Basic Information | |
---|---|
Family ID | F027009 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 196 |
Average Sequence Length | 46 residues |
Representative Sequence | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 196 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 23.98 % |
% of genes near scaffold ends (potentially truncated) | 32.65 % |
% of genes from short scaffolds (< 2000 bps) | 69.90 % |
Associated GOLD sequencing projects | 145 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (67.857 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.796 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.531 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.918 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.53% β-sheet: 0.00% Coil/Unstructured: 39.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 196 Family Scaffolds |
---|---|---|
PF01813 | ATP-synt_D | 39.80 |
PF00137 | ATP-synt_C | 29.08 |
PF00006 | ATP-synt_ab | 4.59 |
PF01496 | V_ATPase_I | 4.08 |
PF00306 | ATP-synt_ab_C | 3.06 |
PF16886 | ATP-synt_ab_Xtn | 2.04 |
PF02874 | ATP-synt_ab_N | 1.53 |
PF00571 | CBS | 1.53 |
PF01991 | vATP-synt_E | 1.02 |
PF01992 | vATP-synt_AC39 | 1.02 |
PF00590 | TP_methylase | 0.51 |
PF04930 | FUN14 | 0.51 |
PF02597 | ThiS | 0.51 |
PF13520 | AA_permease_2 | 0.51 |
PF00696 | AA_kinase | 0.51 |
COG ID | Name | Functional Category | % Frequency in 196 Family Scaffolds |
---|---|---|---|
COG1394 | Archaeal/vacuolar-type H+-ATPase subunit D/Vma8 | Energy production and conversion [C] | 39.80 |
COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 29.08 |
COG1269 | Archaeal/vacuolar-type H+-ATPase subunit I/STV1 | Energy production and conversion [C] | 4.08 |
COG0055 | FoF1-type ATP synthase, beta subunit | Energy production and conversion [C] | 3.06 |
COG0056 | FoF1-type ATP synthase, alpha subunit | Energy production and conversion [C] | 3.06 |
COG1155 | Archaeal/vacuolar-type H+-ATPase catalytic subunit A/Vma1 | Energy production and conversion [C] | 3.06 |
COG1156 | Archaeal/vacuolar-type H+-ATPase subunit B/Vma2 | Energy production and conversion [C] | 3.06 |
COG1390 | Archaeal/vacuolar-type H+-ATPase subunit E/Vma4 | Energy production and conversion [C] | 1.02 |
COG1527 | Archaeal/vacuolar-type H+-ATPase subunit C/Vma6 | Energy production and conversion [C] | 1.02 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.51 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.51 |
COG2383 | Uncharacterized membrane protein, Fun14 family | Function unknown [S] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.86 % |
Unclassified | root | N/A | 32.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_9061679 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1163 | Open in IMG/M |
2088090015|GPICI_9195207 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 47358 | Open in IMG/M |
2162886006|SwRhRL3b_contig_1097234 | Not Available | 1015 | Open in IMG/M |
2162886007|SwRhRL2b_contig_597422 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2058 | Open in IMG/M |
2162886007|SwRhRL2b_contig_675564 | Not Available | 2039 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0404860 | Not Available | 513 | Open in IMG/M |
3300000041|ARcpr5oldR_c006841 | All Organisms → cellular organisms → Archaea | 972 | Open in IMG/M |
3300000041|ARcpr5oldR_c014642 | All Organisms → cellular organisms → Archaea | 678 | Open in IMG/M |
3300000043|ARcpr5yngRDRAFT_c003074 | All Organisms → cellular organisms → Archaea | 1676 | Open in IMG/M |
3300000156|NODE_c0597725 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1590 | Open in IMG/M |
3300000858|JGI10213J12805_10149692 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum | 2965 | Open in IMG/M |
3300001139|JGI10220J13317_10879592 | All Organisms → cellular organisms → Archaea | 711 | Open in IMG/M |
3300001990|JGI24737J22298_10003591 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera gargensis | 5467 | Open in IMG/M |
3300002100|JGI24809J26612_1010123 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2033 | Open in IMG/M |
3300002899|JGIcombinedJ43975_10000316 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera gargensis | 6051 | Open in IMG/M |
3300002903|JGI24801J43971_1002292 | Not Available | 796 | Open in IMG/M |
3300003267|soilL1_10019678 | All Organisms → cellular organisms → Archaea | 28829 | Open in IMG/M |
3300003324|soilH2_10123598 | All Organisms → cellular organisms → Archaea | 3644 | Open in IMG/M |
3300003347|JGI26128J50194_1007643 | Not Available | 697 | Open in IMG/M |
3300003371|JGI26145J50221_1003657 | Not Available | 1229 | Open in IMG/M |
3300003379|JGI26142J50222_101095 | All Organisms → cellular organisms → Archaea | 818 | Open in IMG/M |
3300003379|JGI26142J50222_102258 | Not Available | 563 | Open in IMG/M |
3300003397|JGI26133J50247_100616 | Not Available | 995 | Open in IMG/M |
3300003987|Ga0055471_10000195 | All Organisms → cellular organisms → Archaea | 6680 | Open in IMG/M |
3300003993|Ga0055468_10000023 | All Organisms → cellular organisms → Archaea | 7857 | Open in IMG/M |
3300004114|Ga0062593_101657327 | All Organisms → cellular organisms → Archaea | 697 | Open in IMG/M |
3300004157|Ga0062590_101173963 | All Organisms → cellular organisms → Archaea | 746 | Open in IMG/M |
3300004463|Ga0063356_100754011 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1349 | Open in IMG/M |
3300004479|Ga0062595_100905545 | All Organisms → cellular organisms → Archaea | 744 | Open in IMG/M |
3300004479|Ga0062595_101183388 | Not Available | 677 | Open in IMG/M |
3300004479|Ga0062595_101726091 | Not Available | 591 | Open in IMG/M |
3300005093|Ga0062594_100000802 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 6504 | Open in IMG/M |
3300005186|Ga0066676_10038390 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2655 | Open in IMG/M |
3300005186|Ga0066676_10185021 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1330 | Open in IMG/M |
3300005186|Ga0066676_10281239 | Not Available | 1095 | Open in IMG/M |
3300005294|Ga0065705_10000841 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 5326 | Open in IMG/M |
3300005294|Ga0065705_10102941 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1411 | Open in IMG/M |
3300005294|Ga0065705_10559038 | All Organisms → cellular organisms → Archaea | 729 | Open in IMG/M |
3300005328|Ga0070676_10003931 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7798 | Open in IMG/M |
3300005331|Ga0070670_101442134 | All Organisms → cellular organisms → Archaea | 631 | Open in IMG/M |
3300005334|Ga0068869_100898324 | All Organisms → cellular organisms → Archaea | 766 | Open in IMG/M |
3300005335|Ga0070666_10088376 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2126 | Open in IMG/M |
3300005339|Ga0070660_100222685 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1533 | Open in IMG/M |
3300005365|Ga0070688_101335229 | Not Available | 580 | Open in IMG/M |
3300005406|Ga0070703_10529372 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon | 534 | Open in IMG/M |
3300005459|Ga0068867_100264419 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1404 | Open in IMG/M |
3300005518|Ga0070699_101712505 | Not Available | 576 | Open in IMG/M |
3300005535|Ga0070684_101762718 | Not Available | 584 | Open in IMG/M |
3300005544|Ga0070686_100813432 | Not Available | 754 | Open in IMG/M |
3300005564|Ga0070664_101492895 | All Organisms → cellular organisms → Archaea | 639 | Open in IMG/M |
3300005937|Ga0081455_10006847 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 12144 | Open in IMG/M |
3300005937|Ga0081455_10397410 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 958 | Open in IMG/M |
3300006058|Ga0075432_10001195 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 8337 | Open in IMG/M |
3300006169|Ga0082029_1383138 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 9062 | Open in IMG/M |
3300006169|Ga0082029_1461757 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1225 | Open in IMG/M |
3300006169|Ga0082029_1635311 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 9839 | Open in IMG/M |
3300006196|Ga0075422_10443966 | Not Available | 581 | Open in IMG/M |
3300006577|Ga0074050_10652535 | Not Available | 570 | Open in IMG/M |
3300006844|Ga0075428_100256843 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1882 | Open in IMG/M |
3300006844|Ga0075428_100704634 | Not Available | 1075 | Open in IMG/M |
3300006844|Ga0075428_101012035 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 879 | Open in IMG/M |
3300006846|Ga0075430_100290314 | Not Available | 1353 | Open in IMG/M |
3300006846|Ga0075430_100685689 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 844 | Open in IMG/M |
3300006846|Ga0075430_101260679 | Not Available | 608 | Open in IMG/M |
3300006852|Ga0075433_11007476 | All Organisms → cellular organisms → Archaea | 725 | Open in IMG/M |
3300006852|Ga0075433_11334467 | Not Available | 621 | Open in IMG/M |
3300006852|Ga0075433_11694293 | Not Available | 544 | Open in IMG/M |
3300006876|Ga0079217_10518154 | Not Available | 747 | Open in IMG/M |
3300006880|Ga0075429_101035155 | All Organisms → cellular organisms → Archaea | 717 | Open in IMG/M |
3300006880|Ga0075429_101423848 | Not Available | 603 | Open in IMG/M |
3300006894|Ga0079215_10006608 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3338 | Open in IMG/M |
3300006918|Ga0079216_10442583 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 834 | Open in IMG/M |
3300006969|Ga0075419_10111683 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1764 | Open in IMG/M |
3300007004|Ga0079218_12711418 | Not Available | 591 | Open in IMG/M |
3300007004|Ga0079218_12963570 | Not Available | 571 | Open in IMG/M |
3300009012|Ga0066710_100003919 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 12929 | Open in IMG/M |
3300009081|Ga0105098_10001540 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 8257 | Open in IMG/M |
3300009093|Ga0105240_10756420 | Not Available | 1056 | Open in IMG/M |
3300009100|Ga0075418_11479777 | All Organisms → cellular organisms → Archaea | 737 | Open in IMG/M |
3300009100|Ga0075418_12653155 | Not Available | 547 | Open in IMG/M |
3300009146|Ga0105091_10738681 | Not Available | 519 | Open in IMG/M |
3300009147|Ga0114129_10407915 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1790 | Open in IMG/M |
3300009156|Ga0111538_11718656 | Not Available | 790 | Open in IMG/M |
3300009176|Ga0105242_10251622 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1592 | Open in IMG/M |
3300009499|Ga0114930_10071434 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2024 | Open in IMG/M |
3300009809|Ga0105089_1000311 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3666 | Open in IMG/M |
3300009821|Ga0105064_1000632 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 4237 | Open in IMG/M |
3300010047|Ga0126382_12140969 | Not Available | 536 | Open in IMG/M |
3300010329|Ga0134111_10037601 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1713 | Open in IMG/M |
3300012081|Ga0154003_1013135 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1742 | Open in IMG/M |
3300012081|Ga0154003_1023327 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1156 | Open in IMG/M |
3300012201|Ga0137365_10001591 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 17774 | Open in IMG/M |
3300012358|Ga0137368_10160572 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1648 | Open in IMG/M |
3300012498|Ga0157345_1002715 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1260 | Open in IMG/M |
3300012514|Ga0157330_1040599 | Not Available | 623 | Open in IMG/M |
3300012515|Ga0157338_1047442 | Not Available | 606 | Open in IMG/M |
3300012515|Ga0157338_1080434 | Not Available | 526 | Open in IMG/M |
3300012902|Ga0157291_10148745 | All Organisms → cellular organisms → Archaea | 694 | Open in IMG/M |
3300012905|Ga0157296_10008272 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1696 | Open in IMG/M |
3300012951|Ga0164300_10342694 | Not Available | 799 | Open in IMG/M |
3300012972|Ga0134077_10022791 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2166 | Open in IMG/M |
3300012984|Ga0164309_10003988 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 6897 | Open in IMG/M |
3300013100|Ga0157373_10079903 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2306 | Open in IMG/M |
3300013307|Ga0157372_10415685 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1567 | Open in IMG/M |
3300014268|Ga0075309_1063087 | All Organisms → cellular organisms → Archaea | 861 | Open in IMG/M |
3300014271|Ga0075326_1126333 | All Organisms → cellular organisms → Archaea | 735 | Open in IMG/M |
3300015373|Ga0132257_103053531 | Not Available | 610 | Open in IMG/M |
3300017656|Ga0134112_10035711 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1766 | Open in IMG/M |
3300017657|Ga0134074_1388230 | Not Available | 518 | Open in IMG/M |
3300017997|Ga0184610_1000534 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 8849 | Open in IMG/M |
3300017997|Ga0184610_1014332 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2048 | Open in IMG/M |
3300018000|Ga0184604_10002793 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2853 | Open in IMG/M |
3300018000|Ga0184604_10191430 | All Organisms → cellular organisms → Archaea | 697 | Open in IMG/M |
3300018051|Ga0184620_10076705 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 994 | Open in IMG/M |
3300018054|Ga0184621_10207809 | Not Available | 701 | Open in IMG/M |
3300018063|Ga0184637_10035960 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3005 | Open in IMG/M |
3300018063|Ga0184637_10660561 | All Organisms → cellular organisms → Archaea | 579 | Open in IMG/M |
3300018067|Ga0184611_1229848 | Not Available | 659 | Open in IMG/M |
3300018072|Ga0184635_10003908 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 4690 | Open in IMG/M |
3300018077|Ga0184633_10062714 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1898 | Open in IMG/M |
3300018077|Ga0184633_10105600 | All Organisms → cellular organisms → Archaea | 1455 | Open in IMG/M |
3300018078|Ga0184612_10394637 | All Organisms → cellular organisms → Archaea | 696 | Open in IMG/M |
3300018429|Ga0190272_12114466 | Not Available | 600 | Open in IMG/M |
3300018465|Ga0190269_10158653 | Not Available | 1179 | Open in IMG/M |
3300018465|Ga0190269_10401346 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 848 | Open in IMG/M |
3300018465|Ga0190269_11915491 | Not Available | 512 | Open in IMG/M |
3300018466|Ga0190268_10022183 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2090 | Open in IMG/M |
3300018466|Ga0190268_10041746 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1740 | Open in IMG/M |
3300018466|Ga0190268_10686374 | Not Available | 748 | Open in IMG/M |
3300018469|Ga0190270_11367072 | Not Available | 753 | Open in IMG/M |
3300018920|Ga0190273_12028928 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon | 534 | Open in IMG/M |
3300019767|Ga0190267_10059548 | Not Available | 1352 | Open in IMG/M |
3300019871|Ga0193702_1010616 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1202 | Open in IMG/M |
3300019876|Ga0193703_1053579 | Not Available | 615 | Open in IMG/M |
3300019884|Ga0193741_1000008 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 62228 | Open in IMG/M |
3300020003|Ga0193739_1000971 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 8120 | Open in IMG/M |
3300020003|Ga0193739_1032817 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1347 | Open in IMG/M |
3300020003|Ga0193739_1081126 | Not Available | 825 | Open in IMG/M |
3300020005|Ga0193697_1089645 | All Organisms → cellular organisms → Archaea | 742 | Open in IMG/M |
3300020009|Ga0193740_1000404 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 11983 | Open in IMG/M |
3300020009|Ga0193740_1000531 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 9976 | Open in IMG/M |
3300021073|Ga0210378_10178250 | Not Available | 815 | Open in IMG/M |
3300021080|Ga0210382_10002270 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 6299 | Open in IMG/M |
3300022886|Ga0247746_1018780 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1486 | Open in IMG/M |
3300022899|Ga0247795_1089263 | Not Available | 543 | Open in IMG/M |
3300023062|Ga0247791_1067513 | Not Available | 580 | Open in IMG/M |
3300023067|Ga0247743_1008088 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1252 | Open in IMG/M |
3300023073|Ga0247744_1001043 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 3077 | Open in IMG/M |
3300025146|Ga0209322_10318995 | Not Available | 626 | Open in IMG/M |
3300025159|Ga0209619_10400030 | Not Available | 705 | Open in IMG/M |
3300025290|Ga0207673_1003280 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1888 | Open in IMG/M |
3300025324|Ga0209640_10478036 | All Organisms → cellular organisms → Archaea | 1018 | Open in IMG/M |
3300025907|Ga0207645_10021200 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 4240 | Open in IMG/M |
3300025907|Ga0207645_10297403 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1074 | Open in IMG/M |
3300025908|Ga0207643_10000107 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 56682 | Open in IMG/M |
3300025914|Ga0207671_11340891 | Not Available | 556 | Open in IMG/M |
3300025934|Ga0207686_10138289 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1680 | Open in IMG/M |
3300025940|Ga0207691_10005945 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 11785 | Open in IMG/M |
3300025942|Ga0207689_10043473 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3714 | Open in IMG/M |
3300025945|Ga0207679_10195282 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1686 | Open in IMG/M |
3300026116|Ga0207674_11917980 | Not Available | 558 | Open in IMG/M |
3300026536|Ga0209058_1031232 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3286 | Open in IMG/M |
3300026537|Ga0209157_1008266 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7245 | Open in IMG/M |
3300026749|Ga0207452_100056 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1274 | Open in IMG/M |
3300026750|Ga0207483_100600 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1438 | Open in IMG/M |
3300026779|Ga0207471_100867 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 994 | Open in IMG/M |
3300027018|Ga0208475_1001577 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 2123 | Open in IMG/M |
3300027036|Ga0207467_1011380 | All Organisms → cellular organisms → Archaea | 686 | Open in IMG/M |
3300027360|Ga0209969_1035113 | Not Available | 772 | Open in IMG/M |
3300027364|Ga0209967_1070078 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
3300027471|Ga0209995_1007380 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1773 | Open in IMG/M |
3300027481|Ga0207459_102610 | Not Available | 703 | Open in IMG/M |
3300027511|Ga0209843_1002144 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 4742 | Open in IMG/M |
3300027560|Ga0207981_1000456 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7007 | Open in IMG/M |
3300027695|Ga0209966_1118731 | All Organisms → cellular organisms → Archaea | 606 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10000304 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 15099 | Open in IMG/M |
3300027873|Ga0209814_10000662 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 11633 | Open in IMG/M |
3300027873|Ga0209814_10010931 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 3569 | Open in IMG/M |
3300027880|Ga0209481_10173518 | Not Available | 1071 | Open in IMG/M |
3300027880|Ga0209481_10202616 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 992 | Open in IMG/M |
3300027880|Ga0209481_10490861 | Not Available | 634 | Open in IMG/M |
3300027907|Ga0207428_10000318 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 62982 | Open in IMG/M |
3300027909|Ga0209382_10081047 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3825 | Open in IMG/M |
3300027949|Ga0209860_1000236 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7473 | Open in IMG/M |
(restricted) 3300027995|Ga0233418_10373012 | Not Available | 513 | Open in IMG/M |
3300028784|Ga0307282_10007145 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 4399 | Open in IMG/M |
3300028811|Ga0307292_10127636 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1016 | Open in IMG/M |
3300028876|Ga0307286_10159907 | All Organisms → cellular organisms → Archaea | 809 | Open in IMG/M |
3300030550|Ga0247631_1059691 | Not Available | 671 | Open in IMG/M |
3300031200|Ga0307496_10034281 | All Organisms → cellular organisms → Archaea | 801 | Open in IMG/M |
3300031538|Ga0310888_10222652 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1047 | Open in IMG/M |
3300031716|Ga0310813_12197317 | Not Available | 522 | Open in IMG/M |
3300032013|Ga0310906_10003681 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 5065 | Open in IMG/M |
3300032180|Ga0307471_100623509 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1239 | Open in IMG/M |
3300032180|Ga0307471_103586502 | Not Available | 549 | Open in IMG/M |
3300034666|Ga0314788_045880 | Not Available | 845 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.76% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.10% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 5.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.04% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.04% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.04% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.04% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.53% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.53% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.53% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.02% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.02% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.02% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.02% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.02% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.02% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.02% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.02% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.02% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.02% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.02% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.02% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.02% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.02% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.02% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.02% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.02% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.02% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
3300002100 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA | Environmental | Open in IMG/M |
3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
3300002903 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um Nextera | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Host-Associated | Open in IMG/M |
3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Host-Associated | Open in IMG/M |
3300003379 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM | Host-Associated | Open in IMG/M |
3300003397 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019871 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1 | Environmental | Open in IMG/M |
3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026749 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07K1-12 (SPAdes) | Environmental | Open in IMG/M |
3300026750 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes) | Environmental | Open in IMG/M |
3300026779 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A2w-11 (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300027036 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-10 (SPAdes) | Environmental | Open in IMG/M |
3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027481 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A2-12 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300030550 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_02776980 | 2088090015 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV |
GPICI_02365000 | 2088090015 | Soil | VVANKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSNA |
SwRhRL3b_0314.00001530 | 2162886006 | Switchgrass Rhizosphere | MAAKKMDNDVISGYFKESKQNLQSEHDSMVENVKNDISSYKKKALSNV |
SwRhRL2b_0967.00004370 | 2162886007 | Switchgrass Rhizosphere | MVASKMDADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV |
SwRhRL2b_0648.00004360 | 2162886007 | Switchgrass Rhizosphere | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA |
ICChiseqgaiiDRAFT_04048601 | 3300000033 | Soil | MDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA* |
ARcpr5oldR_0068411 | 3300000041 | Arabidopsis Rhizosphere | HFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA* |
ARcpr5oldR_0146421 | 3300000041 | Arabidopsis Rhizosphere | LEDDIISEHYKKSQQNLQSEHDLMVENVKNDISSYKKKAISNA* |
ARcpr5yngRDRAFT_0030743 | 3300000043 | Arabidopsis Rhizosphere | IISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA* |
NODE_05977251 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MVASKMEADIIADYFKKSKQNLQSEHDSMIQDVKQEISSYKKKAISKA*NISLYQY* |
JGI10213J12805_101496923 | 3300000858 | Soil | MVASKMDSDIISEYFKKSKQNLQSEHDSMVENVKKDISSCKKKALSNA* |
JGI10220J13317_108795922 | 3300001139 | Soil | KMDNDIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMTNV* |
JGI24737J22298_100035914 | 3300001990 | Corn Rhizosphere | MVAXKMEADIIXEYFKKSKQNLQSXHDSMIQDVKQDISSYKKKALSDV* |
JGI24809J26612_10101232 | 3300002100 | Soil | MXSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSNA* |
JGIcombinedJ43975_100003165 | 3300002899 | Soil | MDSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSNA* |
JGI24801J43971_10022921 | 3300002903 | Soil | MDSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSN |
soilL1_100196789 | 3300003267 | Sugarcane Root And Bulk Soil | MAASEMDNNIIADYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMSNV* |
soilH2_101235983 | 3300003324 | Sugarcane Root And Bulk Soil | MAAGEMDNNTIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMSNV* |
JGI26128J50194_10076431 | 3300003347 | Arabidopsis Thaliana Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA* |
JGI26145J50221_10036573 | 3300003371 | Arabidopsis Thaliana Rhizosphere | MDNDIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMTNV* |
JGI26142J50222_1010951 | 3300003379 | Arabidopsis Thaliana Rhizosphere | SKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA* |
JGI26142J50222_1022581 | 3300003379 | Arabidopsis Thaliana Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKK |
JGI26133J50247_1006163 | 3300003397 | Arabidopsis Thaliana Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYK |
Ga0055471_100001951 | 3300003987 | Natural And Restored Wetlands | MDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV* |
Ga0055468_100000234 | 3300003993 | Natural And Restored Wetlands | MVASNMDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKALSNV* |
Ga0062593_1016573271 | 3300004114 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQEISSYKKKAISKA* |
Ga0062590_1011739631 | 3300004157 | Soil | MDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA* |
Ga0063356_1007540112 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSYKKKAMSNV* |
Ga0062595_1009055452 | 3300004479 | Soil | MVASKMEDNIIAEYFKKSKQNLQSEHDSMIQDVKQEISSYKKKAISKA* |
Ga0062595_1011833882 | 3300004479 | Soil | MAAKKMDNDVISGYFKESKQNLQSEHDSMVENVKNDISSYKKKALSNV* |
Ga0062595_1017260912 | 3300004479 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV* |
Ga0062594_1000008025 | 3300005093 | Soil | MAASKMDNDIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMTNV* |
Ga0066676_100383903 | 3300005186 | Soil | MVDNKMDNDIIAEHFKKSKQNLQSERDSMVDAVKNDISSYKKKALSNV* |
Ga0066676_101850213 | 3300005186 | Soil | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA* |
Ga0066676_102812392 | 3300005186 | Soil | MDNDVISGYFKESKQNLQSEHDSMVENVKNDISSYKKKALSNV* |
Ga0065705_100008417 | 3300005294 | Switchgrass Rhizosphere | KQSILMVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA* |
Ga0065705_101029411 | 3300005294 | Switchgrass Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDLKQDISSYKKKALSDV* |
Ga0065705_105590382 | 3300005294 | Switchgrass Rhizosphere | KQSILMVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNV* |
Ga0070676_100039314 | 3300005328 | Miscanthus Rhizosphere | MVARKMEADIITEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV* |
Ga0070670_1014421341 | 3300005331 | Switchgrass Rhizosphere | CILMVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV* |
Ga0068869_1008983242 | 3300005334 | Miscanthus Rhizosphere | IIAEYFKKSKQNLQSEHDSMIQDVKQEISSYKKKAISKA* |
Ga0070666_100883763 | 3300005335 | Switchgrass Rhizosphere | MVASKMDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA* |
Ga0070660_1002226853 | 3300005339 | Corn Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDIKQDISSYKKKALSDV* |
Ga0070688_1013352291 | 3300005365 | Switchgrass Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQEISSYK |
Ga0070703_105293722 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA*LL* |
Ga0068867_1002644193 | 3300005459 | Miscanthus Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQEISSYKKK |
Ga0070699_1017125052 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDNKMNNNIIAEHFKKSKQNLQIEHDSMVENVKKDISSYKKKALSNV* |
Ga0070684_1017627181 | 3300005535 | Corn Rhizosphere | MDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSN |
Ga0070686_1008134321 | 3300005544 | Switchgrass Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKAL |
Ga0070664_1014928951 | 3300005564 | Corn Rhizosphere | AEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV* |
Ga0081455_1000684711 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MVASKMDSDITSEYFKKSKQNLQAEHDLMVEDVKKDISSYKKKALSNA* |
Ga0081455_103974102 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MVASKMENDIISEYFKKSRQNLQSEHDSMVENVKRDISSYKKKALSNA*VFTSNFN* |
Ga0075432_100011953 | 3300006058 | Populus Rhizosphere | MVASKMDSDITSEYFKKSKQNLQAKHDSMVEDVKKDISSYKKKALSNA* |
Ga0082029_13831381 | 3300006169 | Termite Nest | MVASNMDNDIIAEYFRKSKQILQSEHDSMVENVKNDISSCKKKAMSSV* |
Ga0082029_14617573 | 3300006169 | Termite Nest | MDNDIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMSNV* |
Ga0082029_163531110 | 3300006169 | Termite Nest | MAAREMDNNIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMSNV* |
Ga0075422_104439662 | 3300006196 | Populus Rhizosphere | DIIAEYFRKSKQNLQSEHDSMVENVKNDISSYKKKAMSNV* |
Ga0074050_106525351 | 3300006577 | Soil | MDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA* |
Ga0075428_1002568433 | 3300006844 | Populus Rhizosphere | MVASKMDNDIIAEYFRKSKQNLQSEHDSMVENVKKDISSCKKKAMSNV* |
Ga0075428_1007046341 | 3300006844 | Populus Rhizosphere | MDNDIIAEYFRKSKQSLQSEHDSMVENVKNDISSCKKKAMSNV* |
Ga0075428_1010120352 | 3300006844 | Populus Rhizosphere | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA*VLQVICLY* |
Ga0075430_1002903142 | 3300006846 | Populus Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDLMIQDVKQDISSYKKKALSDV* |
Ga0075430_1006856892 | 3300006846 | Populus Rhizosphere | MDNDIIAEYFRKSKQNLQSEHDSMVENVKKDISSCKKKAMSNV* |
Ga0075430_1012606792 | 3300006846 | Populus Rhizosphere | MAASEMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA* |
Ga0075433_110074762 | 3300006852 | Populus Rhizosphere | MDSDITSEYFKKSKQNLQAEHDSMVEDIKKYISSYKKKALSNA* |
Ga0075433_113344672 | 3300006852 | Populus Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDLMIQDVKQDISSYKKKAL |
Ga0075433_116942932 | 3300006852 | Populus Rhizosphere | MDSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSNA*VLQIICFN* |
Ga0079217_105181542 | 3300006876 | Agricultural Soil | MAASKMDNNIIAEYFKKSKQNLQSEHDSMIENVKKDISSCKKKALSNA* |
Ga0075429_1010351551 | 3300006880 | Populus Rhizosphere | ILMVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA*VLQVICLY* |
Ga0075429_1014238481 | 3300006880 | Populus Rhizosphere | MVASNMDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV* |
Ga0079215_100066082 | 3300006894 | Agricultural Soil | MAASEMDNNIIAEYFKKSKQNLQSEHDSMIENVKKDISSCKKKALSNA* |
Ga0079216_104425832 | 3300006918 | Agricultural Soil | MAASKMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKTLSNA* |
Ga0075419_101116833 | 3300006969 | Populus Rhizosphere | MVASNMDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSYKKKAMSNV* |
Ga0079218_127114181 | 3300007004 | Agricultural Soil | MDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKEKALSNA* |
Ga0079218_129635701 | 3300007004 | Agricultural Soil | MDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKTLSNA* |
Ga0066710_10000391914 | 3300009012 | Grasslands Soil | MVDNKMDNDIIAEHFKKSKQNLQSEHDSMVDAVRNDISSYKKKALSNV |
Ga0105098_100015407 | 3300009081 | Freshwater Sediment | QNNALLMVASNRHNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV* |
Ga0105240_107564202 | 3300009093 | Corn Rhizosphere | MVARKMEADIITEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA* |
Ga0075418_114797772 | 3300009100 | Populus Rhizosphere | ILMVASKMDNDIIAEYFRKSKQNLQSEHDSMVENVKKDISSCKKKAMSNV* |
Ga0075418_126531551 | 3300009100 | Populus Rhizosphere | VVANKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSNA* |
Ga0105091_107386811 | 3300009146 | Freshwater Sediment | MVASNMDNDIIAEYFRKSKQNLQSEHYSMVENVKTDISS |
Ga0114129_104079152 | 3300009147 | Populus Rhizosphere | MVASKMDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV* |
Ga0111538_117186562 | 3300009156 | Populus Rhizosphere | VVANKMDSDITSEYFKKSKQNLQAEHDSMVEDIKKYISSYKKKALSNA* |
Ga0105242_102516223 | 3300009176 | Miscanthus Rhizosphere | FKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV* |
Ga0114930_100714343 | 3300009499 | Deep Subsurface | MAAREMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA* |
Ga0105089_10003113 | 3300009809 | Groundwater Sand | MAAKKMDNDIISEYFKESKQNLQSEHDSMVENVKNDISSYKKKALSHV* |
Ga0105064_10006321 | 3300009821 | Groundwater Sand | MAAKKMDNDIISEYFKESKQNLQSEHDSMVENVKNDISSYKKKALSNV* |
Ga0126382_121409692 | 3300010047 | Tropical Forest Soil | MAASEMDNDIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMSNV* |
Ga0134111_100376013 | 3300010329 | Grasslands Soil | MAAKKMDNDVISGYFNESKQNLQSERDSMVDAVKNDISSYKKKALSNV* |
Ga0154003_10131351 | 3300012081 | Attine Ant Fungus Gardens | MHLMATSEMDNDIIAEHFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV* |
Ga0154003_10233272 | 3300012081 | Attine Ant Fungus Gardens | MAASKMDNNIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMTNA* |
Ga0137365_1000159119 | 3300012201 | Vadose Zone Soil | MVDNKMDNDIIAEHFKKSKQNLQSEHDSMVDAVRNDISSYKKKALSNV* |
Ga0137368_101605721 | 3300012358 | Vadose Zone Soil | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKD |
Ga0157345_10027153 | 3300012498 | Arabidopsis Rhizosphere | MDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSDA* |
Ga0157330_10405992 | 3300012514 | Soil | MDGDIISEHFKKSKQNLQSEHDLMVENVKNEISSYKKKTLSNA* |
Ga0157338_10474422 | 3300012515 | Arabidopsis Rhizosphere | LEDDIISVHYKKSQQNLQSEHDLMVENVKNDISSYKKKAIS |
Ga0157338_10804341 | 3300012515 | Arabidopsis Rhizosphere | FKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA* |
Ga0157291_101487451 | 3300012902 | Soil | VASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV* |
Ga0157296_100082722 | 3300012905 | Soil | MVESKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV* |
Ga0164300_103426942 | 3300012951 | Soil | MDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKK |
Ga0134077_100227912 | 3300012972 | Grasslands Soil | MVANKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA* |
Ga0164309_100039884 | 3300012984 | Soil | MDGDIISEHFKKSKQNLQSEHDLMVENVKNYISSYMKKTLSNA* |
Ga0157373_100799033 | 3300013100 | Corn Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISS* |
Ga0157372_104156851 | 3300013307 | Corn Rhizosphere | MDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKAI |
Ga0075309_10630871 | 3300014268 | Natural And Restored Wetlands | IIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA* |
Ga0075326_11263332 | 3300014271 | Natural And Restored Wetlands | YQCIFMAASEMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA* |
Ga0132257_1030535311 | 3300015373 | Arabidopsis Rhizosphere | QSILMVASKMDSDITSEYFKKSKQNLQAKHDSMVEDVKKDISSYKKRALSNA* |
Ga0134112_100357113 | 3300017656 | Grasslands Soil | MVASKMDSDITSEYFKKSKQNLQAEHDSIVEDVKKDISSYKKKALSNA |
Ga0134074_13882301 | 3300017657 | Grasslands Soil | MVASKMDSDITSEYFKKSKQNLQSERDSMVDAVKNDISSYKKKALSNV |
Ga0184610_10005348 | 3300017997 | Groundwater Sediment | MVASKMEADIIAEYFKKSKQNLQSDHDSMIQDVKQDISSYKKKALSNA |
Ga0184610_10143322 | 3300017997 | Groundwater Sediment | MAAKKMDNDVIAGYFKESKQNLQSEHDSMVENVKKDISSYKKKALSNV |
Ga0184604_100027933 | 3300018000 | Groundwater Sediment | MDNDVISGYFKESKQNLQSEHDSMVENVKNDISSYKKKALSNV |
Ga0184604_101914302 | 3300018000 | Groundwater Sediment | MEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA |
Ga0184620_100767052 | 3300018051 | Groundwater Sediment | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA |
Ga0184621_102078092 | 3300018054 | Groundwater Sediment | MVASKMEADIIAEYFKKSKQNLQSDHDSMIQDVKQDISSY |
Ga0184637_100359604 | 3300018063 | Groundwater Sediment | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKAMSNA |
Ga0184637_106605611 | 3300018063 | Groundwater Sediment | MDNDVIAGYFKESKQNLQSEHDSMVENVKKDISSYKKKALSNV |
Ga0184611_12298481 | 3300018067 | Groundwater Sediment | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDLSSYKKKALSNAXVLQVICFN |
Ga0184635_100039081 | 3300018072 | Groundwater Sediment | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDLSSYKKKALSNA |
Ga0184633_100627143 | 3300018077 | Groundwater Sediment | MVASKMEADIIAENFKKSKQNLQSEHDSMIQDVKQDISSYKKKAMSNA |
Ga0184633_101056002 | 3300018077 | Groundwater Sediment | MDNDVIAGYFKGSKQNLQSEHDSMVENVKKDISSYKKKALSNV |
Ga0184612_103946371 | 3300018078 | Groundwater Sediment | KQSILMVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNAXVLQVICFN |
Ga0190272_121144662 | 3300018429 | Soil | MAASKMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA |
Ga0190269_101586532 | 3300018465 | Soil | MDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA |
Ga0190269_104013462 | 3300018465 | Soil | MDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV |
Ga0190269_119154912 | 3300018465 | Soil | AASKMEADIIAEYFKKSKQNLQSDHDSMIQDVKQDISSYKKKALSNA |
Ga0190268_100221833 | 3300018466 | Soil | MVASNMDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV |
Ga0190268_100417462 | 3300018466 | Soil | MDNNIIAEYFKKSKQNLQSEHDYMIENVKKDISSCKKKALSNA |
Ga0190268_106863741 | 3300018466 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDLSSYKKKALSDV |
Ga0190270_113670721 | 3300018469 | Soil | MAASEMDNNIIAEYFKKSKQNLQSEHDSMIENVKKDISSCKKKALSNA |
Ga0190273_120289282 | 3300018920 | Soil | MVASKIDNDIIAEYFRKSKQNLQTEHDSMVENVKNDISSCKKKAMSKV |
Ga0190267_100595482 | 3300019767 | Soil | MDNNIIAEYFKKSKHNLQSEHDSMIENVKKDISSCKKKALSNA |
Ga0193702_10106163 | 3300019871 | Soil | KQSILMVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA |
Ga0193703_10535792 | 3300019876 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQD |
Ga0193741_100000849 | 3300019884 | Soil | MAASKMDNNIIAEYFKKSKQNLQSEHDSMIENVKKDISSCKKKALSNA |
Ga0193739_10009714 | 3300020003 | Soil | MMAGSKMDKDIIAEYFRKSKQNLQTEHDSMVENVKNDISSCKKKAMSNV |
Ga0193739_10328172 | 3300020003 | Soil | MDNDIIAEYFRKSKQNLQTEHDSMVENVKNDISSCKKKAMSNV |
Ga0193739_10811261 | 3300020003 | Soil | MGASKMDNNIIAEYFKKSKQNLQSEHDSMIENVKKDISSCKKKALSNA |
Ga0193697_10896452 | 3300020005 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKAMSDV |
Ga0193740_10004044 | 3300020009 | Soil | MAASKMNNNIIAEYFKKSKQNLQSEHDSMIENVKKDISSCKKKALSNA |
Ga0193740_10005319 | 3300020009 | Soil | MDNDIIAEYFRKSKQNLRSEHDSMVENVKNDISSCKKKAMSNV |
Ga0210378_101782502 | 3300021073 | Groundwater Sediment | MVASKMKADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA |
Ga0210382_100022706 | 3300021080 | Groundwater Sediment | MVASKMEADIIAEYFKKSKQNLQSDHDSMIQDVKQDISSYKKKAMSNA |
Ga0247746_10187803 | 3300022886 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKA |
Ga0247795_10892632 | 3300022899 | Soil | EYFKKSKQNLQSEHDSMIQDIKQDISSYKKKALSDV |
Ga0247791_10675131 | 3300023062 | Soil | VASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV |
Ga0247743_10080881 | 3300023067 | Soil | IAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA |
Ga0247744_10010433 | 3300023073 | Soil | VASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA |
Ga0209322_103189952 | 3300025146 | Soil | MDNNIIAEYFKKSKQNLQSEHDSMIENVKKDISSCKKKALSNA |
Ga0209619_104000302 | 3300025159 | Soil | VAAREMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA |
Ga0207673_10032802 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA |
Ga0209640_104780361 | 3300025324 | Soil | MAASEMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA |
Ga0207645_100212002 | 3300025907 | Miscanthus Rhizosphere | MVARKMEADIITEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV |
Ga0207645_102974032 | 3300025907 | Miscanthus Rhizosphere | MDNDIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMTNV |
Ga0207643_1000010744 | 3300025908 | Miscanthus Rhizosphere | MAASKMDNDIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMTNV |
Ga0207671_113408912 | 3300025914 | Corn Rhizosphere | MDGDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNAXLL |
Ga0207686_101382893 | 3300025934 | Miscanthus Rhizosphere | RMEADIIAEYFKKSKQNLQSQHDSMVQDVKQDISSYKKKTLSNA |
Ga0207691_1000594515 | 3300025940 | Miscanthus Rhizosphere | MVARKMEADIITEYFKKSKQNLQSEHDSMIQDVKQDIS |
Ga0207689_100434734 | 3300025942 | Miscanthus Rhizosphere | MVASKMEDNIIAEYFKKSKQNLQSEHDSMIQDVKQEISSYKKKAISKA |
Ga0207679_101952821 | 3300025945 | Corn Rhizosphere | MVARKMEADIITEYFKKSKQNLQSEHDSMIQDVKQD |
Ga0207674_119179801 | 3300026116 | Corn Rhizosphere | EYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA |
Ga0209058_10312321 | 3300026536 | Soil | MVDNKMDNDIIAEHFKKSKQNLQSERDSMVDAVKNDISSYKKK |
Ga0209157_10082664 | 3300026537 | Soil | MVDNKMDNDIIAEHFKKSKQNLQSERDSMVDAVKNDISSYKKKALSNV |
Ga0207452_1000562 | 3300026749 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDLKQDISSYKKKALSDV |
Ga0207483_1006001 | 3300026750 | Soil | MDSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSNA |
Ga0207471_1008673 | 3300026779 | Soil | YFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSNA |
Ga0208475_10015772 | 3300027018 | Soil | LVVANKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSNA |
Ga0207467_10113801 | 3300027036 | Soil | MEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSDV |
Ga0209969_10351132 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALS |
Ga0209967_10700781 | 3300027364 | Arabidopsis Thaliana Rhizosphere | SEMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKALSNA |
Ga0209995_10073803 | 3300027471 | Arabidopsis Thaliana Rhizosphere | MAASEMDNNIIAEYFKKSKQNLQSEHDSMIENVKNDISSCKKKAMTNV |
Ga0207459_1026101 | 3300027481 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKK |
Ga0209843_10021441 | 3300027511 | Groundwater Sand | MAAKKMDNDIISEYFKESKQNLQSEHDSMVENVKND |
Ga0207981_10004568 | 3300027560 | Soil | AKHSILVVANKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKYISSYKKKALSNA |
Ga0209966_11187312 | 3300027695 | Arabidopsis Thaliana Rhizosphere | YCIFMAASKMDNDIIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMTNV |
(restricted) Ga0233416_100003049 | 3300027799 | Sediment | MAASEMDNNTIAEYFRKSKQNLQSEHDSMIENVKNDISSCKKKAMSNV |
Ga0209814_100006629 | 3300027873 | Populus Rhizosphere | MVASNMDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSYKKKAMSNV |
Ga0209814_100109312 | 3300027873 | Populus Rhizosphere | MVASKMDSDITSEYFKKSKQNLQAKHDSMVEDVKKDISSYKKKALSNA |
Ga0209481_101735182 | 3300027880 | Populus Rhizosphere | MDNDIIAEYFRKSKQSLQSEHDSMVENVKNDISSCKKKAMSNV |
Ga0209481_102026162 | 3300027880 | Populus Rhizosphere | MDNDIIAEYFRKSKQNLQSEHDSMVENVKKDISSCKKKAMSNV |
Ga0209481_104908611 | 3300027880 | Populus Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDLMIQDVKQ |
Ga0207428_1000031811 | 3300027907 | Populus Rhizosphere | MVASKMEADIIAEYFKKSKQNLQSEHDLMIQDVKQDISSYKKKALSDV |
Ga0209382_100810473 | 3300027909 | Populus Rhizosphere | MHIDVASKMDNDIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV |
Ga0209860_10002366 | 3300027949 | Groundwater Sand | MAAKKMDNDVISGYFKESKQNLQSEHDSMVENVKNDISSYKKKALSHV |
(restricted) Ga0233418_103730121 | 3300027995 | Sediment | MAASEMDKDIIAEYFRKSKQALQSEHDSMIENVKNDISSCKKKAMSNV |
Ga0307282_100071454 | 3300028784 | Soil | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSSA |
Ga0307292_101276363 | 3300028811 | Soil | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKK |
Ga0307286_101599071 | 3300028876 | Soil | ILMVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDLSSYKKKALSNA |
Ga0247631_10596912 | 3300030550 | Soil | MDNEIIAEYFRKSKQNLQSEHDSMVENVKNDISSCKKKAMSNV |
Ga0307496_100342812 | 3300031200 | Soil | MVASKMDSDITSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNAXVLQVICFN |
Ga0310888_102226522 | 3300031538 | Soil | MDRDIISEHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA |
Ga0310813_121973172 | 3300031716 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQEISSYKKKAISKA |
Ga0310906_100036813 | 3300032013 | Soil | MDGDIISQHFKKSKQNLQSEHDLMVENVKNDISSYKKKALSNA |
Ga0307471_1006235091 | 3300032180 | Hardwood Forest Soil | TSEYFKKSKQNLQAEHDSMVEDVKKDISSYKKKALSNA |
Ga0307471_1035865021 | 3300032180 | Hardwood Forest Soil | MVTGKMESDIIAEYFKKSKQNLQSEHDSMIQDVKQDISS |
Ga0314788_045880_2_142 | 3300034666 | Soil | MVASKMEADIIAEYFKKSKQNLQSEHDSMIQDVKQDISSYKKKALSD |
⦗Top⦘ |