Basic Information | |
---|---|
Family ID | F026315 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 198 |
Average Sequence Length | 44 residues |
Representative Sequence | MTGSDLIVLAPWIIFAVCLVVLCTRLLRARRSAPRSPSARRRHDD |
Number of Associated Samples | 149 |
Number of Associated Scaffolds | 198 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 87.88 % |
% of genes near scaffold ends (potentially truncated) | 24.75 % |
% of genes from short scaffolds (< 2000 bps) | 79.29 % |
Associated GOLD sequencing projects | 137 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.131 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.687 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.798 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.535 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 198 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 32.32 |
PF00486 | Trans_reg_C | 22.73 |
PF09335 | SNARE_assoc | 9.60 |
PF00893 | Multi_Drug_Res | 7.58 |
PF01258 | zf-dskA_traR | 5.05 |
PF02518 | HATPase_c | 1.01 |
PF13365 | Trypsin_2 | 0.51 |
PF07730 | HisKA_3 | 0.51 |
PF00146 | NADHdh | 0.51 |
PF13560 | HTH_31 | 0.51 |
PF03741 | TerC | 0.51 |
PF15586 | Imm8 | 0.51 |
PF01381 | HTH_3 | 0.51 |
PF00672 | HAMP | 0.51 |
PF01408 | GFO_IDH_MocA | 0.51 |
PF13377 | Peripla_BP_3 | 0.51 |
PF03819 | MazG | 0.51 |
PF00230 | MIP | 0.51 |
PF12323 | HTH_OrfB_IS605 | 0.51 |
PF07228 | SpoIIE | 0.51 |
PF05193 | Peptidase_M16_C | 0.51 |
COG ID | Name | Functional Category | % Frequency in 198 Family Scaffolds |
---|---|---|---|
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 9.60 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 9.60 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 9.60 |
COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 7.58 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 5.05 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.51 |
COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 0.51 |
COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.51 |
COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 0.51 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.51 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.51 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.51 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.13 % |
Unclassified | root | N/A | 36.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000651|AP72_2010_repI_A10DRAFT_1035733 | Not Available | 643 | Open in IMG/M |
3300000903|JGI11872J12872_103568 | Not Available | 513 | Open in IMG/M |
3300001449|JGI20208J14878_1026957 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300001471|JGI12712J15308_10183994 | Not Available | 546 | Open in IMG/M |
3300001661|JGI12053J15887_10466027 | Not Available | 604 | Open in IMG/M |
3300001867|JGI12627J18819_10193167 | Not Available | 823 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100986392 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101080697 | Not Available | 689 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101472229 | Not Available | 575 | Open in IMG/M |
3300003320|rootH2_10022022 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
3300004092|Ga0062389_104862380 | Not Available | 506 | Open in IMG/M |
3300005327|Ga0070658_10045004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3568 | Open in IMG/M |
3300005329|Ga0070683_100032343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4764 | Open in IMG/M |
3300005332|Ga0066388_102217661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 992 | Open in IMG/M |
3300005336|Ga0070680_100079639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2701 | Open in IMG/M |
3300005345|Ga0070692_10143680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1353 | Open in IMG/M |
3300005366|Ga0070659_100186137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1705 | Open in IMG/M |
3300005434|Ga0070709_10127140 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300005434|Ga0070709_10475917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 945 | Open in IMG/M |
3300005435|Ga0070714_100033683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4284 | Open in IMG/M |
3300005435|Ga0070714_100090795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2675 | Open in IMG/M |
3300005435|Ga0070714_100091208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2669 | Open in IMG/M |
3300005435|Ga0070714_101192102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 743 | Open in IMG/M |
3300005435|Ga0070714_101229463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 731 | Open in IMG/M |
3300005435|Ga0070714_101413235 | Not Available | 679 | Open in IMG/M |
3300005436|Ga0070713_100510813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1135 | Open in IMG/M |
3300005458|Ga0070681_10153555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2228 | Open in IMG/M |
3300005530|Ga0070679_100505450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1152 | Open in IMG/M |
3300005537|Ga0070730_11036404 | Not Available | 511 | Open in IMG/M |
3300005541|Ga0070733_10943299 | Not Available | 580 | Open in IMG/M |
3300005602|Ga0070762_10311474 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300005602|Ga0070762_10634788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 712 | Open in IMG/M |
3300005610|Ga0070763_10392915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 778 | Open in IMG/M |
3300005610|Ga0070763_10711833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 589 | Open in IMG/M |
3300005610|Ga0070763_10983609 | Not Available | 505 | Open in IMG/M |
3300005616|Ga0068852_100881156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 912 | Open in IMG/M |
3300005764|Ga0066903_108337141 | Not Available | 529 | Open in IMG/M |
3300005994|Ga0066789_10047598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1882 | Open in IMG/M |
3300005995|Ga0066790_10514694 | Not Available | 512 | Open in IMG/M |
3300006176|Ga0070765_100934477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 820 | Open in IMG/M |
3300006176|Ga0070765_101175184 | Not Available | 725 | Open in IMG/M |
3300006804|Ga0079221_10295604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 947 | Open in IMG/M |
3300007982|Ga0102924_1151954 | Not Available | 1067 | Open in IMG/M |
3300009826|Ga0123355_10078978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5256 | Open in IMG/M |
3300010046|Ga0126384_12386476 | Not Available | 512 | Open in IMG/M |
3300010047|Ga0126382_10028274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3037 | Open in IMG/M |
3300010048|Ga0126373_10400359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1397 | Open in IMG/M |
3300010048|Ga0126373_10932922 | Not Available | 933 | Open in IMG/M |
3300010048|Ga0126373_10962061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 919 | Open in IMG/M |
3300010358|Ga0126370_10153383 | Not Available | 1682 | Open in IMG/M |
3300010361|Ga0126378_11897272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300010361|Ga0126378_12047371 | Not Available | 653 | Open in IMG/M |
3300010362|Ga0126377_10790483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
3300010371|Ga0134125_13069224 | Not Available | 506 | Open in IMG/M |
3300010373|Ga0134128_11582951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300010376|Ga0126381_100157944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2986 | Open in IMG/M |
3300010376|Ga0126381_100202727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2654 | Open in IMG/M |
3300010376|Ga0126381_100501196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1712 | Open in IMG/M |
3300010396|Ga0134126_10028124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7122 | Open in IMG/M |
3300010398|Ga0126383_11046850 | Not Available | 905 | Open in IMG/M |
3300010398|Ga0126383_11951059 | Not Available | 675 | Open in IMG/M |
3300010864|Ga0126357_1101172 | Not Available | 713 | Open in IMG/M |
3300010865|Ga0126346_1058358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 561 | Open in IMG/M |
3300010866|Ga0126344_1050814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1062 | Open in IMG/M |
3300010867|Ga0126347_1535587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 609 | Open in IMG/M |
3300010880|Ga0126350_11120451 | All Organisms → cellular organisms → Bacteria | 3181 | Open in IMG/M |
3300011269|Ga0137392_11519112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 528 | Open in IMG/M |
3300012359|Ga0137385_11607831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 514 | Open in IMG/M |
3300012924|Ga0137413_11202241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 604 | Open in IMG/M |
3300012927|Ga0137416_12107483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 518 | Open in IMG/M |
3300012960|Ga0164301_10293326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1091 | Open in IMG/M |
3300013105|Ga0157369_10055590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4272 | Open in IMG/M |
3300013307|Ga0157372_10327506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1784 | Open in IMG/M |
3300014201|Ga0181537_10170581 | Not Available | 1495 | Open in IMG/M |
3300014501|Ga0182024_10105594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4083 | Open in IMG/M |
3300014654|Ga0181525_10076560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1866 | Open in IMG/M |
3300016404|Ga0182037_10913595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 762 | Open in IMG/M |
3300017821|Ga0187812_1000141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25685 | Open in IMG/M |
3300017937|Ga0187809_10012431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2806 | Open in IMG/M |
3300017937|Ga0187809_10371815 | Not Available | 540 | Open in IMG/M |
3300017948|Ga0187847_10352197 | Not Available | 807 | Open in IMG/M |
3300018038|Ga0187855_10838280 | Not Available | 536 | Open in IMG/M |
3300020070|Ga0206356_10507440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1704 | Open in IMG/M |
3300020075|Ga0206349_1974641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
3300020076|Ga0206355_1040607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
3300020078|Ga0206352_10019150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 555 | Open in IMG/M |
3300020081|Ga0206354_10004534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
3300020081|Ga0206354_10676759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1410 | Open in IMG/M |
3300020082|Ga0206353_11770995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1676 | Open in IMG/M |
3300020199|Ga0179592_10206665 | Not Available | 889 | Open in IMG/M |
3300020582|Ga0210395_10005189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9984 | Open in IMG/M |
3300020582|Ga0210395_11104489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 585 | Open in IMG/M |
3300020582|Ga0210395_11186097 | Not Available | 561 | Open in IMG/M |
3300020582|Ga0210395_11281818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 537 | Open in IMG/M |
3300020583|Ga0210401_10217551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1768 | Open in IMG/M |
3300021086|Ga0179596_10036639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1940 | Open in IMG/M |
3300021180|Ga0210396_10055559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3621 | Open in IMG/M |
3300021180|Ga0210396_10334427 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
3300021180|Ga0210396_10756865 | Not Available | 836 | Open in IMG/M |
3300021180|Ga0210396_11183617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 640 | Open in IMG/M |
3300021181|Ga0210388_10110002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2367 | Open in IMG/M |
3300021181|Ga0210388_10144591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2063 | Open in IMG/M |
3300021181|Ga0210388_10199887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1749 | Open in IMG/M |
3300021402|Ga0210385_10004739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8140 | Open in IMG/M |
3300021403|Ga0210397_10360727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1079 | Open in IMG/M |
3300021403|Ga0210397_10937216 | Not Available | 671 | Open in IMG/M |
3300021404|Ga0210389_10464008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 996 | Open in IMG/M |
3300021405|Ga0210387_10822612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 820 | Open in IMG/M |
3300021406|Ga0210386_10388610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
3300021406|Ga0210386_10406033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1174 | Open in IMG/M |
3300021406|Ga0210386_10943891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300021406|Ga0210386_11386256 | Not Available | 589 | Open in IMG/M |
3300021420|Ga0210394_11524017 | Not Available | 565 | Open in IMG/M |
3300021432|Ga0210384_10319926 | Not Available | 1397 | Open in IMG/M |
3300021474|Ga0210390_10361091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1229 | Open in IMG/M |
3300021477|Ga0210398_11018367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 660 | Open in IMG/M |
3300021477|Ga0210398_11121899 | Not Available | 624 | Open in IMG/M |
3300021560|Ga0126371_11298904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
3300021560|Ga0126371_12647827 | Not Available | 608 | Open in IMG/M |
3300022557|Ga0212123_10019089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8018 | Open in IMG/M |
3300022557|Ga0212123_10449881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 849 | Open in IMG/M |
3300023056|Ga0233357_1002422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1582 | Open in IMG/M |
3300025504|Ga0208356_1023232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1326 | Open in IMG/M |
3300025588|Ga0208586_1076568 | Not Available | 736 | Open in IMG/M |
3300025588|Ga0208586_1112741 | Not Available | 582 | Open in IMG/M |
3300025898|Ga0207692_11144478 | Not Available | 516 | Open in IMG/M |
3300025906|Ga0207699_10251759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
3300025917|Ga0207660_11188188 | Not Available | 621 | Open in IMG/M |
3300025920|Ga0207649_10313395 | Not Available | 1151 | Open in IMG/M |
3300025924|Ga0207694_10416370 | Not Available | 1119 | Open in IMG/M |
3300025928|Ga0207700_10361208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1266 | Open in IMG/M |
3300025929|Ga0207664_10183918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1795 | Open in IMG/M |
3300025929|Ga0207664_10471634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1122 | Open in IMG/M |
3300025939|Ga0207665_10675081 | Not Available | 811 | Open in IMG/M |
3300026116|Ga0207674_10141037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2369 | Open in IMG/M |
3300026291|Ga0209890_10010253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3824 | Open in IMG/M |
3300026555|Ga0179593_1223488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3164 | Open in IMG/M |
3300027089|Ga0207943_102522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1341 | Open in IMG/M |
3300027110|Ga0208488_1050193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 724 | Open in IMG/M |
3300027164|Ga0208994_1014682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1070 | Open in IMG/M |
3300027164|Ga0208994_1049513 | Not Available | 628 | Open in IMG/M |
3300027496|Ga0208987_1015749 | Not Available | 1273 | Open in IMG/M |
3300027505|Ga0209218_1062792 | Not Available | 758 | Open in IMG/M |
3300027528|Ga0208985_1004103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2647 | Open in IMG/M |
3300027567|Ga0209115_1138458 | Not Available | 547 | Open in IMG/M |
3300027725|Ga0209178_1146454 | Not Available | 813 | Open in IMG/M |
3300027775|Ga0209177_10025725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1501 | Open in IMG/M |
3300027817|Ga0209112_10007411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2997 | Open in IMG/M |
3300027857|Ga0209166_10387677 | Not Available | 726 | Open in IMG/M |
3300027889|Ga0209380_10272798 | Not Available | 994 | Open in IMG/M |
3300027889|Ga0209380_10450543 | Not Available | 753 | Open in IMG/M |
3300027895|Ga0209624_10181944 | Not Available | 1394 | Open in IMG/M |
3300027908|Ga0209006_10656454 | Not Available | 862 | Open in IMG/M |
3300027908|Ga0209006_11274610 | Not Available | 570 | Open in IMG/M |
3300028536|Ga0137415_11365416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 529 | Open in IMG/M |
3300028789|Ga0302232_10022462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3546 | Open in IMG/M |
3300028800|Ga0265338_10000911 | All Organisms → cellular organisms → Bacteria | 49821 | Open in IMG/M |
3300029999|Ga0311339_10102941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3517 | Open in IMG/M |
3300030056|Ga0302181_10007029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7230 | Open in IMG/M |
3300030520|Ga0311372_10049169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8237 | Open in IMG/M |
3300030520|Ga0311372_11941172 | Not Available | 693 | Open in IMG/M |
3300030730|Ga0307482_1220658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 584 | Open in IMG/M |
3300030862|Ga0265753_1025158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 922 | Open in IMG/M |
3300030906|Ga0302314_11176459 | Not Available | 721 | Open in IMG/M |
3300031231|Ga0170824_107112628 | Not Available | 633 | Open in IMG/M |
3300031543|Ga0318516_10156472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
3300031561|Ga0318528_10781939 | Not Available | 510 | Open in IMG/M |
3300031640|Ga0318555_10312571 | Not Available | 850 | Open in IMG/M |
3300031708|Ga0310686_105980223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1066 | Open in IMG/M |
3300031708|Ga0310686_110522987 | Not Available | 1271 | Open in IMG/M |
3300031708|Ga0310686_117348985 | All Organisms → cellular organisms → Bacteria | 14354 | Open in IMG/M |
3300031708|Ga0310686_117402185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 759 | Open in IMG/M |
3300031713|Ga0318496_10284461 | Not Available | 913 | Open in IMG/M |
3300031713|Ga0318496_10435132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 725 | Open in IMG/M |
3300031715|Ga0307476_10015272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 4891 | Open in IMG/M |
3300031715|Ga0307476_11132594 | Not Available | 574 | Open in IMG/M |
3300031718|Ga0307474_10305683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
3300031747|Ga0318502_10759055 | Not Available | 587 | Open in IMG/M |
3300031797|Ga0318550_10441199 | Not Available | 629 | Open in IMG/M |
3300031897|Ga0318520_11105959 | Not Available | 502 | Open in IMG/M |
3300031939|Ga0308174_11763803 | Not Available | 532 | Open in IMG/M |
3300032025|Ga0318507_10406931 | Not Available | 592 | Open in IMG/M |
3300032074|Ga0308173_10077708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2515 | Open in IMG/M |
3300032089|Ga0318525_10458532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 653 | Open in IMG/M |
3300032261|Ga0306920_100824590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
3300032770|Ga0335085_10026971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8068 | Open in IMG/M |
3300032893|Ga0335069_10764010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1092 | Open in IMG/M |
3300032895|Ga0335074_10020962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9217 | Open in IMG/M |
3300032895|Ga0335074_10058396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5274 | Open in IMG/M |
3300032896|Ga0335075_10020582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9729 | Open in IMG/M |
3300032896|Ga0335075_10303179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1784 | Open in IMG/M |
3300032897|Ga0335071_12046774 | Not Available | 516 | Open in IMG/M |
3300033134|Ga0335073_10777573 | Not Available | 1031 | Open in IMG/M |
3300033475|Ga0310811_10557771 | Not Available | 1171 | Open in IMG/M |
3300033475|Ga0310811_11167856 | Not Available | 640 | Open in IMG/M |
3300033545|Ga0316214_1003228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2048 | Open in IMG/M |
3300033828|Ga0334850_066039 | Not Available | 684 | Open in IMG/M |
3300034282|Ga0370492_0221361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 770 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.69% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.08% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.04% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.04% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.04% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 4.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.03% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.53% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.53% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.02% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.02% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.52% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.52% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.01% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.01% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.01% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.01% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.01% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.01% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.51% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.51% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.51% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.51% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.51% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.51% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
3300000903 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 | Environmental | Open in IMG/M |
3300001449 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027089 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AP72_2010_repI_A10DRAFT_10357332 | 3300000651 | Forest Soil | MTGSNLIVAAPWIVFGVCLVVLCIRLLRARRPAHRSPSAKRRHDD* |
JGI11872J12872_1035682 | 3300000903 | Forest Soil | MTGSDLIVXAPWIIFAICLVVLCARLLRARRSAQR |
JGI20208J14878_10269572 | 3300001449 | Arctic Peat Soil | MTDSFLIVVAPWIIFGVCLIVLCIRLLRGRRRGERSAGLRRRRDD* |
JGI12712J15308_101839941 | 3300001471 | Forest Soil | MTDSFLIVVAPWIIFGVCLTVLCIRLLRARRPGERSSGLRRKRDD* |
JGI12053J15887_104660272 | 3300001661 | Forest Soil | MTGSDLIVMAPWIIFAICLVVLCARLLRARRSAQRPPSGRREHDR* |
JGI12627J18819_101931672 | 3300001867 | Forest Soil | MTGSDLIVLAPWIIFAICLVVLCARLLRARRSAPRPPSGRREHDR* |
JGIcombinedJ26739_1009863922 | 3300002245 | Forest Soil | MTESFLIVVAPWIIFGVCLTVLCFRLLRARRPGERSPGLRRRRDD* |
JGIcombinedJ26739_1010806971 | 3300002245 | Forest Soil | MTENFLIVVAPWIIFGVCLVLLCIRLLRARRPGERSPGLRRRDDD* |
JGIcombinedJ26739_1014722292 | 3300002245 | Forest Soil | MTGSDLIVLAPWIIXAICLXVLCARLLRARRSAPRPPSGRRGHDR* |
rootH2_100220222 | 3300003320 | Sugarcane Root And Bulk Soil | MTGSDLIVVAPWIIFAVCLAVLCFRLRHARRSASRRRQDD* |
Ga0062389_1048623801 | 3300004092 | Bog Forest Soil | MTESFLIVVAPWIVFGVCLAVLCIRLLRARRPGERSPEPRRRHDD* |
Ga0070658_100450043 | 3300005327 | Corn Rhizosphere | MTGSDLLVVAPWIIFAICVAVVCARLLRARRSASRPPSARRRHDD* |
Ga0070683_1000323438 | 3300005329 | Corn Rhizosphere | MMTGSDLMVFAPWIIFAVCLAVVCTRLLRARWSAKRPPAAKRRESD* |
Ga0066388_1022176611 | 3300005332 | Tropical Forest Soil | MTGSDLIVVAPWIVFVVCLTVLCVRLLRARRSAQRPPSAKRRHDD* |
Ga0070680_1000796396 | 3300005336 | Corn Rhizosphere | MTGSDLLVVAPWIIFAICVAVVCARLLRARRSASRPPSARRRDDD* |
Ga0070692_101436802 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MTASDLLVVAPWIIFAICVAVVCARLFRARRSASRPPSARRRDDD* |
Ga0070659_1001861373 | 3300005366 | Corn Rhizosphere | MTGSDLLVVAPWIIFAICVAVVCARLFRARRSASRPPSARRRDDD* |
Ga0070709_101271402 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLIVAAPWIVFGVSLAILCVGLLRARRSAHRPPSARRRQDD* |
Ga0070709_104759172 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLIVFAPWIIFAICLAVVCTRLLRARWSAKRPPSAKRREGN* |
Ga0070714_1000336833 | 3300005435 | Agricultural Soil | MTGSDLLVVAPWIIFAICVAVVCARLLRARRSASRRTSARRRHDD* |
Ga0070714_1000907954 | 3300005435 | Agricultural Soil | MTGSDLIVFAPWIIFAICLAVVCTRLLRARWSAKRPPSAKRR |
Ga0070714_1000912084 | 3300005435 | Agricultural Soil | MTGSDLIVFAPWIIFAVCLVVVCTRLLRARWSAKRPPSAKRRDGN* |
Ga0070714_1011921023 | 3300005435 | Agricultural Soil | QMTGNDLLVVGPWIIFGVCLAALCIRLLRARRFGQRPPSAHRKDS* |
Ga0070714_1012294632 | 3300005435 | Agricultural Soil | MTGSDLIVLAPWIIFAVCLVVLCARLIRARRSAHRPPPGRRGHDR* |
Ga0070714_1014132352 | 3300005435 | Agricultural Soil | MTGSDLIVVAPWIVFGVSLAILCVGLLRARRSAHRPRSARRRQDD* |
Ga0070713_1005108133 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLLVVAPWIIFAICVAVLCARLLRARRSASRSRSARRRHDD* |
Ga0070681_101535553 | 3300005458 | Corn Rhizosphere | MTGSDLMVFAPWIIFAVCLAVVCTRLLRARWSAKRPPAAKRRESD* |
Ga0070679_1005054504 | 3300005530 | Corn Rhizosphere | MTGSDLMVFAPWIIFAVCLAVVCTRLLRAHWSAKRPPAAKRRESD* |
Ga0070730_110364041 | 3300005537 | Surface Soil | LIWIAPWLVFALCLAVVCTRLFRARRPVKRPPPAGRREGG* |
Ga0070733_109432991 | 3300005541 | Surface Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLLRARRSAHRPPSA |
Ga0070762_103114741 | 3300005602 | Soil | GLMTGSDLIVVAPWIVFGVCLAVLCVGLLRARRAAHRPPSARRRRDD* |
Ga0070762_106347881 | 3300005602 | Soil | GLMTGSDLIVLAPWIIFAICLVVLCARLLRARRSAQRPPPGRRGHDR* |
Ga0070763_103929153 | 3300005610 | Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLLRARRSAHRPPSARRRQDD* |
Ga0070763_107118332 | 3300005610 | Soil | MTGSDLIVLAPWIIFAVCLVVLCARLLRARRSAQRPPSGRRGHDR* |
Ga0070763_109836092 | 3300005610 | Soil | MTGSDLIVLAPWIIFAICLLVLSARLLRARRSASRPPSGEREDDR* |
Ga0068852_1008811562 | 3300005616 | Corn Rhizosphere | MTASDLLVVAPWIIFAICVAVVCARLLRARRSASRPPSARRRHDD* |
Ga0066903_1083371411 | 3300005764 | Tropical Forest Soil | MTGSDLIVAAPWIVFSVCLAVLCIRLLRARRLGHRSPCAKRRQDD* |
Ga0066789_100475984 | 3300005994 | Soil | MTGSDLIVVAPWIIFAVCLTVLCIRLLCARRSAQRSPSARRGQDG* |
Ga0066790_105146942 | 3300005995 | Soil | MTGSDLIVVAPWIIFAVCLAVLCIRLLRARRSAQRSSSARRGQDG* |
Ga0070765_1009344772 | 3300006176 | Soil | MIDSFLLVVAPWIIFGVCLTVLCIRLLRARRPGQRSAGPRRRHDD* |
Ga0070765_1011751842 | 3300006176 | Soil | MTGSDLIVLAPWIIFAICLLVLSARLLRARRSASRPPSGGREDDR* |
Ga0079221_102956042 | 3300006804 | Agricultural Soil | MTASDLLVVAPWIIFAICVAVVCARLFRARRSASRPPSARRRDD |
Ga0102924_11519542 | 3300007982 | Iron-Sulfur Acid Spring | MTGSDLIVLAPWIIFAICLLVLSARLFRARRSASRPPSGGREDDR* |
Ga0123355_100789783 | 3300009826 | Termite Gut | MTGSDLIVLAPWVIFAVCLAVVCTRLLRARWSAKRPPSAKRREGH* |
Ga0126384_123864762 | 3300010046 | Tropical Forest Soil | MTGSDLIVVAPWIIFAICVAVLCARLFRARRSSRPRSARRRHDD* |
Ga0126382_100282745 | 3300010047 | Tropical Forest Soil | MTGSDLIVVAPWIVFSVCLAVLCIRLLRARRLAHRSPSAKRRHDD* |
Ga0126373_104003592 | 3300010048 | Tropical Forest Soil | MTASDLIVAAPWIVFSVCLAVLCIRLLRARRSPSAKRRHDD* |
Ga0126373_109329222 | 3300010048 | Tropical Forest Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLHRARRSAHRPPSGRRRQDD* |
Ga0126373_109620612 | 3300010048 | Tropical Forest Soil | MTGSDLIVVAPWIIFAIWLVVLCIRLLHARRFAQRSPSARRKHHD* |
Ga0126370_101533831 | 3300010358 | Tropical Forest Soil | MTGSDLIVAAPWIVFSVCLAVLCIRLLRARRSPSAKRRHDD* |
Ga0126378_118972722 | 3300010361 | Tropical Forest Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLHRARRSAQRPPSGRRRQDD* |
Ga0126378_120473712 | 3300010361 | Tropical Forest Soil | MTGSDLIVVAPWIAFVICLALLCIRLLRARRSAQRPPSAKRRHDD* |
Ga0126377_107904832 | 3300010362 | Tropical Forest Soil | MTGSDLIVVAPWIVFGICLAVLCIRLLRARRPAHRSPSAKRRHDD* |
Ga0134125_130692242 | 3300010371 | Terrestrial Soil | MTGSDLIVLAPWIVFGVCLAVLCTRLLRARRSAPRSPSARRRHDD* |
Ga0134128_115829512 | 3300010373 | Terrestrial Soil | MTGSDLIVLAPWIVFGVCLAVLCTRLLRARRSAPRAPSARRRHDD* |
Ga0126381_1001579444 | 3300010376 | Tropical Forest Soil | MTGSDLIVVVPWIVFVICLAVLCIRLLRARRSGQRPPSAKRRHDD* |
Ga0126381_1002027274 | 3300010376 | Tropical Forest Soil | MTRNDLIVVAPWIVFVVCLAVLCLRLLRARRSAQRPPSAKRRQDD* |
Ga0126381_1005011962 | 3300010376 | Tropical Forest Soil | MTGSDLIVVAPWIIFAIVLVVLCIRLLRARRFTRRAPSARRKDHD* |
Ga0134126_100281248 | 3300010396 | Terrestrial Soil | MTGSDLIVFAPWIIFAVCLAVVCTRLLRARWSAKRPPSAKRREGN* |
Ga0126383_110468502 | 3300010398 | Tropical Forest Soil | MTGSDLIVVAPWIVFSVCLAVLCIRLLRARRPAHRSPCAKRRHDD* |
Ga0126383_119510591 | 3300010398 | Tropical Forest Soil | MTGSDLIVAAPWIVFGVCLVVLCIRLLRARRPAHRSPSAKRRHDD* |
Ga0126357_11011721 | 3300010864 | Boreal Forest Soil | MTESFLIVVAPWIIFGVCLVLLFIRLLRARRPGERSPGLRRRDDD* |
Ga0126346_10583581 | 3300010865 | Boreal Forest Soil | MTGSDLIVLAPWIIFGVCLVVLCTSLFRARRSPSAKRKHED* |
Ga0126344_10508142 | 3300010866 | Boreal Forest Soil | MTGSDLIVLAPWIIFAICLVVLCARLVRARRSTQRPPSGRRGHDR* |
Ga0126347_15355871 | 3300010867 | Boreal Forest Soil | MTGSDLIVVAPWIIFAVCLTVLCIRLLRARRSAQRSSSARRGQDG* |
Ga0126350_111204512 | 3300010880 | Boreal Forest Soil | MTGSDLIVLAPWIIFAICLVVLCARLVRARRSAQRPPSGRRGHDR* |
Ga0137392_115191122 | 3300011269 | Vadose Zone Soil | MTGSDLIVLAPWIIFAICLVVLCARLLRARRSAQRPPPGRRGHDR* |
Ga0137385_116078311 | 3300012359 | Vadose Zone Soil | TGSDLIVMAPWIIFAICLVVLGTRLLRARRSASRPPSARRRHDD* |
Ga0137413_112022412 | 3300012924 | Vadose Zone Soil | MTGSDLIVLAPWIIFGICVVVLCTRLFRARRSASRSSSARRRHDD* |
Ga0137416_121074831 | 3300012927 | Vadose Zone Soil | AGLMTGSDLIVLAPWIIFAICLVVLCARLLRARRSAQRPPPDRRGHDR* |
Ga0164301_102933261 | 3300012960 | Soil | TTERQHRTGTMTGSDLMVFAPWIIFAVCLAVVCTRLLRARWSAKRPPAAKRRESD* |
Ga0157369_100555902 | 3300013105 | Corn Rhizosphere | MTGSDLLVVGPWIIFGVCLAALCIRLLRARRTGQRPPSAQRKDS* |
Ga0157372_103275063 | 3300013307 | Corn Rhizosphere | MTGSDLLVVAPWIIFAICVAVLCARLLRARRSASRPPSARRRHDD* |
Ga0181537_101705813 | 3300014201 | Bog | MTGSDLIVLAPWIIFAVCLLVLCTRLLRARRPAPRSPSAKRKHDD* |
Ga0182024_101055943 | 3300014501 | Permafrost | MTGSDLIVVAPWIIFAVCLAVLCIRLLCARRSAQRSPSARRGQDG* |
Ga0181525_100765604 | 3300014654 | Bog | MTGSDLIVLAPWIIFAVCLLVLCTRLLRARRSAPRSPSAKRKHDD* |
Ga0182037_109135951 | 3300016404 | Soil | MTGSDLIVVVPWIVFSVCLAVLCIRLIRARRPAHRSPCAKRRDDG |
Ga0187812_100014113 | 3300017821 | Freshwater Sediment | MTGSDLIVVTPWVIFGVCLAVLCVRLIRARRSAQRPPSARQDHDE |
Ga0187809_100124313 | 3300017937 | Freshwater Sediment | MTGSDLIVVAPWIVFGVCLAVLCVGLLRARRSAHRPPSARRRQDD |
Ga0187809_103718151 | 3300017937 | Freshwater Sediment | MTGSDLIVLAPWIIFGVCLAVLCTRLLRARRSAPRSPSARRRHDD |
Ga0187847_103521972 | 3300017948 | Peatland | MTGSDLIVAVPWIVFAICLVVLCASLIRGRRSGRR |
Ga0187855_108382802 | 3300018038 | Peatland | MNGSDLIVAAPWIVFAVCLAVLCICLLRARRSAKRPPSARR |
Ga0206356_105074403 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLIVVAPWIIFAICVAVLCARLLRARRSASRPRSARRRH |
Ga0206349_19746413 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTGSDLMVFAPWIIFAVCLAVVCTRLLRARWSAKRPPAAKRRESD |
Ga0206355_10406073 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLMVFAPWIIFAVCLAVVCTRLLRARWSAKRPPAAKRRESD |
Ga0206352_100191502 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | PLAPQHKAGTMTGSDLLVVAPWIIFAICVAVVCARLLRARRSASRPPSARRRHDD |
Ga0206354_100045343 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MVFAPWIIFAVCLAVVCTRLLRARWSAKRPPAAKRRESD |
Ga0206354_106767592 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLLVVAPWIIFAICVAVVCARLFRARRSASRPPSARRRHDD |
Ga0206353_117709953 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLLVVAPWIIFAICVAVVCARLLRARRSASRPPSARRRHDD |
Ga0179592_102066651 | 3300020199 | Vadose Zone Soil | MTGSDLIVLAPWIIFAICLVVLCARLLRARRSAQRPPPGRRGHDR |
Ga0210395_100051896 | 3300020582 | Soil | MTGSDLIVVAPWVIFGVCLAVLCVRLIRARRSAQRPPPARQDHDD |
Ga0210395_111044892 | 3300020582 | Soil | LAPWIIFAVCLLVLCTRLLRDRRSDRRPPGARGPHDD |
Ga0210395_111860972 | 3300020582 | Soil | MNGSDLIVLAPWIIFAVCLVVLCARLLRARRSAPRPPSGRRRHDR |
Ga0210395_112818181 | 3300020582 | Soil | SDLIVLAPWIIFAVCLVVLCARLLRARRSAQRPPPGRRRHDR |
Ga0210401_102175513 | 3300020583 | Soil | MTGSDLIVLAPWIIFAVCLVVLCARLLRARRSAQRPPPGRRRHDR |
Ga0179596_100366394 | 3300021086 | Vadose Zone Soil | MTGSDLIILAPWIIFAICVAVLCTRLLRARRSASRSP |
Ga0210396_100555593 | 3300021180 | Soil | MNGSDLIVLAPWIIFAVCLAVLCTRLLRARRSASRSRSAKRKHDD |
Ga0210396_103344272 | 3300021180 | Soil | MTGSDLIVLAPWIIFAICLVVLCTSLLRARRSASRRPSAKRRHDDKTLR |
Ga0210396_107568652 | 3300021180 | Soil | MIDSFLLVVAPWIIFGVCLILLCIRLLCARRTGDRSPELRRSR |
Ga0210396_111836172 | 3300021180 | Soil | MNGSDLIVLAPWIIFAICLVVLCARLLRARRSAPRPPSGRRRHDR |
Ga0210388_101100023 | 3300021181 | Soil | MTGSDLIVLAPWIIFAVCLVVLCASLFRARRSAPRSPSARRRHDD |
Ga0210388_101445912 | 3300021181 | Soil | MTGSDLIVLAPWIIFAVCLVVLCARLLRARRSAPRPPSGRRGHDR |
Ga0210388_101998871 | 3300021181 | Soil | MTGSDLIVLAPWIIFAICLLVLSARLLRARRSASRPPPGRREDDR |
Ga0210385_100047396 | 3300021402 | Soil | MTGSDLMVLAPWIIFAVCLLVLCTRLLRDRRSDRRPPGARGPHDD |
Ga0210397_103607273 | 3300021403 | Soil | MTGSDLIVIAPWIIFAIWLVVLCVRLLRARRFARQAPSARRRNHD |
Ga0210397_109372162 | 3300021403 | Soil | MTGSDLIVLAPWIIFAICLVVLCARLLRARRSAPRPPSGRRGHDR |
Ga0210389_104640081 | 3300021404 | Soil | MNGSDLIVLTPWIIFAVCLAVLCARLLRARRSASRSSSAKRKHDDNSA |
Ga0210387_108226122 | 3300021405 | Soil | MTENFLIVVAPWIIFGVCLVLLCIRLLRARRPGERSPGLRRRDDD |
Ga0210386_103886101 | 3300021406 | Soil | GSDLIVVVPWIIFAVCLVVLCVSLIRARRSAPRSPSARRRHRD |
Ga0210386_104060332 | 3300021406 | Soil | MTGSDLIVLAPWIIFAICLVVLCARLLRARRSAPRPPSRRRGHDR |
Ga0210386_109438912 | 3300021406 | Soil | MTGSDLIVLAPWIIFAICLVVLCTRLLRARRPAPRSRSARRRRDD |
Ga0210386_113862562 | 3300021406 | Soil | MTGSDLIVLAPWIIFAMCLLVLCTRLLLARRSAPRPRSARRRHGD |
Ga0210394_115240171 | 3300021420 | Soil | MTDSFLLVVAPWIIFGVCLILLCIRLLCARRTGDRSPEPRR |
Ga0210384_103199261 | 3300021432 | Soil | MTGSDLIVMAPWLIFAIWLVVLCIRLLRARRFARRAPSARRRNHD |
Ga0210390_103610913 | 3300021474 | Soil | AGLMTGSDLIVLAPWIIFAICLLVLCTRLLRARRSAPRSPSAKRKHDD |
Ga0210398_110183671 | 3300021477 | Soil | LIVLAPWLIFAVCLAVLCTRLLRARRSAPRSPSARRKHD |
Ga0210398_111218992 | 3300021477 | Soil | MTGSDLIVLAPWIIFAICLLVLCTRLLRARRSAPRSPSAKRKHDD |
Ga0126371_112989042 | 3300021560 | Tropical Forest Soil | MTGSDLIVVAPWIIFAIWLVVLCIRLLHARRFAQRSPSARRKHHD |
Ga0126371_126478272 | 3300021560 | Tropical Forest Soil | MTGSDLIVVAPWIIFAILLVVLCIRLLRARRFTRRAESARRK |
Ga0212123_100190893 | 3300022557 | Iron-Sulfur Acid Spring | MTGSDLIVLAPWIVFGVCLVVLCACLFRARRSAPRPPSRRRGHDR |
Ga0212123_104498812 | 3300022557 | Iron-Sulfur Acid Spring | MTGSDLIVLAPWIIFAICLLVLSARLFRARRSASRPPSGGREDDR |
Ga0233357_10024223 | 3300023056 | Soil | MTGSDLIVLAPWIIFAICLVVLCARLLRARRSAQRPPPDRRGHDR |
Ga0208356_10232322 | 3300025504 | Arctic Peat Soil | MTDSFLIVVAPWIIFGVCLIVLCIRLLRGRRRGERSAGLRRRRDD |
Ga0208586_10765682 | 3300025588 | Arctic Peat Soil | MTESFLIVVAPWIIFGVCLTVLCIRLLRARRPGERSPGLRRRRDD |
Ga0208586_11127412 | 3300025588 | Arctic Peat Soil | MTRSDLIVVAPWIIFAVCLAVLCIRLLRARRSAQRSSSARRGQDG |
Ga0207692_111444781 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLIVFAPWIIFAVCLVVVCTRLLRARWSAKRPPSAKRRDGN |
Ga0207699_102517593 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLIVFAPWIIFAICLAVVCTRLLRARWSAKRPPSAKRREGN |
Ga0207660_111881881 | 3300025917 | Corn Rhizosphere | MTGSDLMVFAPWIIFAVCLAVVCTRLLRARWSAKRPPAAK |
Ga0207649_103133951 | 3300025920 | Corn Rhizosphere | MTASDLLVVAPWIIFAICVAVVCARLLRARRSASRPPSARRRDDD |
Ga0207694_104163702 | 3300025924 | Corn Rhizosphere | MTGSDLLVVAPWIIFAICVAVVCARLFRARRSASRPPSARRRDDD |
Ga0207700_103612081 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IVFAPWIIFAICLAVVCTRLLRARWSAKRPPSAKRREGN |
Ga0207664_101839181 | 3300025929 | Agricultural Soil | MTGSDLIVFAPWIIFAVCLVVVCTRLLRARWSAKRPPSAKRRDGN |
Ga0207664_104716343 | 3300025929 | Agricultural Soil | MTGSDLIVVAPWIVFGVSLAILCVGLLRARRSAHRPRSARRRQDD |
Ga0207665_106750812 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGSDLIVFAPWIIFAICLAVVCTRLLRARWSAKRPPSAKRRDGN |
Ga0207674_101410375 | 3300026116 | Corn Rhizosphere | MTASDLLVVAPWIIFAICVAVVCARLLRARRSASRPPSARRRHDD |
Ga0209890_100102533 | 3300026291 | Soil | MTGSDLIVVAPWIIFAVCLTVLCIRLLCARRSAQRSPSARRGQDG |
Ga0179593_12234883 | 3300026555 | Vadose Zone Soil | MTGSDLIVLAPWIIFAICLLVLSARLLRARRSASRPPSGRREDDR |
Ga0207943_1025223 | 3300027089 | Forest Soil | MTDSFLLVVAPWIIFGVCLILLCIRLLCARRAGDRSPELRRSPD |
Ga0208488_10501933 | 3300027110 | Forest Soil | KAGLMTGSDLIVLAPWIIFAICLLVLCTRLLRARRSAPRSPSAKRKHDD |
Ga0208994_10146822 | 3300027164 | Forest Soil | MTGSDLIVMAPWIIFAICLVVLCARLLRARRSAQRPPSGRREHDR |
Ga0208994_10495132 | 3300027164 | Forest Soil | MTESFLIVVAPWIIFGVCLAVLCVRLLRARRPGERSPGLRRRDDD |
Ga0208987_10157492 | 3300027496 | Forest Soil | MNGSDLIVLAPWIIFAICLVVLCARLLRARRSAPRPPSGRREHDR |
Ga0209218_10627921 | 3300027505 | Forest Soil | MTDSFLLVVAPWIIFGVCLILLCIRLLCARRTGDRSPEPPRRRDDEP |
Ga0208985_10041035 | 3300027528 | Forest Soil | MTGSDLIVLAPWIIFAVCLVVVCTRLLRARWSAKRPPSANRREGD |
Ga0209115_11384582 | 3300027567 | Forest Soil | MTENFLIVVAPWIIFGVCLVLLCIRLLCARRPGERSPGLRRRDDD |
Ga0209178_11464542 | 3300027725 | Agricultural Soil | MTASDLLVVAPWIIFAICVAVVCARLFRARRSASRPP |
Ga0209177_100257252 | 3300027775 | Agricultural Soil | MTASDLLVVAPWIIFAICVAVVCARLFRARRSASRPPSARRRDDD |
Ga0209112_100074116 | 3300027817 | Forest Soil | MTGSDLIVLAPWIIFAVCLVVLCTRLLRARRPAPRSRSVRRRRDD |
Ga0209166_103876772 | 3300027857 | Surface Soil | MTESFLIVVAPWIIFGVCLTAVCILLLRARRPGERSPGLRRRRDD |
Ga0209380_102727981 | 3300027889 | Soil | MTGSDLIVLAPWIIFAICLLVLCTRLLRARRSAPRSPS |
Ga0209380_104505432 | 3300027889 | Soil | MTGSDLIVLAPWIIFAICLVVLCARLIRARRSASRPPSGRRGHDR |
Ga0209624_101819442 | 3300027895 | Forest Soil | MTGSDLIVLAPWIIFAICLLVLCARLLRARRSAPRPPSGRRGHDR |
Ga0209006_106564542 | 3300027908 | Forest Soil | MTGSDLIVVVPWIIFAVCLVVLCVSLIRARRSAPRSPSARRRHHD |
Ga0209006_112746102 | 3300027908 | Forest Soil | MTDSFLIVVAPWIIFGVCLTVLCIRLLRARRPGERSSGLRRKRDD |
Ga0137415_113654161 | 3300028536 | Vadose Zone Soil | LIVMAPWIIFAICLVVLCARLLRARRSAQRPPPGRRGHDR |
Ga0302232_100224623 | 3300028789 | Palsa | MTTSFLIVAAPWIIFGVCLTVLCLRLLRARRPGDRSPGLRRRRDD |
Ga0265338_1000091142 | 3300028800 | Rhizosphere | MTGSDLILVAPWIIFAVCLAVLCARLLRARRTARGRPARRRR |
Ga0311339_101029415 | 3300029999 | Palsa | MTGSDLMVVAPWIIFAVCLTALCIRLLRARRSAQRSSSARRGKTANPS |
Ga0302181_100070291 | 3300030056 | Palsa | MNGSDLIVAAPWIVFAVCLAVLYICLLRARRSARRRPSARREKDR |
Ga0311372_100491692 | 3300030520 | Palsa | MTGSDLIVLAPWIIFAVCLVVLCASLFRARRPAPRSKPARRRRR |
Ga0311372_119411721 | 3300030520 | Palsa | MTDSFLIVVAPWIIFGVCLTVLCIRLLRARRSGERSAGP |
Ga0307482_12206581 | 3300030730 | Hardwood Forest Soil | RSIRQGLMTGSDLIVVAPWIVFGVCLAVLCVGLLRARRSAHRPRSARRRQDD |
Ga0265753_10251582 | 3300030862 | Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLLRARRSAHRPPSAR |
Ga0302314_111764592 | 3300030906 | Palsa | MTASFLIVVAPWIIFGVCLALLCIRLLRARRPGKRSSALRRRDDD |
Ga0170824_1071126282 | 3300031231 | Forest Soil | MTGSDLIVVAPWIIFAVCLVVLCVSLIRARRSAPRSRSAKRRHDD |
Ga0318516_101564722 | 3300031543 | Soil | MTGSDLIVVVPWIVFSVCLAVLCIRLIRARRPAHRSPCAKRRDDD |
Ga0318528_107819391 | 3300031561 | Soil | MTGSDLIVVVPWIVFSVCLAVLCIRLIRARRPAHRSPCA |
Ga0318555_103125711 | 3300031640 | Soil | MTGSDLIVVVPWIVFSVCLAVLCIRLIRARRPAHR |
Ga0310686_1059802233 | 3300031708 | Soil | MNGSDLIVLAPWIIFAICLVVLCARLLRARRSAPRPPSGRRGHDR |
Ga0310686_1105229872 | 3300031708 | Soil | MTDSFLIVVAPWIIFGVCLTVLCIRLLRARRSGERSAGPRRRRGD |
Ga0310686_1173489858 | 3300031708 | Soil | MTGSDLMVLAPWIIFAVCLVVLCVSLLCARRSGRR |
Ga0310686_1174021852 | 3300031708 | Soil | MTGSDLIVVVPWIIFAVCLVVLCVSLVRARRSAPRSPSAKRRHHD |
Ga0318496_102844612 | 3300031713 | Soil | MTGSDLIVVAPWIVFSVCLAVLCIRLIRARRPAHRSPCAKRRDDD |
Ga0318496_104351322 | 3300031713 | Soil | MTGSDLIVLAPWIVFAVCLVVLCARLLRARRSAQRPPSGRRGHDR |
Ga0307476_100152725 | 3300031715 | Hardwood Forest Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLLRARRSAHRPRSARRRQDD |
Ga0307476_111325942 | 3300031715 | Hardwood Forest Soil | MTESFLIVVVPWIIFGVCLTVLCIRLLRARRPGQRSAGLRRRHDD |
Ga0307474_103056831 | 3300031718 | Hardwood Forest Soil | IVVAPWIILAVCLVVLCFRLRHSRRPRPRSPFVRRRDDD |
Ga0318502_107590552 | 3300031747 | Soil | MTGSDLIVVAPWIIFAVWLVVLCIRLLRARRFAQRSPSARRRHHD |
Ga0318550_104411992 | 3300031797 | Soil | MTGSDLIVVAPWIIFGVCLAVLCIRLLRARRPAHRSP |
Ga0318520_111059592 | 3300031897 | Soil | MTGSDLIVVVPWIVFSVCLAVICIRLIRARRPAHRSPCAKRRDDD |
Ga0308174_117638032 | 3300031939 | Soil | MTGSDLIVFAPWIIFAVCLAVVCTRLLRARWSAKRPPPAKRREGN |
Ga0318507_104069312 | 3300032025 | Soil | MTGSDLIVVVPWIVFGVCLVVLCIRLLRARRSPHRSPCAKRRHDD |
Ga0308173_100777083 | 3300032074 | Soil | MTGSDLIVFAPWIIFAVCLAVVCTRLLRARWSAKRPPSAKRREGNLGR |
Ga0318525_104585321 | 3300032089 | Soil | AGLMTGSDLIVVAPWIVFGVCLAVLCVGLHRARRSAQRPPSARRRQDD |
Ga0306920_1008245904 | 3300032261 | Soil | QGRMTGSDLIVVAPWIIFGVCLAVLCIRLLRARRPAQRSPSARRRQDD |
Ga0335085_100269713 | 3300032770 | Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLLRARRAAHRPPSARRRQDD |
Ga0335069_107640101 | 3300032893 | Soil | GSDLMVAAPWIVFAVCLAVLGIRLLRARRPARRSPAARRRHDGQTPG |
Ga0335074_100209626 | 3300032895 | Soil | MVAAPWIIFGVSLAVLCIRLLRARRPAPRSPSARRRHDD |
Ga0335074_100583966 | 3300032895 | Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLLRARRSAHRPPSVRRRHDD |
Ga0335075_100205827 | 3300032896 | Soil | MTGSDLIVMAPWIIFAVCLVVLCARLLRARRSARRPPSGRREHDR |
Ga0335075_103031792 | 3300032896 | Soil | MTESILLVVAPWIIFGVCLGLLCIRLLRARRPGARSPGLRRRHDD |
Ga0335071_120467742 | 3300032897 | Soil | MTGSDLIVLAPWIIFAVCLVVLCTRLLRARRSAPRSPSARRRHDD |
Ga0335073_107775731 | 3300033134 | Soil | MTGSDLIVVAPWIVFGVCLAVLCVGLLRARRSAHRPPSARRR |
Ga0310811_105577713 | 3300033475 | Soil | MTGSDLIVFAPWIIFAVCLAVVCTRLLRARWSAKRPPSAKRREGN |
Ga0310811_111678562 | 3300033475 | Soil | MTGSDLIVVAPWIIFAICVAVLCARLFRARRSASRSRSARRRHDD |
Ga0316214_10032283 | 3300033545 | Roots | MTGSDLIVLAPWIIFAICLLVLCTRLLRARRPAPRSPSAKRKHDD |
Ga0334850_066039_563_682 | 3300033828 | Soil | MTTSFLIVAAPWIIFGVCLTVLCLRLLRARRPGDRSPGLR |
Ga0370492_0221361_368_505 | 3300034282 | Untreated Peat Soil | MAGSDLMVVAPWIIFAVCLAVLCIRLLSARRSAQRSSSARRRQDG |
⦗Top⦘ |