NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026012

Metagenome / Metatranscriptome Family F026012

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026012
Family Type Metagenome / Metatranscriptome
Number of Sequences 199
Average Sequence Length 87 residues
Representative Sequence VQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Number of Associated Samples 153
Number of Associated Scaffolds 199

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 60.30 %
% of genes from short scaffolds (< 2000 bps) 52.26 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (34.171 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(33.668 % of family members)
Environment Ontology (ENVO) Unclassified
(36.181 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(78.392 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.79%    β-sheet: 17.21%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 199 Family Scaffolds
PF00237Ribosomal_L22 75.88
PF00252Ribosomal_L16 8.04
PF07650KH_2 7.04
PF00673Ribosomal_L5_C 1.51
PF00366Ribosomal_S17 1.51
PF00238Ribosomal_L14 1.01
PF00203Ribosomal_S19 1.01
PF00831Ribosomal_L29 1.01
PF00297Ribosomal_L3 0.50
PF00189Ribosomal_S3_C 0.50
PF00177Ribosomal_S7 0.50
PF00276Ribosomal_L23 0.50

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 199 Family Scaffolds
COG0091Ribosomal protein L22Translation, ribosomal structure and biogenesis [J] 75.88
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 8.04
COG0094Ribosomal protein L5Translation, ribosomal structure and biogenesis [J] 1.51
COG0186Ribosomal protein S17Translation, ribosomal structure and biogenesis [J] 1.51
COG0093Ribosomal protein L14Translation, ribosomal structure and biogenesis [J] 1.01
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 1.01
COG0255Ribosomal protein L29Translation, ribosomal structure and biogenesis [J] 1.01
COG0049Ribosomal protein S7Translation, ribosomal structure and biogenesis [J] 0.50
COG0087Ribosomal protein L3Translation, ribosomal structure and biogenesis [J] 0.50
COG0089Ribosomal protein L23Translation, ribosomal structure and biogenesis [J] 0.50
COG0092Ribosomal protein S3Translation, ribosomal structure and biogenesis [J] 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.83 %
UnclassifiedrootN/A34.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000792|BS_KBA_SWE02_21mDRAFT_10150937All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta572Open in IMG/M
3300003271|JGI26114J46594_1040170All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta715Open in IMG/M
3300003683|Ga0008459J53047_1017553All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens662Open in IMG/M
3300003683|Ga0008459J53047_1020886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2412Open in IMG/M
3300004008|Ga0055446_10238379All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta551Open in IMG/M
3300004097|Ga0055584_101573037All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta681Open in IMG/M
3300004097|Ga0055584_101780259All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens635Open in IMG/M
3300005758|Ga0078117_1047250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1576Open in IMG/M
3300005992|Ga0073924_1001380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4773Open in IMG/M
3300006383|Ga0075504_1062502All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta773Open in IMG/M
3300006394|Ga0075492_1539806All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1738Open in IMG/M
3300006396|Ga0075493_1575579All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta546Open in IMG/M
3300006424|Ga0075497_1071763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria10385Open in IMG/M
3300006484|Ga0070744_10069442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1024Open in IMG/M
3300006562|Ga0101390_1005214All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta598Open in IMG/M
3300006571|Ga0075505_1491874All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta764Open in IMG/M
3300006641|Ga0075471_10008422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6426Open in IMG/M
3300006870|Ga0075479_10410043All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta523Open in IMG/M
3300006874|Ga0075475_10121573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1164Open in IMG/M
3300006917|Ga0075472_10334759All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta747Open in IMG/M
3300007177|Ga0102978_1143091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2347Open in IMG/M
3300007230|Ga0075179_1685973All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta811Open in IMG/M
3300007321|Ga0102692_1516124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1065Open in IMG/M
3300007551|Ga0102881_1136433All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta678Open in IMG/M
3300007553|Ga0102819_1088281All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta526Open in IMG/M
3300007557|Ga0102821_1091329All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta777Open in IMG/M
3300007621|Ga0102872_1031392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1458Open in IMG/M
3300007667|Ga0102910_1065938All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta832Open in IMG/M
3300007681|Ga0102824_1016305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1998Open in IMG/M
3300007681|Ga0102824_1175031All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta565Open in IMG/M
3300007715|Ga0102827_1072046All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta777Open in IMG/M
3300007860|Ga0105735_1132869All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta544Open in IMG/M
3300007953|Ga0105738_1038165All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta749Open in IMG/M
3300008105|Ga0114338_1205294All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1046Open in IMG/M
3300008995|Ga0102888_1068494All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens699Open in IMG/M
3300009003|Ga0102813_1035366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1763Open in IMG/M
3300009003|Ga0102813_1137069All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta767Open in IMG/M
3300009057|Ga0102892_1100630All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta565Open in IMG/M
3300009058|Ga0102854_1102570All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta819Open in IMG/M
3300009079|Ga0102814_10117758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1455Open in IMG/M
3300009079|Ga0102814_10369208All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta781Open in IMG/M
3300009080|Ga0102815_10548804All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens648Open in IMG/M
3300009142|Ga0102885_1079107All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta788Open in IMG/M
3300009142|Ga0102885_1128623All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta615Open in IMG/M
3300009142|Ga0102885_1139715All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta590Open in IMG/M
3300009145|Ga0102961_1042303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1054Open in IMG/M
3300009543|Ga0115099_10224784All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta770Open in IMG/M
3300009599|Ga0115103_1578297All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta759Open in IMG/M
3300009606|Ga0115102_10056748All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta588Open in IMG/M
3300009606|Ga0115102_10612060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5395Open in IMG/M
3300010307|Ga0129319_1032521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales862Open in IMG/M
3300010354|Ga0129333_11173589All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens638Open in IMG/M
3300010997|Ga0139324_1006373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1910Open in IMG/M
3300012415|Ga0138263_1473380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4832Open in IMG/M
3300012417|Ga0138262_1035579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3767Open in IMG/M
3300012471|Ga0129334_1069242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1299Open in IMG/M
3300012767|Ga0138267_1232639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3003Open in IMG/M
3300012962|Ga0129335_1160751All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta741Open in IMG/M
3300012968|Ga0129337_1034996All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta520Open in IMG/M
3300012970|Ga0129338_1175595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1493Open in IMG/M
3300013010|Ga0129327_10354314All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta770Open in IMG/M
3300018713|Ga0192887_1000232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2480Open in IMG/M
3300018813|Ga0192872_1042450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria822Open in IMG/M
3300018980|Ga0192961_10008447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2137Open in IMG/M
3300018980|Ga0192961_10013743All Organisms → cellular organisms → Bacteria1865Open in IMG/M
3300018980|Ga0192961_10030735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1439Open in IMG/M
3300018980|Ga0192961_10137999All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta743Open in IMG/M
3300018980|Ga0192961_10170353All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens660Open in IMG/M
3300018980|Ga0192961_10251735All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta518Open in IMG/M
3300019010|Ga0193044_10198683All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens637Open in IMG/M
3300019022|Ga0192951_10000185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4416Open in IMG/M
3300019214|Ga0180037_1084949All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta514Open in IMG/M
3300019706|Ga0193995_1053973All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta517Open in IMG/M
3300019707|Ga0193989_1009386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria989Open in IMG/M
3300019710|Ga0194009_1022862All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta723Open in IMG/M
3300019721|Ga0194011_1000326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2738Open in IMG/M
3300019730|Ga0194001_1016231All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta802Open in IMG/M
3300019745|Ga0194002_1003561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1635Open in IMG/M
3300019745|Ga0194002_1081494All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta548Open in IMG/M
3300019751|Ga0194029_1016479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1102Open in IMG/M
3300019757|Ga0193964_1043172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1048Open in IMG/M
3300019765|Ga0194024_1021329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1384Open in IMG/M
3300020524|Ga0208858_1000926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5282Open in IMG/M
3300021282|Ga0210303_1007072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria11776Open in IMG/M
3300021305|Ga0210296_1024297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3703Open in IMG/M
3300021316|Ga0210351_1105758All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta720Open in IMG/M
3300021323|Ga0210295_1236296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1041Open in IMG/M
3300021347|Ga0213862_10013506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae3128Open in IMG/M
3300021371|Ga0213863_10260489All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta739Open in IMG/M
3300021389|Ga0213868_10318666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria885Open in IMG/M
3300021847|Ga0210305_1041263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya4914Open in IMG/M
3300022206|Ga0224499_10122985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria882Open in IMG/M
3300022206|Ga0224499_10130557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales855Open in IMG/M
3300022306|Ga0224509_10008343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae3280Open in IMG/M
3300022307|Ga0224507_10393520All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta562Open in IMG/M
3300022374|Ga0210311_1002078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2303Open in IMG/M
3300022374|Ga0210311_1018381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales842Open in IMG/M
3300023174|Ga0214921_10289277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Gomontiellaceae → Crinalium → Crinalium epipsammum923Open in IMG/M
3300023178|Ga0255759_10767868All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta522Open in IMG/M
(restricted) 3300024059|Ga0255040_10110778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1077Open in IMG/M
3300024346|Ga0244775_10005373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria13000Open in IMG/M
3300024346|Ga0244775_10154516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1936Open in IMG/M
3300025632|Ga0209194_1065315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria996Open in IMG/M
3300025684|Ga0209652_1120895All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta725Open in IMG/M
3300025684|Ga0209652_1128109All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta693Open in IMG/M
3300025879|Ga0209555_10014347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales4070Open in IMG/M
3300026099|Ga0209920_1016237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria972Open in IMG/M
3300027185|Ga0208672_1001283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae3226Open in IMG/M
3300027188|Ga0208921_1022358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria965Open in IMG/M
3300027191|Ga0208021_1004390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2216Open in IMG/M
3300027193|Ga0208800_1012619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1087Open in IMG/M
3300027193|Ga0208800_1022987All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta827Open in IMG/M
3300027198|Ga0208163_1080185All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta517Open in IMG/M
3300027217|Ga0208928_1039943All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta723Open in IMG/M
3300027225|Ga0208025_1061031All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta583Open in IMG/M
3300027228|Ga0208308_1009335All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1313Open in IMG/M
3300027230|Ga0208171_1000476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5165Open in IMG/M
3300027235|Ga0208804_1021045All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Biddulphiales → Biddulphiaceae → Biddulphia → Biddulphia tridens625Open in IMG/M
3300027243|Ga0208174_1012531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1067Open in IMG/M
3300027248|Ga0208176_1004492All Organisms → cellular organisms → Bacteria2074Open in IMG/M
3300027254|Ga0208177_1001130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3534Open in IMG/M
3300027308|Ga0208796_1019734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1639Open in IMG/M
3300027525|Ga0208437_1142747All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta538Open in IMG/M
3300027608|Ga0208974_1096816All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta791Open in IMG/M
3300027753|Ga0208305_10197249All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta725Open in IMG/M
3300027753|Ga0208305_10197668All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta724Open in IMG/M
3300031773|Ga0315332_10373323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales914Open in IMG/M
3300032257|Ga0316205_10288629All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta579Open in IMG/M
3300032272|Ga0316189_10832929All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta701Open in IMG/M
3300033482|Ga0316627_102966658All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta505Open in IMG/M
3300034166|Ga0335016_0751043All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta511Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine33.67%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.06%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.05%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment7.04%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.02%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment3.02%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.51%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.01%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.01%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.01%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat1.51%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.51%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.00%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.50%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.50%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.50%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.50%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.50%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.50%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.50%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.50%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.50%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.50%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.50%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.50%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.50%
SeawaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Seawater0.50%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.50%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.50%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.50%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.50%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000792Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21mEnvironmentalOpen in IMG/M
3300001004Marine microbial communities from the Deep Atlantic Ocean - MMD3.0EnvironmentalOpen in IMG/M
3300001824Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM36, ROCA_DNA073_0.2um_10gEnvironmentalOpen in IMG/M
3300003264Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10EnvironmentalOpen in IMG/M
3300003271Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10EnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004008Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300005954Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_21-May-14EnvironmentalOpen in IMG/M
3300005992Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006562Marine microbial communities from the Black Sea in Odessa region - Od_2EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007230Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007321Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007553Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007621Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007953Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3umEnvironmentalOpen in IMG/M
3300008105Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, sample E2014-0046-100-LTREnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009145Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MGEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010307Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010997ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019706Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_1-2_MGEnvironmentalOpen in IMG/M
3300019707Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MGEnvironmentalOpen in IMG/M
3300019710Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_5-6_MGEnvironmentalOpen in IMG/M
3300019715Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_2-3_MGEnvironmentalOpen in IMG/M
3300019721Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MGEnvironmentalOpen in IMG/M
3300019730Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MGEnvironmentalOpen in IMG/M
3300019731Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_3-4_MGEnvironmentalOpen in IMG/M
3300019736Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_5-6_MGEnvironmentalOpen in IMG/M
3300019737Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MGEnvironmentalOpen in IMG/M
3300019744Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_4-5_MGEnvironmentalOpen in IMG/M
3300019745Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MGEnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019752Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_1_MGEnvironmentalOpen in IMG/M
3300019757Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_7_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020524Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021282Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021316Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021847Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021907Marine eukaryotic communities from Monterey Bay, California, United States - M1_20Mar14CPVII9sort6BwellE17EnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022307Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022372Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022374Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026099Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027185Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 (SPAdes)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027225Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027228Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027230Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027258Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032257Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyriteEnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE02_21mDRAFT_1015093713300000792MarineVQFKHFYYVRDDICYLLKSNPIERDFLLEALSSIVISLQNNLSVNFFDMWVYEIYINKVSNHNKFINQKSQNLEPGEYITIKLAYGTSVSQEKK*
JGI12096J13111_1013023300001004Deep OceanPIERDFLLQALYSIVISLQNNLSINFFDMWVYDIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSQEKK*
ACM36_11706313300001824Marine PlanktonQALYSIVISLQNNLCINFFDMWIYEMYINKVPTHNKFMKQKSQNLEPGEYITIKLAYGSSGSQEKK*
JGI26119J46589_101657633300003264MarineLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
JGI26114J46594_104017023300003271MarineLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
JGI26083J51738_1009480523300003621MarineDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0008458J53046_10849313300003677SeawaterLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWVYEIYINKVSTHNKFMDRNSQDLEPGEYITIKLAYGSSVSQEKK*
Ga0008459J53047_101755313300003683SeawaterPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK*
Ga0008459J53047_102088613300003683SeawaterDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWVYEIYINKVSTHNKFMDRNSQDLEPGEYITIKLAYGSSVSQEKK*
Ga0031658_100855113300003860Freshwater Lake SedimentLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYESSVFQEKK*
Ga0055446_1023837923300004008Natural And Restored WetlandsFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK*
Ga0055584_10157303723300004097Pelagic MarineQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK*
Ga0055584_10178025913300004097Pelagic MarineQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK*
Ga0078117_104725043300005758Lake WaterRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLAINFFDMWIYEIYISKVSNSNKFLKESYQNKEFDEYITIKLAYGINTFQEKK*
Ga0070742_1013585913300005942EstuarinePSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0073925_103882223300005954SandIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0073924_100138013300005992SandKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075504_106250213300006383AqueousKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK*
Ga0075509_100395713300006390AqueousFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFINDKSQNLEQGEYITIKLAYGSSASQEKK*
Ga0075492_153980643300006394AqueousHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK*
Ga0075493_156783713300006396AqueousSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNRNSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075493_157557913300006396AqueousLQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK*
Ga0075497_107176313300006424AqueousSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKKIIFQY*
Ga0070744_1006944213300006484EstuarineFYYVRDDIDYRLKSHPMERDFLLQVLFSIAIYLQNNLSINFFDMWIYEIYISKVSNPNKFLKESSQNKEFDEYITIKLAYGINTSQEKK*
Ga0101390_100521423300006562MarineVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0075505_149187413300006571AqueousILQSLQFKHFYYVRDDIHYLLKSYPMERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKISKSNKFLKQTYQHKEYDEYITIKLAYNISPEKK*
Ga0075505_150065213300006571AqueousRDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK*
Ga0075471_10008422143300006641AqueousQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPVEYITIKLAYGSSVSQEKK*
Ga0075479_1041004313300006870AqueousPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0075475_1012157313300006874AqueousSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFINEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0075472_1033475923300006917AqueousQSVQFKHFYYVRDDISYLLKSHPMERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKVSNSNKFLRETYQNKEFDEYITIKLAYGINISQEKK*
Ga0102978_114309113300007177Freshwater LakeRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLSINFFDMWIYEIYISKVSNPNKFLKESYQNKEFDEYITIKLAYGINTFQEKK*
Ga0075179_168597323300007230Wastewater EffluentAKLILQSVQFKHFYYVRDDISYLLKANPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFIDKKNQNLEPGEYITIKLAYGVNTSQEKK*
Ga0102692_151612433300007321Freshwater LakeDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN*
Ga0102881_113643313300007551EstuarineSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102819_103695613300007553EstuarineVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK*
Ga0102819_108828123300007553EstuarineILKSLRFKHFYYVRDDISYLLRSNPTERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRINEKR*
Ga0102821_109132923300007557EstuarineDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK*
Ga0102914_117666613300007561EstuarineLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK*
Ga0102920_120446913300007600EstuarineNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102872_103139233300007621EstuarineHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK*
Ga0102910_106593823300007667EstuarineLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102824_101630513300007681EstuarineKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102824_117503113300007681EstuarineKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102827_107204613300007715EstuarineKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0105735_113286923300007860Estuary WaterDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0105738_103816513300007953Estuary WaterYLLKSNPIERDFLLQTLYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0105738_105160813300007953Estuary WaterDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0114338_120529413300008105Freshwater, PlanktonQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN*
Ga0102888_106849423300008995EstuarineSPLAKFILQGMQFKHFYYARDDIFYLLNSNPIEQQFLLQALYSISISLQNNLSVDFFDIWIYEVYINKVPRKNKFIIKSYQKLESKEYLTITLAYVIKKVSIKKKFVY*
Ga0102813_103536613300009003EstuarineLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK*
Ga0102813_113706923300009003EstuarineYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102829_122537023300009026EstuarineLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102860_1001333143300009056EstuarineLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK*
Ga0102892_101399043300009057EstuarineSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0102892_110063013300009057EstuarineSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEQGEYITIKLAYGSSVSQETK*
Ga0102854_110257023300009058EstuarineLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102814_1011775833300009079EstuarineYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK*
Ga0102814_1036920813300009079EstuarineSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK*
Ga0102814_1050526113300009079EstuarinePSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102814_1054425213300009079EstuarineSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK*
Ga0102815_1054604613300009080EstuarineYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWVYEIYINKVSTHNKFMDRNSQDLEPGEYITIKLAYGSSVSQEKK*
Ga0102815_1054880423300009080EstuarineQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMNQKLQNLEPCEYITIKLAYGVNRINEKR*
Ga0102815_1056514413300009080EstuarineERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK*
Ga0102812_1053841713300009086EstuarineLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102885_107910723300009142EstuarineLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0102885_112862323300009142EstuarineAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSQNSQNLEPGEYLTIKLAYGNSIS*
Ga0102885_113971513300009142EstuarineSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0102961_104230333300009145SoilPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK*
Ga0115007_1014716713300009441MarineLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLAYGRNGGFQEKK*
Ga0115099_1020352413300009543MarineRDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK*
Ga0115099_1022478413300009543MarinePLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK*
Ga0115099_1037319513300009543MarineLLQALYSTVISLQNNLSINYFDMWIYEIYINKVSINNKFLNQKSQNLKPEEYITIKLAYGNSVS*
Ga0115099_1039102713300009543MarineRDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115099_1100462413300009543MarineYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMDRNSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115103_157829723300009599MarineVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0115103_163864123300009599MarineRDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK*
Ga0115103_174493813300009599MarineSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQNSQNLEPGEYLTIKLAYGNSIS*
Ga0115102_1005674813300009606MarineAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSPHNKFISPKCQNLELGEYITITLAYRNSSFQEEDEELLKNLKYM*
Ga0115102_10612060123300009606MarineSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK*
Ga0123361_102123923300009741MarineLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLESGEYITIKLAYGSSGSQEKK*
Ga0129319_103252113300010307AqueousPLAKLILQNVQFKHFYYVRDDISYLLKYNPSERDFLLQALYSIVISLQNNLLINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK*
Ga0129333_1117358923300010354Freshwater To Marine Saline GradientVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0139324_100637313300010997SedimentFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK*
Ga0138258_162321543300012413Polar MarineDFLLQALSSIVISLQNNLSINFFDMWIYEVYINNVSTNNKFLNSKSQNLEPGEYITIKLAYGSNVSQEKK*
Ga0138263_147338043300012415Polar MarineVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSNVSQEKK*
Ga0138262_103557953300012417Polar MarineVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK*
Ga0129334_106924213300012471AqueousPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPVEYITIKLAYGSSVSQEKK*
Ga0129334_109686513300012471AqueousRDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0138267_123263983300012767Polar MarineYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSAKNKFMSQTSQNLESIEYITIKLAYGRNGGFQEKK*
Ga0129335_103044813300012962AqueousFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK*
Ga0129335_116075123300012962AqueousAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLAINFFDMWIYEIYISKVSKPNKFLKESNQNKEFDEYITIKLAYGINTSQEKK*
Ga0129337_103499623300012968AqueousMLTSNSKSIFQNCKVKPFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLAINFFDMWIYEIYISKVSNSNKFLKESYQNKEFDEYITIKLAYGINPFQKKK*
Ga0129338_117559533300012970AqueousFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK*
Ga0129327_1035431413300013010Freshwater To Marine Saline GradientKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSSVSQEKK*
Ga0192887_100023213300018713MarineAKSILQSASGKPFYYVREDIDSGLKSTPIERNFLLQYLHSIVIFLQNNLSIDFFNIWIVEIYINKIAVYNKFINQEYQNLDPEEYITIRLAYGHRVARKSYDD
Ga0193425_103283913300018743MarineERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTVPTDNKFMKQKSQNLEPNEYITIKLAYGSTLSQ
Ga0192872_104245013300018813MarineRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTVPTDNKFMKQKSQNLEPNEYITIKLAYGSTLSQ
Ga0193540_1022523323300018979MarineFLLQALYSSVIYLQNNLSINYFDMWIYEIYINKVSTNNKFLNQKSQNLKLEEYITIKLAYGSSVSS
Ga0192961_1000844713300018980MarineLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0192961_1001374343300018980MarineLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTHNKFMRQKSQNLESDEYITIKLAYGSSVS
Ga0192961_1003073533300018980MarineLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKISTHNKFLNQKSQNLESDEYITIKLAYGSSVPQEKK
Ga0192961_1013799923300018980MarineLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFMSQKSQKLESGEYLTIKLAYGSRISQEKK
Ga0192961_1017035313300018980MarineLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0192961_1025173523300018980MarineYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEVYINNVSTNNKFLNSKSQNLEPGEYITIKLAYGSNVSQEKK
Ga0193044_1019868313300019010MarineLAKLILQGMQFKHFYYARDDIFYLLNSNPIEQEFLLQALYSMSISLQNNLSVDFFDIWISEVYINKVPLKNKFIIKPYQKLESKEYITITLAYVIKKVSTKKKFVY
Ga0192951_1000018533300019022MarineLQSIQFKHFYYVRDDIFYLLKSNIAERDYILQSLYSIVIYLQNNLSINFFDMWIYEVYINETLTKNKFMIQTSQNLESCEYITIKLAYGKKVT
Ga0180032_100407423300019201EstuarineLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0180032_110171343300019201EstuarineERDFLLQALYSIVISLQNNLSIDFFDMWIYEIYLTKVSNPNKFIKEVYQHKEFNEYITIKLAYKIDSPKEKKKTYK
Ga0180037_102173063300019214EstuarineFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0180037_108494913300019214EstuarineRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK
Ga0193995_105397323300019706SedimentAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0193989_100938633300019707SedimentLQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNIEPDEYITIKLAYGSSVSQEKK
Ga0193989_104490813300019707SedimentIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEK
Ga0194009_102286223300019710SedimentPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0194009_105859123300019710SedimentYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0193966_102292213300019715SedimentLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHQEPSEYITIKLAYGSNVSQEKK
Ga0194011_100032673300019721SedimentLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0194001_101623113300019730SedimentLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNLEPGEYLTIKLAYGNSIS
Ga0193982_102780313300019731SedimentYSTVISLQNNLSINFFDMWIYEIYINKVETNNKFMSQKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0194019_101049733300019736SedimentERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0193973_100160213300019737SedimentNRYPNEREFLLQALFSIAISLQNNLSINFFDMWVYEIYMTKISTPNKFLKKNSQNKEFDEYITIKLAYNIFQEKK
Ga0193998_104085723300019744SedimentHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0194002_100356143300019745SedimentAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQTLYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFMSHKSQNLEPGEYLTIKLAYGNSIS
Ga0194002_108149423300019745SedimentPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSQEKK
Ga0194029_101647913300019751FreshwaterLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSISFFDIWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0193958_104146933300019752Freshwater Microbial MatISLQNNLSINFFDMWVYDIYINKVETHNKFMSQKSQNLESDEYITIKLAYGSSVSQEKK
Ga0193958_111766123300019752Freshwater Microbial MatLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKVSSNNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0193964_104317213300019757Freshwater Microbial MatLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKFQHLEPSEYITIKLAYGSNVSQEKK
Ga0194024_102132933300019765FreshwaterILQSLQFKHFYYVRDDIHYLLKSYPTERDFLLQALYSIVISLQNNFSINFFDMWIYEIYITKVSKPNKFLKQTYQYKGFDEYITIKLAYNISPEKK
Ga0194127_1093949623300020221Freshwater LakeISLQNNLSINFFDMWIYEIYINKVSTPNKFMSRKSQNIESGEYITIKLAYGSSVSQEKK
Ga0208858_1000926123300020524FreshwaterHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0210303_100707213300021282EstuarineKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0210303_104506013300021282EstuarineKSNPSERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK
Ga0210296_102429763300021305EstuarineVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0210351_110575823300021316EstuarineQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKN
Ga0210295_112984013300021323EstuarineDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0210295_123629613300021323EstuarineLQSVQFKHFYYVRDDICYLLKSNPIERDFLLEALSSIVISLQNNLSVNFFDMWVYEIYINKVSNHNKFINQKSQNLEPGEYITIKLAYGTSVSQEKK
Ga0213862_1001350613300021347SeawaterLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQERK
Ga0213863_1026048923300021371SeawaterDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYDIYINKVETHNKFMSQKSQNLESDEYITIKLAYGSSVSQEKK
Ga0213861_1052807313300021378SeawaterRDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0213868_1031866633300021389SeawaterLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYDIYINKVETHNKFMSQKSQNLESDEYITIKLAYGSSVSQEKK
Ga0210305_104126363300021847EstuarineVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0214480_10775813300021907SeawaterLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0222719_1072447523300021964Estuarine WaterVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSERSQNLEPGEYITIKLAYGSSVS
Ga0224498_1014519813300022202SedimentSLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0224499_1012298513300022206SedimentFYYVRDDISYLLKSHPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK
Ga0224499_1013055713300022206SedimentLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK
Ga0224509_1000834313300022306SedimentKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSINFFDMWVYEIYINKVSTHNKFMSQKFQNLEPSEYITIKLAYGSNVSQEKK
Ga0224507_1039352023300022307SedimentLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSINNKFMNQKFQNLESGEYITIKLAYGNNVSQEKK
Ga0224504_1034867413300022308SedimentLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNDKSQNLEQGEYITIKLAYGSSVSQEKK
Ga0210312_10089013300022367EstuarineQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0210293_11840123300022372EstuarineISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMNQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0210311_100207853300022374EstuarineDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYVNKVSTHNKFMNQKSQSLEPGEYITIKLAYGSSVSQEKK
Ga0210311_101838133300022374EstuarineLILQNVQFKHFDYVRDDRSYLLKSNPSERNFLFQVLYSIVISLQNNLSINFFDMWIYEIYINKVSTNNKFMSQKSQKLESGEYLTIKLAYGSRISQEKK
Ga0214921_1028927713300023174FreshwaterQNVRFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINYFDMWIYEIYINKVSTHNKFMSQKSQSPEPEEYITIKLAYGSSVL
Ga0255759_1076786813300023178Salt MarshKHFYYVRDDIYYLLKSNSIERDFLLQALYSTVIALQNNLSINFFDMWIYEIYITKKPNSNKFLRETSQKKEFEEYITFKLAYNISEEKK
(restricted) Ga0255040_1011077823300024059SeawaterLKLKPLMLNLKKILQSVRFKHFYYVRDDISYLLKSNPIERYFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNISQEKK
Ga0244775_10005373253300024346EstuarineAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0244775_1015451653300024346EstuarineLAKLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSENLEPGEYITIKLAYGSSVSQEKK
Ga0244775_1105681023300024346EstuarineQSLYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEYITIKLAYGSSVSQEKK
Ga0209194_106531513300025632Pelagic MarineLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0209652_112089513300025684MarineILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0209652_112810913300025684MarineYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYVNKVSTHNKFMNQKSQSLEPGEYITIKLAYESSVSQEKNNSSILK
Ga0208784_113184833300025732AqueousKSHPMERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKISTPNKFLKKSSQNKEFDEYITIKLAYNIL
Ga0209555_10014347103300025879MarineKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0209920_101623713300026099SoilSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINFFDMWVYEIYINKVSTHNKFMNQKSQNLEPDEYITIKLAYGSSVSQEKK
Ga0208672_100128383300027185EstuarineAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208797_102779623300027186EstuarineYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208921_102235833300027188EstuarineFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0208021_100439053300027191EstuarineLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMNGKSQNLEADEYITIKIAYGFNVSQERK
Ga0208021_103700523300027191EstuarineNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208800_101261933300027193EstuarineLILQSVQFKHFYYVRDDICYLLKSNPIERDFLLEALSSIVISLQNNLSVNFFDMWVYEIYINKVSNHNKFINQKSQNLEPGEYITIKLAYGTSVSQEKK
Ga0208800_102298713300027193EstuarineLSPLTKLILQNVQFKHFYYVRDDISYLLKSNPNERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSRKSQNIEPGEYITIKLAYGSSVSQEKK
Ga0208163_108018523300027198EstuarineQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHNKFMSQKSENLEPGEYITIKLAYGSSISQEKK
Ga0208928_103994323300027217EstuarineVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK
Ga0208025_106103113300027225EstuarineLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0208308_100933513300027228EstuarineILQGMQFKHFYYARDDIFYLLNSNPIEQQFLLQALYSISISLQNNLSVDFFDIWIYEVYINKVPRKNKFIIKSYQKLESKEYLTITLAYVIKKVSIKKKFVY
Ga0208171_100047613300027230EstuarineVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0208804_102104523300027235EstuarinePLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTYNKFMSQKSQNLEPGEYLTIKLAYGSSVSQEKK
Ga0208174_101253133300027243EstuarineKLILQSVQLKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208176_100449253300027248EstuarineFVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKSQNLEADEYITIKIAYGFNVSQEKK
Ga0208177_100113073300027254EstuarineMFNLNNFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0208558_100326563300027258EstuarineLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK
Ga0208796_101973413300027308EstuarineRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208437_114274713300027525EstuarineLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK
Ga0208974_109681623300027608Freshwater LenticNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208305_1019724913300027753EstuarineFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTQNKFMSQKSQNLEPGEYITIKLAYGSSVSQEKK
Ga0208305_1019766813300027753EstuarineYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYIRKVSTHNKFMSQTSENLEPGEYITIKLAYGSSVSQEKK
Ga0208671_1027901413300027757EstuarineFLLQALYSIVISLQNNLSVNFFDMWVYEIYINKVSTHNKFMDRNSQDLEPGEYITIKLAYGSSVSQEKK
Ga0209713_1102833623300027883MarineSNPIERDFLLQALYSIVISLQNNLSVNFFDMWVYEIYINKVSTHNKFMDRNSQDLEPGEYITIKLAYGSSVSQEKK
Ga0209404_1035411913300027906MarineFLLQALYSIVISLQNNLSVNFFDMWIYEIYINTVPTDNKFMKQKSQNLEPNEYITIKLAYGSTLSQ
Ga0315332_1037332313300031773SeawaterVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0315315_1177194723300032073SeawaterRDFLLQALYSIVISLQNNLSINFFDMWVYDIYINKVSSHNKFMNEKSQNIETDEYITIKLAYGFNVSQEKK
Ga0316205_1028862923300032257Microbial MatKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMNQKFQNLEPSEYITIKLAYGNNVSQEKK
Ga0316189_1083292913300032272Worm BurrowLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYITKLSTRNKFMSQKSQNLEPGEYLTIKLAYGSNISQEKNNISLLK
Ga0316202_1032856923300032277Microbial MatYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYINKISTHNKFLNQKSQNLESDEYITIKLAYGSSVPQEKK
Ga0316627_10296665813300033482SoilQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQEKK
Ga0335016_0751043_10_2703300034166FreshwaterVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIHNKFMSQKFQNLEPGEYITIKLAYGSSVSQEKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.