	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6582
3300030521|Ga0307511_10036649	Not Available	4254
3300030521|Ga0307511_10043427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	3756
3300030521|Ga0307511_10045906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3603
3300030521|Ga0307511_10046478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3569
3300030521|Ga0307511_10051825	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3282
3300030521|Ga0307511_10068201	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2629
3300030521|Ga0307511_10123563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1589
3300030521|Ga0307511_10143283	Not Available	1396
3300030521|Ga0307511_10153508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1314
3300030521|Ga0307511_10186912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1103
3300030521|Ga0307511_10188026	Not Available	1097
3300030522|Ga0307512_10011015	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8589
3300030522|Ga0307512_10036052	Not Available	4202
3300030522|Ga0307512_10070240	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2610
3300030522|Ga0307512_10172376	Not Available	1237
3300030522|Ga0307512_10179860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1191
3300030522|Ga0307512_10317996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	710
3300030522|Ga0307512_10323069	Not Available	700
3300030522|Ga0307512_10404582	Not Available	571
3300031456|Ga0307513_10003889	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	20090
3300031456|Ga0307513_10011786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	10840
3300031456|Ga0307513_10046647	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	4720
3300031456|Ga0307513_10051548	All Organisms → cellular organisms → Eukaryota	4438
3300031456|Ga0307513_10056271	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae	4200
3300031456|Ga0307513_10063654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3891
3300031456|Ga0307513_10117399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2638
3300031456|Ga0307513_10118648	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2619
3300031456|Ga0307513_10181890	Not Available	1964
3300031456|Ga0307513_10260488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1524
3300031456|Ga0307513_10321749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1304
3300031456|Ga0307513_10337962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1257
3300031456|Ga0307513_10411449	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1084
3300031456|Ga0307513_10432751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1043
3300031456|Ga0307513_10753349	Not Available	679
3300031456|Ga0307513_10787396	Not Available	656
3300031456|Ga0307513_10901642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	591
3300031507|Ga0307509_10049541	Not Available	4502
3300031507|Ga0307509_10157613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2173
3300031507|Ga0307509_10161351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2138
3300031507|Ga0307509_10244008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1586
3300031507|Ga0307509_10285436	Not Available	1408
3300031507|Ga0307509_10350562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1199
3300031507|Ga0307509_10369787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1150
3300031507|Ga0307509_10525346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	864
3300031507|Ga0307509_10571896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	805
3300031507|Ga0307509_10872686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	564
3300031616|Ga0307508_10285349	Not Available	1244
3300031616|Ga0307508_10316396	Not Available	1153
3300031616|Ga0307508_10396833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	970
3300031616|Ga0307508_10602113	Not Available	700
3300031616|Ga0307508_10635792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	671
3300031649|Ga0307514_10051738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3180
3300031649|Ga0307514_10060104	Not Available	2901
3300031649|Ga0307514_10084273	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	2339
3300031649|Ga0307514_10087094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2289
3300031649|Ga0307514_10106543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	1998
3300031649|Ga0307514_10135342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1687
3300031649|Ga0307514_10152486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1547
3300031649|Ga0307514_10214772	Not Available	1188
3300031649|Ga0307514_10261800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1011
3300031649|Ga0307514_10267453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	993
3300031649|Ga0307514_10560075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	524
3300031730|Ga0307516_10011239	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix purpurea	9757
3300031730|Ga0307516_10101136	Not Available	2698
3300031730|Ga0307516_10120321	Not Available	2417
3300031730|Ga0307516_10528552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	833
3300031730|Ga0307516_10741160	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	641
3300031730|Ga0307516_10847523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	577
3300031838|Ga0307518_10150817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1608
3300031838|Ga0307518_10395902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	773
3300031838|Ga0307518_10619146	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	510
3300032354|Ga0325403_1000738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	24731
3300032354|Ga0325403_1002535	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16239
3300032354|Ga0325403_1003557	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	14257
3300032354|Ga0325403_1003558	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14256
3300032354|Ga0325403_1004906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	12526
3300032354|Ga0325403_1005849	Not Available	11639
3300032354|Ga0325403_1005849	Not Available	11639
3300032354|Ga0325403_1010913	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8635
3300032354|Ga0325403_1012288	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8093
3300032354|Ga0325403_1012345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	8071
3300032354|Ga0325403_1013574	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7658
3300032354|Ga0325403_1016223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6913
3300032354|Ga0325403_1021078	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5868
3300032354|Ga0325403_1025473	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	5148
3300032354|Ga0325403_1026198	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5050
3300032354|Ga0325403_1040578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis	3574
3300032354|Ga0325403_1040666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	3568
3300032354|Ga0325403_1045092	Not Available	3243
3300032354|Ga0325403_1049292	Not Available	2972
3300032354|Ga0325403_1051250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2851
3300032354|Ga0325403_1051278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	2850
3300032354|Ga0325403_1054779	Not Available	2658
3300032354|Ga0325403_1068476	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2052
3300032354|Ga0325403_1076861	All Organisms → cellular organisms → Eukaryota	1760
3300032354|Ga0325403_1099210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1200
3300032354|Ga0325403_1105736	Not Available	1083
3300032354|Ga0325403_1126241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	829
3300032355|Ga0325401_1014871	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	7431
3300032355|Ga0325401_1079327	Not Available	2051
3300032389|Ga0325405_1001089	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	27364
3300032389|Ga0325405_1004131	Not Available	14872
3300032389|Ga0325405_1004131	Not Available	14872
3300032389|Ga0325405_1025754	Not Available	4822
3300032389|Ga0325405_1027838	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	4517
3300032389|Ga0325405_1050699	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2482
3300032389|Ga0325405_1076697	Not Available	1351
3300032389|Ga0325405_1111189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	710
3300032389|Ga0325405_1123427	Not Available	577
3300032389|Ga0325405_1127537	Not Available	542
3300032390|Ga0325404_1004466	Not Available	14872
3300032390|Ga0325404_1020215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5956
3300032735|Ga0325410_1011461	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis	9220
3300032735|Ga0325410_1047068	All Organisms → cellular organisms → Eukaryota	2682
3300033179|Ga0307507_10017617	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8191
3300033179|Ga0307507_10059741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3566
3300033179|Ga0307507_10105257	Not Available	2336
3300033179|Ga0307507_10237444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1198
3300033179|Ga0307507_10627701	Not Available	549
3300033180|Ga0307510_10239808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	1308
3300033180|Ga0307510_10267175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1188
3300033180|Ga0307510_10277407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	1148
3300034389|Ga0325419_036000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	3597
3300034389|Ga0325419_047475	Not Available	2606
3300034389|Ga0325419_110427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	723
3300034688|Ga0325420_047768	Not Available	2701

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	75.90%
Wood	Host-Associated → Plants → Wood	22.05%
Phylloplane	Host-Associated → Plants → Phylloplane	2.05%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	75.90%
Unclassified	Host-Associated → Plants → Wood → Unclassified	22.05%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	2.05%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	75.90%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	22.05%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	2.05%

Habitat

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	75.90%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	22.05%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	2.05%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated
3300034688	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_1000352022	3300028786	Ectomycorrhiza	MGKALNGSFVVGLLEFGLIMQISKEIDVVYGQNNR
Ga0307517_100071069	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDVVYCQNSR
Ga0307517_100149375	3300028786	Ectomycorrhiza	MGKALNGSFDVRLLEFVLIMQISEEIDDVYGQNIR
Ga0307517_100155491	3300028786	Ectomycorrhiza	MGKTLNGSFDAGLHEFGLIMQISEGIDVVYGQNSK
Ga0307517_100178999	3300028786	Ectomycorrhiza	MGKSLNGSFDAGLLEFGLIMQISEGINVVYSQNSK
Ga0307517_100195236	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQINEEIDAVYGQNSR
Ga0307517_100249272	3300028786	Ectomycorrhiza	MGKALNGSFNVGLLVFGLIMQISKEIDVVYGQNSR
Ga0307517_1002881210	3300028786	Ectomycorrhiza	MGKALNGSFDVALLEFGLIIQISEEIDVVYGQNSR
Ga0307517_100288125	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVCGQKSR
Ga0307517_100299995	3300028786	Ectomycorrhiza	MGKALNGSFDIGLLEFGLIMQLSEEIDGVYGQNSR
Ga0307517_100336842	3300028786	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQISEEIDAVYGQNSR
Ga0307517_100336844	3300028786	Ectomycorrhiza	MRKALNGSFDVGLLEFGLIMQINEEIDAVYGQNSR
Ga0307517_100355937	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFWMIMQISEGIDVVYDQNSK
Ga0307517_100391332	3300028786	Ectomycorrhiza	MGKALNGSFNVGLLVFGLIMQISEEIGAVYGQNSR
Ga0307517_100420363	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEVIDTVYGQNSKRI
Ga0307517_100423295	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDAVYDQNSR
Ga0307517_100435665	3300028786	Ectomycorrhiza	MRKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSR
Ga0307517_100461974	3300028786	Ectomycorrhiza	MGKALNVSFDVGLLEFGLIMQIREEIDAVYGHNSR
Ga0307517_100497525	3300028786	Ectomycorrhiza	MGKALNGSFDVGLFEFGLIMQISEGIGVVYSQNSK
Ga0307517_100529933	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307517_100578627	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGINVVYGQNSK
Ga0307517_100600021	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIIQISEGIDAIYGQNSR
Ga0307517_100627085	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLVMQIIKRIDVVYYYNNR
Ga0307517_100752044	3300028786	Ectomycorrhiza	VGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSR
Ga0307517_100900042	3300028786	Ectomycorrhiza	MGKALNGSLDAGLLEFGLIMQISEGIDVVYDQKSK
Ga0307517_101014393	3300028786	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQISEEIDVVYDQNSR
Ga0307517_101076652	3300028786	Ectomycorrhiza	MEKTLNGSFDVGLLEFGLIMQISKEIDAVYDQNSR
Ga0307517_101193302	3300028786	Ectomycorrhiza	MGKPLNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307517_101235944	3300028786	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEAIDVVYSQNSK
Ga0307517_101502631	3300028786	Ectomycorrhiza	MGKAFNGFLDAGLLEFELIMQISEGIDVVYSQNSK
Ga0307517_101682482	3300028786	Ectomycorrhiza	MGKALNGSFDIGLLEFGLIMQISEGVDVVYCQNSR
Ga0307517_101832773	3300028786	Ectomycorrhiza	MGKALNGSFDAGPLEFGLIMQISEGIDVVYGQNSR
Ga0307517_102624282	3300028786	Ectomycorrhiza	MEKALNGSFDAGLLELGLIMQISEGIDVVYSQNSK
Ga0307517_103086611	3300028786	Ectomycorrhiza	MGKTLNGSLDAGLLEFGLIMQISEGIDAVYGHNSN
Ga0307517_103261202	3300028786	Ectomycorrhiza	MEKALNGSFDVELLEFGLIMQINEEIDDVYGQNSR
Ga0307517_103410852	3300028786	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSRCF
Ga0307517_103560761	3300028786	Ectomycorrhiza	MGKAFNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307517_104838901	3300028786	Ectomycorrhiza	MGKALNGSFNAGLLEFGLIMQISEGINVVYGQNSK
Ga0307517_104892762	3300028786	Ectomycorrhiza	MGKALDGSFDVGLLEFGLIMQISEEIDAIYCQNSRCI
Ga0307517_105116161	3300028786	Ectomycorrhiza	MGKTLNGSFDAGLLEFGLIMQISEEIDAVYSQNSK
Ga0307515_100087529	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLRVQISEEIDVVYCQNSR
Ga0307515_1000885716	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGHNSK
Ga0307515_100155003	3300028794	Ectomycorrhiza	MGKALNGSFNAGLLEFGLIMQISKGINVVYGQNSK
Ga0307515_100406113	3300028794	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSR
Ga0307515_100410733	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDAVYGQNSR
Ga0307515_100425612	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLVMQIIKRIDVVYYHNNR
Ga0307515_100590408	3300028794	Ectomycorrhiza	MGKGLNDSFDVGLLEFGLIMQTSEEIYAVYGQNSR
Ga0307515_100638543	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISKGIDVVYGQNSK
Ga0307515_100684864	3300028794	Ectomycorrhiza	MGKSLNGSFDAGLVEFGLIMQINEGINVVYSQNSK
Ga0307515_100874794	3300028794	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQISKEIDVVYGQNSR
Ga0307515_100889115	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLITQISEEIDAVYGQNSR
Ga0307515_101132763	3300028794	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDAVYGHNSR
Ga0307515_101320702	3300028794	Ectomycorrhiza	MEKALNGFFDAGLLEFGLIMQISEEIDAVYGQISR
Ga0307515_101390581	3300028794	Ectomycorrhiza	MEKTLNGSFNIALLEFELIMQISEEIDAIYGQNNR
Ga0307515_101417854	3300028794	Ectomycorrhiza	LPTIGNLEMGKALNGYFDVGLLEFGLIMQISKGIDVVYGQKNK
Ga0307515_101475615	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGKNNK
Ga0307515_101940942	3300028794	Ectomycorrhiza	MGKSLNGSFDAGLVEFGLIMQISEGINVVYSQNSK
Ga0307515_102007491	3300028794	Ectomycorrhiza	LNLEMGLEMGKALNGSFDAGLLEFGLIMQISEGIDAVYGQNSR
Ga0307515_102028292	3300028794	Ectomycorrhiza	MGKALNGSFEAGLLEFGLIMQISEGIDAVCGQKSR
Ga0307515_102244551	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSK
Ga0307515_102388732	3300028794	Ectomycorrhiza	MGKALDVSFDVGLLEFGLIMQISEEIDAVYGHNSR
Ga0307515_103762141	3300028794	Ectomycorrhiza	MEKTLNGSFDVRLLVFGLIMQISEEIDVVYGQNSR
Ga0307515_104780072	3300028794	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSR
Ga0307515_106353751	3300028794	Ectomycorrhiza	LDTGKALNGSFDVGLLEFGLIIQISEEIDVVYGQNK
Ga0307515_107090531	3300028794	Ectomycorrhiza	MGKALNGSFDDGLLEFGLIMQISEGIDVVYGQNSK
Ga0307515_107691672	3300028794	Ectomycorrhiza	MKKALNGSFDVELLEFGLIMQINEEIDAVYGQNSK
Ga0307511_1000754314	3300030521	Ectomycorrhiza	LPTIGNLEMGKALNGYFDVGLLEFGLIMQISKGIDVVYGQNNK
Ga0307511_100187266	3300030521	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIYAVYGQKSR
Ga0307511_100188441	3300030521	Ectomycorrhiza	LDIGKALNGSFDVELLEFGLIMQISEEIDVVYGQNSR
Ga0307511_100366492	3300030521	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDTVYGQNNKSI
Ga0307511_100434271	3300030521	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGHNSK
Ga0307511_100459064	3300030521	Ectomycorrhiza	MRKALNGSFDAGLLEFGLIMQISEGIDAVYGQNNR
Ga0307511_100464783	3300030521	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAIYGQNSR
Ga0307511_100518255	3300030521	Ectomycorrhiza	MEKALNGSFDVGLLEYGLIMQISKEIDVVYGQNSR
Ga0307511_100682015	3300030521	Ectomycorrhiza	MGKAFNGSFHAGLLEFELIMQISEGIDVVYSQNSK
Ga0307511_101235632	3300030521	Ectomycorrhiza	MRKALNGFFDVGLLEFGLIMQISEEIDFVYGQNSR
Ga0307511_101432831	3300030521	Ectomycorrhiza	MGKALNGSFDARLLEFGLIMQISEGIDVVYSQNSK
Ga0307511_101535082	3300030521	Ectomycorrhiza	MGKALNGSFEVGLLEFGLIIQISEEIDAVYGQNSR
Ga0307511_101869122	3300030521	Ectomycorrhiza	MGKALNDSIDAGLLKFGVDMQISEGIDVVYGQNNK
Ga0307511_101880263	3300030521	Ectomycorrhiza	MRKTLNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307512_100110156	3300030522	Ectomycorrhiza	LDTGKALNGSFDVRLLEFVLIMQISEEIDDVYGQNIR
Ga0307512_100360522	3300030522	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDTVYGQNSKSI
Ga0307512_100702401	3300030522	Ectomycorrhiza	LDMEKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSR
Ga0307512_101723761	3300030522	Ectomycorrhiza	MRKALNGSFDVGLLEFGLIMQISEEIDFVYGQNSR
Ga0307512_101798602	3300030522	Ectomycorrhiza	MGKTLNGSFDVRLLVFGLIMQISEEIDVVYGQNSR
Ga0307512_103179962	3300030522	Ectomycorrhiza	MGKALNGYFDVGLLEFGLIMQISKGIDVVYDQNNK
Ga0307512_103230691	3300030522	Ectomycorrhiza	MEKTLNGSFNIALLEFELIMQISEEIDAIYGQNNRXIXTRFXN
Ga0307512_104045821	3300030522	Ectomycorrhiza	MGKALNSYFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307513_1000388913	3300031456	Ectomycorrhiza	MGKALNSSFDVGLLEFGLITQISEEIDAVYGQDSR
Ga0307513_1001178615	3300031456	Ectomycorrhiza	MGKAFNGSFDIGLLEFGLIMQLSEEIDGVYGQNSR
Ga0307513_100466475	3300031456	Ectomycorrhiza	MGKALNGSFDIGLLEFGLIMQLSEEIDVVYGQNSR
Ga0307513_100515481	3300031456	Ectomycorrhiza	NLEMGKALNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307513_100562712	3300031456	Ectomycorrhiza	MEKALNGSFDVGLLEFGLVMQIIKRIDVVYYHNNI
Ga0307513_100636545	3300031456	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISERIDAVYGQNSK
Ga0307513_101173991	3300031456	Ectomycorrhiza	MGKAFNGSFDAGLLEFELIMQISEGIDVVYSQNSK
Ga0307513_101186481	3300031456	Ectomycorrhiza	MEKALNGSFDVGLLEFGLIMQINEEIDAVYGQNSR
Ga0307513_101818903	3300031456	Ectomycorrhiza	MKKALNGSFDVELLEFGLIMQINEEIDAVYGQNSKXI
Ga0307513_102604883	3300031456	Ectomycorrhiza	MRKALNGSFDAGLLEFGLIMQISEGIDVVYSQNSK
Ga0307513_103217491	3300031456	Ectomycorrhiza	MGKAINGSFNVGLLVFGLIMQISEEIGAVYGQNSR
Ga0307513_103379622	3300031456	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGQKSR
Ga0307513_104114492	3300031456	Ectomycorrhiza	MGKALNGSFDAGLLEFWMIMQISEGIDVVYDHNSK
Ga0307513_104327511	3300031456	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIIQISEGIDAIYGHNSR
Ga0307513_107533491	3300031456	Ectomycorrhiza	MGKTLNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307513_107873962	3300031456	Ectomycorrhiza	MGKALNGYFDVGLLEFGLIMQISKGIDVVYGQKNK
Ga0307513_109016422	3300031456	Ectomycorrhiza	MGKALNDSIDAGLLKFGVDMQISEGIDAVYGQNNK
Ga0307509_100495412	3300031507	Ectomycorrhiza	LPTIGNLEMGKALNGYFDAGLLEFGLIMQISKGIDVVYGQNNK
Ga0307509_101576132	3300031507	Ectomycorrhiza	MEKTLNGSFNIELLEFGLIMQISEEIDVVYGQNNR
Ga0307509_101613512	3300031507	Ectomycorrhiza	MGKTLNGSFDAGLLEFGLIMQISKGIDVVYGQNSK
Ga0307509_102440081	3300031507	Ectomycorrhiza	MGKALNGSFDVELLEFGLIMQISEEIDVVYGQNSR
Ga0307509_102854363	3300031507	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGINAVYGQNSK
Ga0307509_103505621	3300031507	Ectomycorrhiza	MGKTLNGSFDAGLLEFGLIMQISEGIDAVYSQNSK
Ga0307509_103697873	3300031507	Ectomycorrhiza	MGKALNGSFDVGLLEFGLITQISEGIDAIYSQNSR
Ga0307509_105253462	3300031507	Ectomycorrhiza	MRKALNGSFDVRLLEFGLIMQISEEIDDVYGQNIR
Ga0307509_105718962	3300031507	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVIYGQNSR
Ga0307509_108726862	3300031507	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEEIDVVYGQNSR
Ga0307508_102853491	3300031616	Ectomycorrhiza	LNLEMGLEMGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSR
Ga0307508_103163961	3300031616	Ectomycorrhiza	MEKALNDSFDVELLEFGLIMQINEEIDVVYIQNSR
Ga0307508_103968332	3300031616	Ectomycorrhiza	MGKALNGSFDVRLLVFGLIMQISEEIDVVYGQNSR
Ga0307508_106021131	3300031616	Ectomycorrhiza	NWNLEMGKTLNGSFDAGLHEFGLIMQISEGIDVVYGQNSK
Ga0307508_106357923	3300031616	Ectomycorrhiza	MRKALNGSFYVRLLEFGLIMQISEEIDDVYGQNIR
Ga0307514_100517381	3300031649	Ectomycorrhiza	NLNMEKALNGSFDVGLLEFGLIMQISEEIDVVYGQNSR
Ga0307514_100601046	3300031649	Ectomycorrhiza	MGKALNGSFDVGLLEFGLVMQIIKIIDVVYYHNNR
Ga0307514_100842733	3300031649	Ectomycorrhiza	YNWNLEMGKALNGSFDAGLLEFGLIMQISEGIDTVYG
Ga0307514_100870943	3300031649	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYDQNSK
Ga0307514_101065431	3300031649	Ectomycorrhiza	MRKALNGSFDVGLLKFGLIMQINEEIDAVYGQNSR
Ga0307514_101353423	3300031649	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIMQISEEIDGVYGQNSR
Ga0307514_101524863	3300031649	Ectomycorrhiza	MGKALNGSFDAGLLEFWMIMQISEGIDVVYGQNSK
Ga0307514_102147721	3300031649	Ectomycorrhiza	DMEKALNGSFDVGLLEFGLIMQISEEIDAVYGQNSR
Ga0307514_102618001	3300031649	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISKGIDVVYGRNSK
Ga0307514_102674532	3300031649	Ectomycorrhiza	MGKALNGSFDVRLLEFGLIMQISEEIDDVYGQNIR
Ga0307514_105600751	3300031649	Ectomycorrhiza	MGKAFNGSFDAGLLEFELIMQISEGIDVVYSQNSKXIXTQI
Ga0307516_100112397	3300031730	Ectomycorrhiza	MGKALNGSFDVGLLEFGLIVQISEEIDVVYCQNSR
Ga0307516_101011361	3300031730	Ectomycorrhiza	NLDMRKALNGSFDVRLLEFGLIIQISEEIDDVYGQNIR
Ga0307516_101203211	3300031730	Ectomycorrhiza	MKKALNGSFDVELLEFGLIMQINEEIDAVYGQNSKXIXTRF
Ga0307516_105285521	3300031730	Ectomycorrhiza	MEKALNGSFDAGLLELGLIMQISERIDTVYSQNSK
Ga0307516_107411603	3300031730	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGKNNK
Ga0307516_108475232	3300031730	Ectomycorrhiza	MGKAFNGFLDAGLLEFELIMQISEGIDVVYIQNSK
Ga0307518_101508172	3300031838	Ectomycorrhiza	MGKALNGSLDTGLLEFGLIMQISEGIDAVYDQKSK
Ga0307518_103959021	3300031838	Ectomycorrhiza	MSCHSTILNGYFDAGLLEFGLIMQISKGIDVVYGQNNK
Ga0307518_106191461	3300031838	Ectomycorrhiza	MGKALNGSIDAGLLKFGVDMQISEGIDAVYGQNNK
Ga0325403_100073815	3300032354	Xylem	MGKALNSSFDAGVLEFGLIMQISEGINVVYGQNSK
Ga0325403_10025352	3300032354	Xylem	MGKALNGFFDARLLEFGLIMQISEGIDVVYGQNNK
Ga0325403_100355717	3300032354	Xylem	MAKPLSGSFDVGLLEFGLIMQIGEEIDVVYSQNSR
Ga0325403_100355813	3300032354	Xylem	MGKAFNGSFDAGLLEFGLIMQINEGIDVVYGQNSR
Ga0325403_100490615	3300032354	Xylem	MGKTLNGSFDAGLLEFRLIMQISEGIDVVYGQNSK
Ga0325403_10058491	3300032354	Xylem	MGKALNGSFDIGLLDFGLIMQISEEIDDVYGQNSR
Ga0325403_100584911	3300032354	Xylem	MGKALNGSFDVGLFEFGLIMQISEEIDDVYGQNSR
Ga0325403_101091311	3300032354	Xylem	MGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNTR
Ga0325403_10122883	3300032354	Xylem	MGKALNGSFDAGLLEFGLIMHISEGINAIYGHNSK
Ga0325403_10123457	3300032354	Xylem	MGKAFNGSFDVGLFEFGLIIQISEEIDDVYDQNSR
Ga0325403_10135744	3300032354	Xylem	MGKALNGSFDAGLLEFGLIMQISEGIDVFYGQNSK
Ga0325403_10162238	3300032354	Xylem	MRKALNGSFDVELLEFGLLMQISEEIDVVYDQNSR
Ga0325403_10210782	3300032354	Xylem	MGKVLNGSFDAGLLEFGLIMQISEGIDVVYGQNSKWI
Ga0325403_10254731	3300032354	Xylem	MGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNNR
Ga0325403_10261981	3300032354	Xylem	MGKALNGSFDIGLLEFGLIMQISEEIDDVYSQNSR
Ga0325403_10405781	3300032354	Xylem	MGKALNGSFEVGLLDFGLIMQISEEIDVVYGQNNR
Ga0325403_10406663	3300032354	Xylem	MGKALNGSFDVGLLKFGLIMQISEEIDVVYGQNSRCI
Ga0325403_10450923	3300032354	Xylem	MGKALNDSLDVGLLEFGLIMQISEEINAVYSQDSR
Ga0325403_10492922	3300032354	Xylem	MGKALNGSFDVGLLEFGLIMQISEEIDVIYCQNSR
Ga0325403_10512502	3300032354	Xylem	MGKALNHSCDAGLLEFGLIMQISEGIDVVYDQNSK
Ga0325403_10512781	3300032354	Xylem	MGKTLNGSFDVGLLEFGLIMQISEEIDVVYCQNSR
Ga0325403_10547791	3300032354	Xylem	MGKALNGSFEVGLLDFGLIMQISEEIDAVYGQNNR
Ga0325403_10684762	3300032354	Xylem	TTLLGLFLLEGKALNGSFDVGLLEFGLVMQVSEGMDVVYYQNSR
Ga0325403_10768612	3300032354	Xylem	LDIEKALNGSFDVGLLEFGLIMQISEEIDAVYCPNSR
Ga0325403_10992103	3300032354	Xylem	MGKAFNGSFDMRLLEFEFVMQISEGIDFVYYQNCRLIRN
Ga0325403_11057362	3300032354	Xylem	MGKALNGSFDAGLLKFELIMQISEGINIVYGQNNK
Ga0325403_11262411	3300032354	Xylem	MGKALNGYFDAGLLEFRLIMQMSEEIDPVYGQNSR
Ga0325401_10148717	3300032355	Xylem	MGKALNGSFDAGLLEFGLIMQISEGIDVVYGQNSKWI
Ga0325401_10793271	3300032355	Xylem	MGKALNGSFDAGLLKFELIMQISEGINIVYGQNSKXIXTRI
Ga0325405_10010893	3300032389	Xylem	MGKALNGSFDAGLLEFGLIMQISEGIDAVYGQNNK
Ga0325405_100413114	3300032389	Xylem	LKLGHEKSLNGSFDAGLLDFGLIMQISEEIDVVYGQNTR
Ga0325405_10041313	3300032389	Xylem	MGKALNGSFDAGLLEFGLIMQISEEIDVVYGQNTR
Ga0325405_10257543	3300032389	Xylem	MGKALNGSFDAGVLEFGLIMQISEGIDVVHGQNSK
Ga0325405_10278382	3300032389	Xylem	MGKALNGSFDAGLLEFGLIMQISKGIDAIYSQNSR
Ga0325405_10506992	3300032389	Xylem	LLGLFLLEGKALNGFFDVGLLEFGLVMQVSEGMDVVYYQNSR
Ga0325405_10766973	3300032389	Xylem	MGKALNDSFDVGLLEFGLIIQISEEIKVVYGQDIR
Ga0325405_11111891	3300032389	Xylem	MGKALNGSFDARLLEFGLIMQISEGIDAVYGQNNK
Ga0325405_11234272	3300032389	Xylem	MEKALNGSFDVGLLEFGLIIQISEEIDAVYCPNSR
Ga0325405_11275372	3300032389	Xylem	LLGLFLLEGKALNGSFDVGLLEFGLVMQVSEGMDVVYYQNSR
Ga0325404_10044665	3300032390	Xylem	LLKLKLGHEKSLNGSFDAGLLDFGLIMQISEEIDVVYGQNTR
Ga0325404_10202155	3300032390	Xylem	LNIGKALNGSFDVGLLEFGLIMQISEEIDVVYGQNNR
Ga0325410_101146110	3300032735	Xylem	MGKALNSSFDVGLLEFGLIMQISEGIDAIYGQNSR
Ga0325410_10470683	3300032735	Xylem	LLGLFLLEGKALNGSFDVGLLEFGLVIQVSEGMDVVYYQNSR
Ga0307507_100176178	3300033179	Ectomycorrhiza	MGKALNGSFNVGLLVFGLIMQISEEIGVVYGQNSR
Ga0307507_100597413	3300033179	Ectomycorrhiza	MGKALNGSLDTGLLEFGLIMQISEGIDVVYDQKSK
Ga0307507_101052572	3300033179	Ectomycorrhiza	MEKTLNGSFNIELLEFGLIMQISKEIDAVYGQNNR
Ga0307507_102374441	3300033179	Ectomycorrhiza	MGKALNGSFDAGLLEFGLIMQISEAIDVVYSQNSKXI
Ga0307507_106277011	3300033179	Ectomycorrhiza	EMGKAFNGSFDAGLLEFGLIMQISEGIDAVYGQNSK
Ga0307510_102398082	3300033180	Ectomycorrhiza	MGKALNGSFDVELFEFGLIMQISEGIGVVYSQNSK
Ga0307510_102671753	3300033180	Ectomycorrhiza	MGKALNGYFDAGLLEFGLIMQISKGIDVVYGQNNK
Ga0307510_102774071	3300033180	Ectomycorrhiza	MGKALNGYFDVGLLEFGLIMQISKGIDVVYGQNNK
Ga0325419_036000_315_422	3300034389	Leaf	MGKALNGSFDAGLLKFELIMQISEGINIVYGQNSK
Ga0325419_047475_1144_1251	3300034389	Leaf	MEKALNDSFDVGLLEFGLIIQISEEINVVYGQDIR
Ga0325419_110427_57_164	3300034389	Leaf	MGKALNSSFDAGLLKFELIMQISEGINIVYGQNNK
Ga0325420_047768_2293_2400	3300034688	Leaf	MGKAFNGSFNVGLLEFGLIMQISEEIDVIYCQNSK