Basic Information | |
---|---|
Family ID | F025837 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 200 |
Average Sequence Length | 44 residues |
Representative Sequence | TANIRGTIEFDTPVGAQIGALGIRIPVAHTFTTLPALAK |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 200 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.51 % |
% of genes near scaffold ends (potentially truncated) | 95.50 % |
% of genes from short scaffolds (< 2000 bps) | 89.50 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (12.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (61.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.500 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.37% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 200 Family Scaffolds |
---|---|---|
PF01425 | Amidase | 5.50 |
PF07883 | Cupin_2 | 4.50 |
PF11954 | DUF3471 | 2.50 |
PF07728 | AAA_5 | 2.50 |
PF05016 | ParE_toxin | 2.00 |
PF02900 | LigB | 2.00 |
PF04389 | Peptidase_M28 | 2.00 |
PF07746 | LigA | 2.00 |
PF13418 | Kelch_4 | 1.50 |
PF13637 | Ank_4 | 1.50 |
PF12796 | Ank_2 | 1.50 |
PF16396 | DUF5005 | 1.50 |
PF00909 | Ammonium_transp | 1.00 |
PF02452 | PemK_toxin | 1.00 |
PF07043 | DUF1328 | 1.00 |
PF03712 | Cu2_monoox_C | 1.00 |
PF15919 | HicB_lk_antitox | 1.00 |
PF01321 | Creatinase_N | 1.00 |
PF00891 | Methyltransf_2 | 1.00 |
PF03693 | ParD_antitoxin | 1.00 |
PF00005 | ABC_tran | 0.50 |
PF13810 | DUF4185 | 0.50 |
PF00654 | Voltage_CLC | 0.50 |
PF01027 | Bax1-I | 0.50 |
PF01479 | S4 | 0.50 |
PF13673 | Acetyltransf_10 | 0.50 |
PF07494 | Reg_prop | 0.50 |
PF07589 | PEP-CTERM | 0.50 |
PF04909 | Amidohydro_2 | 0.50 |
PF13906 | AA_permease_C | 0.50 |
PF07719 | TPR_2 | 0.50 |
PF13649 | Methyltransf_25 | 0.50 |
PF00413 | Peptidase_M10 | 0.50 |
PF01553 | Acyltransferase | 0.50 |
PF00572 | Ribosomal_L13 | 0.50 |
PF07690 | MFS_1 | 0.50 |
PF02913 | FAD-oxidase_C | 0.50 |
PF12867 | DinB_2 | 0.50 |
PF13924 | Lipocalin_5 | 0.50 |
PF03466 | LysR_substrate | 0.50 |
PF01522 | Polysacc_deac_1 | 0.50 |
PF06282 | DUF1036 | 0.50 |
PF06094 | GGACT | 0.50 |
PF13857 | Ank_5 | 0.50 |
PF01979 | Amidohydro_1 | 0.50 |
PF00449 | Urease_alpha | 0.50 |
PF00034 | Cytochrom_C | 0.50 |
PF07626 | PSD3 | 0.50 |
PF01569 | PAP2 | 0.50 |
PF07811 | TadE | 0.50 |
PF00903 | Glyoxalase | 0.50 |
PF03544 | TonB_C | 0.50 |
PF00027 | cNMP_binding | 0.50 |
PF13490 | zf-HC2 | 0.50 |
PF00535 | Glycos_transf_2 | 0.50 |
PF00588 | SpoU_methylase | 0.50 |
PF09586 | YfhO | 0.50 |
PF04368 | DUF507 | 0.50 |
PF07238 | PilZ | 0.50 |
PF13466 | STAS_2 | 0.50 |
PF04972 | BON | 0.50 |
COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
---|---|---|---|
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 5.50 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 1.00 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 1.00 |
COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 1.00 |
COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 1.00 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 1.00 |
COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
COG5480 | Uncharacterized membrane protein | Function unknown [S] | 0.50 |
COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.50 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
COG0804 | Urease alpha subunit | Amino acid transport and metabolism [E] | 0.50 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.50 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.50 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.50 |
COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.50 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.50 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.00 % |
Unclassified | root | N/A | 28.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918007|ConsensusfromContig169973 | Not Available | 680 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101505027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
3300000789|JGI1027J11758_12422438 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300004092|Ga0062389_101841808 | Not Available | 784 | Open in IMG/M |
3300004114|Ga0062593_101037920 | Not Available | 844 | Open in IMG/M |
3300005329|Ga0070683_102398708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300005334|Ga0068869_101084016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300005334|Ga0068869_101875838 | Not Available | 537 | Open in IMG/M |
3300005335|Ga0070666_10756573 | Not Available | 714 | Open in IMG/M |
3300005336|Ga0070680_100234513 | Not Available | 1550 | Open in IMG/M |
3300005336|Ga0070680_100497739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1043 | Open in IMG/M |
3300005356|Ga0070674_102135407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300005366|Ga0070659_100510949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
3300005367|Ga0070667_100790975 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300005439|Ga0070711_101863319 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005440|Ga0070705_101930665 | Not Available | 503 | Open in IMG/M |
3300005456|Ga0070678_101170125 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300005458|Ga0070681_10227490 | Not Available | 1780 | Open in IMG/M |
3300005458|Ga0070681_10496488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1133 | Open in IMG/M |
3300005458|Ga0070681_11603681 | Not Available | 576 | Open in IMG/M |
3300005530|Ga0070679_100180618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2082 | Open in IMG/M |
3300005535|Ga0070684_100532291 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300005535|Ga0070684_101321373 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300005547|Ga0070693_100674522 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300005563|Ga0068855_100211361 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
3300005563|Ga0068855_100544418 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
3300005564|Ga0070664_101774189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300005578|Ga0068854_102144752 | Not Available | 516 | Open in IMG/M |
3300005614|Ga0068856_101253962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 757 | Open in IMG/M |
3300005616|Ga0068852_102034153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300005618|Ga0068864_100113101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2420 | Open in IMG/M |
3300005618|Ga0068864_102612883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300005718|Ga0068866_10896490 | Not Available | 623 | Open in IMG/M |
3300005842|Ga0068858_100745353 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300005842|Ga0068858_100872141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
3300005842|Ga0068858_102557491 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005843|Ga0068860_101591392 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300006047|Ga0075024_100765040 | Not Available | 537 | Open in IMG/M |
3300006050|Ga0075028_100332058 | Not Available | 855 | Open in IMG/M |
3300006052|Ga0075029_100999762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300006059|Ga0075017_100813337 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300006162|Ga0075030_100672470 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300006162|Ga0075030_101265949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300006162|Ga0075030_101376374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300006172|Ga0075018_10310415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 780 | Open in IMG/M |
3300006174|Ga0075014_100818988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 551 | Open in IMG/M |
3300006237|Ga0097621_100229269 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
3300006354|Ga0075021_11016932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300006358|Ga0068871_100659625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
3300006358|Ga0068871_101391891 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300006358|Ga0068871_101521039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300006755|Ga0079222_10050930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1923 | Open in IMG/M |
3300006854|Ga0075425_102383602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300006881|Ga0068865_100070636 | Not Available | 2474 | Open in IMG/M |
3300009012|Ga0066710_104916577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300009088|Ga0099830_11514067 | Not Available | 559 | Open in IMG/M |
3300009093|Ga0105240_10713656 | Not Available | 1093 | Open in IMG/M |
3300009093|Ga0105240_11115192 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300009098|Ga0105245_10023660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5392 | Open in IMG/M |
3300009098|Ga0105245_10102109 | Not Available | 2655 | Open in IMG/M |
3300009098|Ga0105245_11674556 | Not Available | 688 | Open in IMG/M |
3300009098|Ga0105245_12146791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300009101|Ga0105247_11200366 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300009101|Ga0105247_11789636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300009148|Ga0105243_10147412 | Not Available | 2015 | Open in IMG/M |
3300009148|Ga0105243_12151632 | Not Available | 594 | Open in IMG/M |
3300009148|Ga0105243_12562664 | Not Available | 549 | Open in IMG/M |
3300009174|Ga0105241_10234657 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSLD10 | 1548 | Open in IMG/M |
3300009174|Ga0105241_10713382 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300009174|Ga0105241_11596278 | Not Available | 631 | Open in IMG/M |
3300009174|Ga0105241_12417367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300009176|Ga0105242_12816268 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300009177|Ga0105248_11313633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300009545|Ga0105237_10554431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 1156 | Open in IMG/M |
3300009545|Ga0105237_11179338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
3300009545|Ga0105237_12097142 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300009551|Ga0105238_10146529 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
3300009553|Ga0105249_11948933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 660 | Open in IMG/M |
3300009764|Ga0116134_1208058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300010159|Ga0099796_10408212 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010373|Ga0134128_10735651 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300010373|Ga0134128_13218184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300010375|Ga0105239_10264696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1933 | Open in IMG/M |
3300010375|Ga0105239_11339931 | Not Available | 826 | Open in IMG/M |
3300010397|Ga0134124_13224958 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300010399|Ga0134127_13136738 | Not Available | 540 | Open in IMG/M |
3300010400|Ga0134122_13042252 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300010401|Ga0134121_12568897 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300011119|Ga0105246_10567090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
3300012212|Ga0150985_112621017 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1420 | Open in IMG/M |
3300012357|Ga0137384_10357271 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300012361|Ga0137360_10430630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
3300012923|Ga0137359_10516302 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300013104|Ga0157370_10387348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1287 | Open in IMG/M |
3300013104|Ga0157370_10416509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
3300013104|Ga0157370_11295008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
3300013296|Ga0157374_10078531 | Not Available | 3126 | Open in IMG/M |
3300013296|Ga0157374_11325574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300013296|Ga0157374_11670673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300013296|Ga0157374_11692665 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300013297|Ga0157378_11448181 | Not Available | 731 | Open in IMG/M |
3300013297|Ga0157378_12870785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300013306|Ga0163162_12090805 | Not Available | 649 | Open in IMG/M |
3300013307|Ga0157372_10186709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2401 | Open in IMG/M |
3300013307|Ga0157372_11946397 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300013307|Ga0157372_13070881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300013308|Ga0157375_10026585 | All Organisms → cellular organisms → Bacteria | 5397 | Open in IMG/M |
3300013308|Ga0157375_13565593 | Not Available | 518 | Open in IMG/M |
3300013308|Ga0157375_13664604 | Not Available | 511 | Open in IMG/M |
3300014199|Ga0181535_10445234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300014200|Ga0181526_11063185 | Not Available | 508 | Open in IMG/M |
3300014838|Ga0182030_10323776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1675 | Open in IMG/M |
3300014969|Ga0157376_11376436 | Not Available | 737 | Open in IMG/M |
3300015063|Ga0167649_100749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4640 | Open in IMG/M |
3300015203|Ga0167650_1038845 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1238 | Open in IMG/M |
3300015203|Ga0167650_1045690 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300016750|Ga0181505_10313671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 941 | Open in IMG/M |
3300016750|Ga0181505_10953668 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300017946|Ga0187879_10534691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300018035|Ga0187875_10259832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
3300018038|Ga0187855_10948129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300018086|Ga0187769_11445743 | Not Available | 520 | Open in IMG/M |
3300021432|Ga0210384_10129971 | Not Available | 2260 | Open in IMG/M |
3300021432|Ga0210384_11158336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300025903|Ga0207680_10339793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 1053 | Open in IMG/M |
3300025903|Ga0207680_11186661 | Not Available | 544 | Open in IMG/M |
3300025911|Ga0207654_10306219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1082 | Open in IMG/M |
3300025911|Ga0207654_10507902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
3300025911|Ga0207654_10843568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300025911|Ga0207654_10928380 | Not Available | 631 | Open in IMG/M |
3300025911|Ga0207654_11306579 | Not Available | 529 | Open in IMG/M |
3300025912|Ga0207707_11510295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300025913|Ga0207695_10172877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2085 | Open in IMG/M |
3300025913|Ga0207695_10971418 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300025913|Ga0207695_11586246 | Not Available | 535 | Open in IMG/M |
3300025914|Ga0207671_10883528 | Not Available | 707 | Open in IMG/M |
3300025914|Ga0207671_10991706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 662 | Open in IMG/M |
3300025914|Ga0207671_11239055 | Not Available | 582 | Open in IMG/M |
3300025914|Ga0207671_11598285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 501 | Open in IMG/M |
3300025917|Ga0207660_10405829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
3300025917|Ga0207660_10721906 | Not Available | 813 | Open in IMG/M |
3300025920|Ga0207649_11100246 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300025927|Ga0207687_10530234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 986 | Open in IMG/M |
3300025927|Ga0207687_10628831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
3300025927|Ga0207687_10958286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
3300025927|Ga0207687_11380299 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300025934|Ga0207686_10147200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1635 | Open in IMG/M |
3300025934|Ga0207686_10404066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300025934|Ga0207686_11301650 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300025935|Ga0207709_10382841 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300025935|Ga0207709_11363714 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300025937|Ga0207669_11743465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300025941|Ga0207711_10571387 | Not Available | 1055 | Open in IMG/M |
3300025942|Ga0207689_11167123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300025944|Ga0207661_10216645 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
3300025944|Ga0207661_10230156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1641 | Open in IMG/M |
3300025949|Ga0207667_10049529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4436 | Open in IMG/M |
3300025949|Ga0207667_10277381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1713 | Open in IMG/M |
3300025949|Ga0207667_10336942 | Not Available | 1540 | Open in IMG/M |
3300025986|Ga0207658_10901068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300026023|Ga0207677_10145932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1818 | Open in IMG/M |
3300026041|Ga0207639_10237668 | Not Available | 1582 | Open in IMG/M |
3300026041|Ga0207639_10349622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
3300026041|Ga0207639_10727203 | Not Available | 922 | Open in IMG/M |
3300026041|Ga0207639_10763727 | Not Available | 899 | Open in IMG/M |
3300026041|Ga0207639_10837739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300026041|Ga0207639_10872396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
3300026078|Ga0207702_10030592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4485 | Open in IMG/M |
3300026078|Ga0207702_10277505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1583 | Open in IMG/M |
3300026078|Ga0207702_11055054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 806 | Open in IMG/M |
3300026088|Ga0207641_10011530 | All Organisms → cellular organisms → Bacteria | 7256 | Open in IMG/M |
3300027432|Ga0209421_1098841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 596 | Open in IMG/M |
3300027787|Ga0209074_10328784 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300027905|Ga0209415_10778503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 670 | Open in IMG/M |
3300027915|Ga0209069_10700893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
3300028381|Ga0268264_10495424 | Not Available | 1191 | Open in IMG/M |
3300028381|Ga0268264_10636937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1054 | Open in IMG/M |
3300028381|Ga0268264_12050878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300031236|Ga0302324_100927101 | Not Available | 1194 | Open in IMG/M |
3300031241|Ga0265325_10183517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 973 | Open in IMG/M |
3300031469|Ga0170819_16033060 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300031708|Ga0310686_100465945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 588 | Open in IMG/M |
3300031712|Ga0265342_10577795 | Not Available | 568 | Open in IMG/M |
3300031715|Ga0307476_10765379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 715 | Open in IMG/M |
3300031720|Ga0307469_12073456 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300031720|Ga0307469_12185538 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300031823|Ga0307478_11455968 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300032174|Ga0307470_10089977 | Not Available | 1724 | Open in IMG/M |
3300032174|Ga0307470_10137451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1472 | Open in IMG/M |
3300032515|Ga0348332_14116542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300033433|Ga0326726_10222116 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
3300033433|Ga0326726_12063825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300033475|Ga0310811_10602941 | Not Available | 1102 | Open in IMG/M |
3300034163|Ga0370515_0291902 | Not Available | 690 | Open in IMG/M |
3300034281|Ga0370481_0192803 | Not Available | 719 | Open in IMG/M |
3300034354|Ga0364943_0215981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 709 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 12.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 9.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 9.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 8.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.50% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.00% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.50% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.50% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.50% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.50% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.50% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.50% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.50% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.50% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.50% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.50% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.50% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A_all_C_03430390 | 2140918007 | Soil | AAGIRGTIEFDTPANAQIGALGIRIPAGAHTFTTLPALVK |
INPhiseqgaiiFebDRAFT_1015050272 | 3300000364 | Soil | MVPAPAFTLVTDKYPATANTRGTIEFDTPADAQIGELGIRIPPTRTYTTLPTLAK* |
JGI1027J11758_124224381 | 3300000789 | Soil | VFDRYPATANIRGTIEFGTPAGAQIGALGIRIPNVAAHTYTTLPALAK* |
Ga0062389_1018418081 | 3300004092 | Bog Forest Soil | NIRGTIEFDAPAGAQIGALGIRIPAGAAHTYTTLPALAK* |
Ga0062593_1010379202 | 3300004114 | Soil | LAFTLGSGKYPATAGIRGTIEFDTPPNAQIGALGIRIPAAAHTFTTLPALAK* |
Ga0070683_1000671613 | 3300005329 | Corn Rhizosphere | FTLAVDKFPETARIRGTIELDAPPGTQISVLGIRVRPAHTFTTLPALTK* |
Ga0070683_1023987082 | 3300005329 | Corn Rhizosphere | LAFTLVTDKYLNTAGIRGTIEFDTPPGAQIGALGIRIPVAHTFTTLPALVR* |
Ga0068869_1010840161 | 3300005334 | Miscanthus Rhizosphere | TANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK* |
Ga0068869_1018758381 | 3300005334 | Miscanthus Rhizosphere | KYQVTQNIRGTVEFDTPAGAQIGALGIRIPLAHTFTTLPALAK* |
Ga0070666_107565731 | 3300005335 | Switchgrass Rhizosphere | LVTDKYPGTANIRGTIEFDKPANGQIGALGIRIPAGSAHTYTTLPALAK* |
Ga0070680_1002345131 | 3300005336 | Corn Rhizosphere | GKYPATAGVRGTLEFDTPANAQIGVLGIRIPSAAHTFTTLPALAK* |
Ga0070680_1004977393 | 3300005336 | Corn Rhizosphere | TLATDKYPVTANRRGTIEFDAPAGVQIGVLGIRIPIAHTFTSLPALAN* |
Ga0070674_1021354072 | 3300005356 | Miscanthus Rhizosphere | YLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK* |
Ga0070659_1005109491 | 3300005366 | Corn Rhizosphere | AFTLVTDKYPMTANIRGTIEFDAPPGGQIGALAFRIPTAHTFTTLPALAK* |
Ga0070667_1007909752 | 3300005367 | Switchgrass Rhizosphere | NIRGIIEFDAPPGAQIGALGIRIPNSAAHTYTTLPALAK* |
Ga0070711_1018633192 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LGIDKYPAALSVRGTIEFDTPAGAQIGALGIRIPNSAAHTYTTLPALAK* |
Ga0070705_1019306651 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AFTLAKDRYPGTANIRGTIEFDKPPGGQIGALAFRIPTAHTFTTLPALVK* |
Ga0070678_1011701252 | 3300005456 | Miscanthus Rhizosphere | VTLNLRGTIEFDAPAGAQIGALGIRIPLAHTFTTLPALAK* |
Ga0070681_102274901 | 3300005458 | Corn Rhizosphere | KYPATIGARGTLEFDTPANAQIGVLGIRIPSAAHTFTTLPALAK* |
Ga0070681_104964883 | 3300005458 | Corn Rhizosphere | NIRGTIEFDAPAGAQIGALGIRMPSGASHTYTTLPALAK* |
Ga0070681_116036812 | 3300005458 | Corn Rhizosphere | AFTLVTDKYPATANTRGTIEFDKPANGQIGVLGIRIPPTSTYTTLPALAK* |
Ga0070679_1001806184 | 3300005530 | Corn Rhizosphere | TDKYPATVNIRGTIEFDAPPGAQIGALGIRIPVAHTFTTLPALAK* |
Ga0070684_1005322912 | 3300005535 | Corn Rhizosphere | TANIRGTVEFDTPAGGQIGALGIRIPTGAAHTYTTLPALAK* |
Ga0070684_1013213732 | 3300005535 | Corn Rhizosphere | PATAGGPGTIEFDTPAGAQIGGLGIRIPLAHNFTTFSALVK* |
Ga0068853_1001038852 | 3300005539 | Corn Rhizosphere | LAVDKFPETARIRGTIELDAPPGTQISVLGIRVRPAHTFTTLPALTK* |
Ga0070693_1006745222 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | HVAFTLVTDKYPQTANIRGTIEFGTPSGGQIGALGIRIPIAHTFTTLPALAR* |
Ga0068855_1002113613 | 3300005563 | Corn Rhizosphere | NGHLAFTLVADKYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK* |
Ga0068855_1005444182 | 3300005563 | Corn Rhizosphere | MRGTIEFDKPPNGQIGALGIRIPTGAAHTFTTLPALAK* |
Ga0070664_1017741892 | 3300005564 | Corn Rhizosphere | TTQAPVGVAIGALGIRITAGATPTYTTLPALARQ* |
Ga0068854_1021447522 | 3300005578 | Corn Rhizosphere | IEFDKPAGAQIGALGIRIPSGAAHTYTSLPGLAK* |
Ga0068856_1012539622 | 3300005614 | Corn Rhizosphere | VTEKYPATANVRGTIEFDKPANAQIGVLGIRIPPTQTYTTLPVLVK* |
Ga0068852_1020341532 | 3300005616 | Corn Rhizosphere | ANIRGTIEFGKPANAQIAALGIRIPTGAAHAYTTLPALAK* |
Ga0068864_1001131011 | 3300005618 | Switchgrass Rhizosphere | HSAFALGVDRFPAAAGIRGTIEFDVPAGAQIGALGIRTPLAHTFTTLPALTK* |
Ga0068864_1026128832 | 3300005618 | Switchgrass Rhizosphere | TLGTDKYLGTLGIRGTIEFDTPAGAQIGALGIRIPIAHTFTTLPALVR* |
Ga0068866_108964902 | 3300005718 | Miscanthus Rhizosphere | IEFDTPVGAQIGAVGIRIPAGVAHTYTTLPALVK* |
Ga0068858_1007453531 | 3300005842 | Switchgrass Rhizosphere | NILNIRGTIEFLAPLGASIGALGIRIPVGAAPTYTTLPSLARQ* |
Ga0068858_1008721412 | 3300005842 | Switchgrass Rhizosphere | IRGTIEFDAPAGAQIGALGIRIPIAHTFTTLPALTK* |
Ga0068858_1025574911 | 3300005842 | Switchgrass Rhizosphere | VVDKFAMTNGIRGTLEFDAPAGSQISALGIRIPQAHTFTTLPALAK* |
Ga0068860_1015913921 | 3300005843 | Switchgrass Rhizosphere | TIRGTIEFDKPPNAQIGALGIRIPTGEAHTFTTLPALAK* |
Ga0075024_1007650402 | 3300006047 | Watersheds | VAFTLVTDKYPATANIRGTIEFDSPVGAQIGALALRIPPGAAHTYTSLPALAK* |
Ga0075028_1003320581 | 3300006050 | Watersheds | HYAFTMVVDKYSATAGIRGTIEFGKPANGQIGVLGIRIPAIAHTFTTLPALAK* |
Ga0075029_1009997621 | 3300006052 | Watersheds | ANIRGTIEFDTPAGAQIGALGIRIPAGAAHTYTTLPALAK* |
Ga0075017_1008133372 | 3300006059 | Watersheds | QNIPNILNIRGTIEFDKPPTAQIGALGIRIPTGAAHTFTTLPALAK* |
Ga0075030_1006724702 | 3300006162 | Watersheds | DKYPAANNMRGTIEFDKPPNGQIGAVGIRIPASAAHTYTTLPSLAK* |
Ga0075030_1012659492 | 3300006162 | Watersheds | RGTIEFDTPSGGQIGALGIRIPVGHTFTTLPALAK* |
Ga0075030_1013763742 | 3300006162 | Watersheds | NIRGTIEFDTPAAAQIGALGIRIPAGVAHTYTTLPALPK* |
Ga0075018_103104152 | 3300006172 | Watersheds | YPATAGIRGTIEFDKPANGQIGLLGIRIPAVAHTFTSLPALAR* |
Ga0075014_1008189882 | 3300006174 | Watersheds | LGVNKYTFTGNKRGTEFATPSGGQIGALGIRIPPKLTFTTLPARAK* |
Ga0097621_1002292693 | 3300006237 | Miscanthus Rhizosphere | IEFDKPAGAQIGALGIRIPTGTAHTYTTLPALAK* |
Ga0075021_110169321 | 3300006354 | Watersheds | NIRGTIEFDAPTGVQIGALGIRMPTGAAHAYTTLPALAK* |
Ga0068871_1006596251 | 3300006358 | Miscanthus Rhizosphere | SIQGTIEFDTPAGSQIGALGIRIPDVPAHTYTTLPALAK* |
Ga0068871_1013918912 | 3300006358 | Miscanthus Rhizosphere | GSDRYQAAATIRGTIEFDKPPNAQIGALGIRIPTGAAHTFTTLPALAK* |
Ga0068871_1015210391 | 3300006358 | Miscanthus Rhizosphere | QKYPATANIRGTIEFDTPSAAANAQIGVVGIRIPTGAAHAYTTLPALAK* |
Ga0079222_100509303 | 3300006755 | Agricultural Soil | GSDRYQAAATMRGTIEFDKPPNGQIGALGIRIPTGAAHTFTTLPALAK* |
Ga0075425_1023836022 | 3300006854 | Populus Rhizosphere | IRGTIEFDTTQAPVGVAIGALGIRITAGATPTYTTLPALARQ* |
Ga0068865_1000706364 | 3300006881 | Miscanthus Rhizosphere | TLGVDRYPATVGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK* |
Ga0066710_1049165771 | 3300009012 | Grasslands Soil | TANKRGTIEFVRPAGAQIGVLGIRIPVTNTFTTLPALAK |
Ga0099830_115140671 | 3300009088 | Vadose Zone Soil | NIRGTIEFDTPTNGQIGALGIRIPAAHTFTTLPALVK* |
Ga0105240_107136563 | 3300009093 | Corn Rhizosphere | RGTIEFDTPAGAQIGALGIRMPAGAAHTYTTLPALAK* |
Ga0105240_111151923 | 3300009093 | Corn Rhizosphere | FKYSQTAGIRGTLEFQTPIGAQIGALGIRIPVAHTFTTLPALAK* |
Ga0105245_100236604 | 3300009098 | Miscanthus Rhizosphere | MHVQAANIRGTIEFDTPAGATIGAPGIRIPPGALTTYTTLPALTK* |
Ga0105245_101021091 | 3300009098 | Miscanthus Rhizosphere | IEFDKPAGAQIGALGIRIPAVAAHTYTTLPGLAK* |
Ga0105245_116745561 | 3300009098 | Miscanthus Rhizosphere | SAFTLGTDKYPGTANIRGTIEFDTPANAQIGALGIRIPSTQTYTTLPALVK* |
Ga0105245_121467912 | 3300009098 | Miscanthus Rhizosphere | IRGTIEFVTPSGAKIGALGIRTPVAHTFTTLPALAK* |
Ga0105247_112003662 | 3300009101 | Switchgrass Rhizosphere | YPAAAAIRGTIEFDKPPNAQIGALGIRIPTGPAHTFTTLPALAK* |
Ga0105247_117896361 | 3300009101 | Switchgrass Rhizosphere | YPGAAHIRGTIEFDKPTGAQIGALGIRIPAVAAHTYTTLPALAK* |
Ga0105243_101474121 | 3300009148 | Miscanthus Rhizosphere | NRGTIEFDAPAGVTIGALGIRTPIAHTFTTLPALAK* |
Ga0105243_121516321 | 3300009148 | Miscanthus Rhizosphere | QTANIRGTIEFGTPSGGQIGALGIRIPIAHTFTTLPALAK* |
Ga0105243_125626641 | 3300009148 | Miscanthus Rhizosphere | DKYQVTQNIRGTVEFDTPAGAQIGALGIRIPLAHTFTTLPALAK* |
Ga0105241_102346571 | 3300009174 | Corn Rhizosphere | TAGLRGTLEFDTPAGGEIGVLGIRVGVAHTFTTLPALAK* |
Ga0105241_107133821 | 3300009174 | Corn Rhizosphere | IRGTIEFVAPTGAAIGALGIRIPAGATTTYTTLPALAK* |
Ga0105241_115962781 | 3300009174 | Corn Rhizosphere | DRYPATAAIRGTIEFVKPVSAQIAALGIRIPAGPAHTYTTLPALAK* |
Ga0105241_124173672 | 3300009174 | Corn Rhizosphere | RGTVEFDKPAVAQIGVLGIRVPVTHTFTTLPSLAK* |
Ga0105242_128162681 | 3300009176 | Miscanthus Rhizosphere | YPAALHIRGTIEFVAPTGAAIGALGIRIPAGATTTYTTLPALAK* |
Ga0105248_113136331 | 3300009177 | Switchgrass Rhizosphere | IRGTIEFDTPSAAANAQIGVVGIRIPTGAAHAYTTLPALAK* |
Ga0105237_105544311 | 3300009545 | Corn Rhizosphere | FALGDKYSAAATIRGTIEFDTPPGGQIGVLGIRTPVAHTFTTLPALTR* |
Ga0105237_111793383 | 3300009545 | Corn Rhizosphere | YPFARTIRGTIEFLAPTGVSIGALGIRISPGATTTYTTLPALARQ* |
Ga0105237_120971421 | 3300009545 | Corn Rhizosphere | VDKYQGAANIRGTIEFDKPGNAQIGALGIRIPTGAAHTFTTLPALAK* |
Ga0105238_101465291 | 3300009551 | Corn Rhizosphere | LSFTLVTDKYPQTADIRGTIEFGAPLNTRIGALGIRIPVTHTFTTLPALTK* |
Ga0105249_119489331 | 3300009553 | Switchgrass Rhizosphere | KYAATANIRGTIEFDKPSNAQIGALGIRIPAGVAHTYTTLPALAK* |
Ga0116134_12080582 | 3300009764 | Peatland | FTLAVDKYPAAANIRGTIEFDTPAGARIGVLGIRIPVAHTFTTLPALVK* |
Ga0099796_104082122 | 3300010159 | Vadose Zone Soil | IRGTIELDTPFGAQIGALGIRIPAGGAHTYTTLPALAK* |
Ga0134128_107356512 | 3300010373 | Terrestrial Soil | ANIRGTVEFDTPAGAQIGALGIRIPSGAAHTYTTLPALAK* |
Ga0134128_132181842 | 3300010373 | Terrestrial Soil | NIRGTIEFDTTQAPVGVAIGALGIRITAGATPTYTTLPALARQ* |
Ga0105239_102646961 | 3300010375 | Corn Rhizosphere | HLAFTLGTDKYPATATIRGTIEFDTPPGGQIGVLGIRIPIAHTFTTLPALTR* |
Ga0105239_113399311 | 3300010375 | Corn Rhizosphere | VRGTIEFDTPANAKIGVLGIRIPPTQTYTTLPALAK* |
Ga0134124_132249581 | 3300010397 | Terrestrial Soil | ATVGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK* |
Ga0134127_131367381 | 3300010399 | Terrestrial Soil | GTVEFDTPAGAQIGALGIRIPTGAAHTYTTLPALAK* |
Ga0134122_130422521 | 3300010400 | Terrestrial Soil | MRGTIQFDTPANAPIGVLGIRIPAAAHTFTTLPALAK* |
Ga0134121_125688971 | 3300010401 | Terrestrial Soil | PAALHIRGTIEFVAPTGAAIGALGIRIPAGATTTYTTLPALAK* |
Ga0105246_105670902 | 3300011119 | Miscanthus Rhizosphere | FTLGIDKYPAALAIRGTIEFDKPAGAQIGALGIRIPSGAAHTYTSLPGLAK* |
Ga0150985_1126210172 | 3300012212 | Avena Fatua Rhizosphere | IQGTAEFDAPIGVQIGALGIRTPLAHTFTTLPALVK* |
Ga0137384_103572712 | 3300012357 | Vadose Zone Soil | VADKYPATANIRGTIEFDTPLGGQIGALGIRIPIAHTFTTLPALAR* |
Ga0137360_104306302 | 3300012361 | Vadose Zone Soil | HLAFTLVTDKYPAAAHIRGTIEFDTPPGGQIGALGIRIPIAHTFTTLPALAK* |
Ga0137359_105163022 | 3300012923 | Vadose Zone Soil | GHTQFTLVTDKYAATANIRGTIEFDKPANAKIGVLGIRIPPTQTYTTLPALAK* |
Ga0157370_103873481 | 3300013104 | Corn Rhizosphere | LASDKYPATAGIRGTIEFDTPANAQIGVLGIRIPAAAHTFTTLPALAK* |
Ga0157370_104165093 | 3300013104 | Corn Rhizosphere | HLAFTLVTDKYLNTAGIRGTIEFDTPPGAQIGALGIRIPVAHTFTTLPALVR* |
Ga0157370_112950082 | 3300013104 | Corn Rhizosphere | ANIRGTIEFDTPAGVQIGALGIRIPVAHTFTTLPALAK* |
Ga0157374_100785311 | 3300013296 | Miscanthus Rhizosphere | LVTDKYPQTANIRGTIEFGTPSGGQIGALGIRIPTAHTFTTLPALAR* |
Ga0157374_113255741 | 3300013296 | Miscanthus Rhizosphere | LAFTLGTDKYLGTLGIRGTIEFDTPAGAQIGAMGIRIPIAHTFTTLPALVR* |
Ga0157374_116706732 | 3300013296 | Miscanthus Rhizosphere | CTANIRGTIEFDTPAGAQIGALGIRIPSSAAHAYTTLPALAK* |
Ga0157374_116926651 | 3300013296 | Miscanthus Rhizosphere | ANIRGTIEFDRPANAQIGALGIRIPSGTAHTYTTLPALAK* |
Ga0157378_114481811 | 3300013297 | Miscanthus Rhizosphere | IEFVKPVSAQIAALGILIPAGPAHTYTTLPALAK* |
Ga0157378_128707852 | 3300013297 | Miscanthus Rhizosphere | YPETANIRGTIEFGKPANAQIGALGIRIPTGAAHAYTTLPALAK* |
Ga0163162_120908051 | 3300013306 | Switchgrass Rhizosphere | IEFDTPAGAQIGALGIRIPNVAAHTYTTLPALAK* |
Ga0157372_101867096 | 3300013307 | Corn Rhizosphere | GSDKYPATANIRGTIEFDKPANGQIGVLGIRIPVAHTFTTLPALAK* |
Ga0157372_119463971 | 3300013307 | Corn Rhizosphere | LAFTLGVDRYPATVGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK* |
Ga0157372_130708811 | 3300013307 | Corn Rhizosphere | RGTIELDAPLNTQIGALGIRIPVTHTFTTLPALTK* |
Ga0157375_100265851 | 3300013308 | Miscanthus Rhizosphere | LGTDKYPATVNLRGTIEFDAPAGAQIGALGIRAPLAHTFTTLPALAK* |
Ga0157375_135655931 | 3300013308 | Miscanthus Rhizosphere | TQNIRGTIEFDTPAGAQIGALGIRVPLAHTFTTLPALGK* |
Ga0157375_136646041 | 3300013308 | Miscanthus Rhizosphere | TLTIRGTIEFDKPPNAQIGALGIRIPAGDAHTYTTLPALAK* |
Ga0181535_104452342 | 3300014199 | Bog | VMGHRGTIELDTPSGGQITALGIRQAASGAITTVPALVK* |
Ga0181526_110631852 | 3300014200 | Bog | DRYPATANIRGTIEFDKPVGAQIGALGIRIPTGAAHTYTTLPALAK* |
Ga0182030_103237761 | 3300014838 | Bog | AAGIRGTIEFDAPAGAQIGALGIRIPVAHTFTTLPALAK* |
Ga0157376_113764362 | 3300014969 | Miscanthus Rhizosphere | SSDKYPATYGIRGTIEFNKPANGQIGVLGIRMPAGQTHTFTTLPALAK* |
Ga0167649_1007497 | 3300015063 | Glacier Forefield Soil | KFQDPILNIRNMRGTIEFDTKQVPVGAAIGALGIRIRPGATATYTTLPALARQ* |
Ga0167650_10388451 | 3300015203 | Glacier Forefield Soil | TQKYPVTANIRGTIEFDAPIGAQIGALGIRIPSGAAHAYTTLPALAK* |
Ga0167650_10456901 | 3300015203 | Glacier Forefield Soil | YAFTMVVDKYPTTAGIRGTIEFDKPANGQIGVLGIRIPAVAHTFTSIPSLPK* |
Ga0181505_103136711 | 3300016750 | Peatland | ATANIRGTIEFDTPAGARIGVLGIRMPVAHTFTTLPALVR |
Ga0181505_109536683 | 3300016750 | Peatland | PATANLRGTIEFDTPAGAQIGVLGIRTLAGHTFTALPVLVR |
Ga0187879_105346912 | 3300017946 | Peatland | ANIRGTIEFGTPAGAQIGVMGIRTPAGHTFTALPVLPK |
Ga0187875_102598322 | 3300018035 | Peatland | DKYAATASIRGTIEFGTPAGAQIGVVGIRTPAGHTFTALPVLAK |
Ga0187855_109481292 | 3300018038 | Peatland | ATANIRGTIEFGTPAGAQIGVMGIRTPAGHTFTALPVLPK |
Ga0187769_114457431 | 3300018086 | Tropical Peatland | NGHLSFTLVTDKYANTAGIRGTLEFDTPPGGQIGTLGIRIPLAHTFTTLPALAR |
Ga0210384_101299714 | 3300021432 | Soil | TLVVDKFPVTAGIRGTLELDAPTGGQIGALGIRIAPAHTFTTLPALVK |
Ga0210384_111583362 | 3300021432 | Soil | LVTDKYAATANIRGTIEFDKPANAQIGVLGIRIPPTQTYTTLPALAK |
Ga0207680_103397931 | 3300025903 | Switchgrass Rhizosphere | LAFTLGTDKYPATATIRGTIEFDTPPGGQIGVLGIRIPIAHTFTTLPALTR |
Ga0207680_111866611 | 3300025903 | Switchgrass Rhizosphere | GHTQFTLVTDKYPGTANIRGTIEFDKPANGQIGALGIRIPAGSAHTYTTLPALAK |
Ga0207654_103062192 | 3300025911 | Corn Rhizosphere | TLVSDKYSVTQNIRGTIEFDTPAGAQIGALGIRIPVAHTFTTLPALGK |
Ga0207654_105079021 | 3300025911 | Corn Rhizosphere | TLVADKYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK |
Ga0207654_108435682 | 3300025911 | Corn Rhizosphere | PGTAGIRGTIQFDTPAGAQIGALGIRIPSVAAHTYTTLPALAK |
Ga0207654_109283802 | 3300025911 | Corn Rhizosphere | DRYPATAAIRGTIEFVKPVSAQIAALGIRIPAGPAHTYTTLPALAK |
Ga0207654_113065791 | 3300025911 | Corn Rhizosphere | TAGLRGTLEFDTPAGGEIGVLGIRVGVAHTFTTLPALAK |
Ga0207707_115102951 | 3300025912 | Corn Rhizosphere | YPATASIRGTIEFDTPPGAQIGALAFRIPTAHTFTTLPALVK |
Ga0207695_101728774 | 3300025913 | Corn Rhizosphere | RFPITAGIRETIEFDTPTGAQIGALGIRIPVAHTFTSLPALVK |
Ga0207695_109714181 | 3300025913 | Corn Rhizosphere | PNILNIRGTIEFVTPQGAAIGALGIRIPAGAAHTYTTLPALAR |
Ga0207695_115862462 | 3300025913 | Corn Rhizosphere | TAGMRGTIEFDTPANAQIGVLGIRIPAAAHTFTTLPALAK |
Ga0207671_108835281 | 3300025914 | Corn Rhizosphere | AFTLGSDRYPGALNIRGTIEFVKPADAQISALGIRIPGGAAHTYTTLPALAK |
Ga0207671_109917061 | 3300025914 | Corn Rhizosphere | FALGDKYSAAATIRGTIEFDTPPGGQIGVLGIRTPVAHTFTTLPALTR |
Ga0207671_112390551 | 3300025914 | Corn Rhizosphere | SDRYPATAAIRGTIEFVKPVSAQIAALGIRIPAGPAHTYTTLPALAK |
Ga0207671_115982851 | 3300025914 | Corn Rhizosphere | GLRGTLEFDTPAGGEIGVLGIRVGVAHTFTTLPALAK |
Ga0207660_104058292 | 3300025917 | Corn Rhizosphere | GADQFLAAAGIRGTIEFDAPAGAQIGALGIRIPIAHTFTTLPALTK |
Ga0207660_107219062 | 3300025917 | Corn Rhizosphere | LAFTLVSDKYSVTQNIRGTIEFDTPAGAQIGALGIRIPVAHTFTTLPALGK |
Ga0207649_111002462 | 3300025920 | Corn Rhizosphere | TAGIRGTIEFDTPPNAQIGALGIRIPAAAHTFTTLPALAK |
Ga0207687_105302343 | 3300025927 | Miscanthus Rhizosphere | IRGTIEFDKPTGAQIGALGIRIPAVAAHTYTTLPALAK |
Ga0207687_106288311 | 3300025927 | Miscanthus Rhizosphere | FTRVSDKYQVTLNKRGTIEFDAPAGVQIGALGIRIPAGDAHTYTTLPALAK |
Ga0207687_109582861 | 3300025927 | Miscanthus Rhizosphere | TDRYPATATIRGTIEFVKPANAQIGALGIRIPAGAAHTYTTLPALAK |
Ga0207687_113802992 | 3300025927 | Miscanthus Rhizosphere | ALTIRGTIEFDTPAGAQIGALGIRIPNVAAHTYTTLPALAK |
Ga0207686_101472001 | 3300025934 | Miscanthus Rhizosphere | KYSAAATIRGTIEFDTPPGGQIGVLGIRTPVAHTFTTLPALTR |
Ga0207686_104040661 | 3300025934 | Miscanthus Rhizosphere | AVTLVADKYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK |
Ga0207686_113016502 | 3300025934 | Miscanthus Rhizosphere | YPAALHIRGTIEFVAPTGAAIGALGIRIPAGATTTYTTLPALAK |
Ga0207709_103828413 | 3300025935 | Miscanthus Rhizosphere | YPATAKIRGTIEFDAPAGAQIGALGIRMPIGAAHAYTTLPALAK |
Ga0207709_113637141 | 3300025935 | Miscanthus Rhizosphere | AAANIRGTIEFDTPAGAQIGALGIRIPDSAAHTYTTLPALAK |
Ga0207669_117434652 | 3300025937 | Miscanthus Rhizosphere | YLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK |
Ga0207711_105713871 | 3300025941 | Switchgrass Rhizosphere | ATVGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK |
Ga0207689_111671231 | 3300025942 | Miscanthus Rhizosphere | TANIRGTIELDAPLNTQIGALGIRIPVTHTFTTLPALTK |
Ga0207661_102166451 | 3300025944 | Corn Rhizosphere | RGTIEFGTPSGGQIGALGIRIPIAHTFTTLPALAK |
Ga0207661_102301561 | 3300025944 | Corn Rhizosphere | GIRGTIEFDAPAGAQIGALGIRIPIAHTFTTLPALTK |
Ga0207661_112409372 | 3300025944 | Corn Rhizosphere | GHSAFTLAVDKFPETARIRGTIELDAPPGTQISVLGIRVRPAHTFTTLPALTK |
Ga0207667_100495297 | 3300025949 | Corn Rhizosphere | VTTNMQGTVEFDAPIGVQIGALGIRTPIAHTFTTLPALAK |
Ga0207667_102773811 | 3300025949 | Corn Rhizosphere | FPITAGIRGTIEFDTPTGAQIGALGIRIPVAHTFTSLPALVK |
Ga0207667_103369422 | 3300025949 | Corn Rhizosphere | LGSGKYPATAGIRGTIEFDTPPNAQIGALGIRIPAAAHTFTTLPALAK |
Ga0207658_109010681 | 3300025986 | Switchgrass Rhizosphere | NIRGIIEFDAPPGAQIGALGIRIPNSAAHTYTTLPALAK |
Ga0207677_101459321 | 3300026023 | Miscanthus Rhizosphere | GHLAFTLGSQKYPETANIRGTIEFGKPANAQIGALGIRIPTGAAHAYTTLPALAK |
Ga0207639_102376683 | 3300026041 | Corn Rhizosphere | GLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK |
Ga0207639_103496221 | 3300026041 | Corn Rhizosphere | YLGTLGIRGTIEFDTPAGAQIGALGIRIPIAHTFTTLPALVR |
Ga0207639_107272031 | 3300026041 | Corn Rhizosphere | GKYPGTAGIRGTIEFDTPPNAQIGALGIRIPAAAHTFTTLPALAK |
Ga0207639_107637272 | 3300026041 | Corn Rhizosphere | NVRGTIEFDTPANAKIGVLGIRIPPTQTYTTLPALAK |
Ga0207639_108377393 | 3300026041 | Corn Rhizosphere | NIRGTIEFGKPANGQIGVLGIRIPVAHTFTTLPALAK |
Ga0207639_108723961 | 3300026041 | Corn Rhizosphere | LGVDKYWSTGNGRGTIEFAKPSNGQIAVLGIRIPATQTYTTLPALAK |
Ga0207702_100305927 | 3300026078 | Corn Rhizosphere | DQFPAALGIRGTIEFDAPAGAQIGALGIRIPIAHTFTTLPALTK |
Ga0207702_102775052 | 3300026078 | Corn Rhizosphere | KYPSTGNIRGTIEFDTPPGTQMGALGIRIPVGHTFTTLPALAR |
Ga0207702_110550542 | 3300026078 | Corn Rhizosphere | SAFTLVTEKYPATANVRGTIEFDKPANAQIGVLGIRIPPTQTYTTLPVLVK |
Ga0207641_1001153010 | 3300026088 | Switchgrass Rhizosphere | RGTIEFATPAGAQIGALGIRTPVAHTFTTLPALVR |
Ga0209421_10988411 | 3300027432 | Forest Soil | HVAFTLGVDKYTAAAAVRGTIEFDTPTGAQIGALGIRIPVAHTFTTLPALVK |
Ga0209074_103287841 | 3300027787 | Agricultural Soil | QAAATMRGTIEFDKPPNGQIGALGIRIPTGAAHTFTTLPALAK |
Ga0209415_107785032 | 3300027905 | Peatlands Soil | TANIRGTIEFDTPVGAQIGALGIRIPVAHTFTTLPALAK |
Ga0209069_107008932 | 3300027915 | Watersheds | DKFPEAAGIRGTIEFDKPANAQIGALGIRIPTGAAHTFTTLPALAK |
Ga0268264_104954243 | 3300028381 | Switchgrass Rhizosphere | HTQFTLVTDKYPGTANIRGTIEFDKPANGQIGALGIRIPAGSAHTYTTLPALAK |
Ga0268264_106369372 | 3300028381 | Switchgrass Rhizosphere | GNIRGTIEFDTPAGTQMGALGIRIPVAHTFTTLPALAR |
Ga0268264_120508781 | 3300028381 | Switchgrass Rhizosphere | DKYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK |
Ga0170824_1076652701 | 3300031231 | Forest Soil | SLRGTIEFDTPAGAQISVLGIRTPPAFTFTTLPALTK |
Ga0302324_1009271013 | 3300031236 | Palsa | LGTGRYPATASIRGTIEFDAPAGAQIGALGIRIPVGAAHTYTTLPALAK |
Ga0265325_101835171 | 3300031241 | Rhizosphere | TLVADKYPGTANIRGTIEFATPPGGQIGALGIRIPVAHTFTTLPALAK |
Ga0170819_160330601 | 3300031469 | Forest Soil | PAAAAIRGTIEFDKPPNGQIGALGIRIPTGAAHTFTTLPALAK |
Ga0310686_1004659452 | 3300031708 | Soil | RGTIEFDTPVGSQIGALGIRIPVAHTFTTLPALAK |
Ga0265342_105777952 | 3300031712 | Rhizosphere | AVDKYPAAANIRGTVEFDAPAGAQIGALGIRIPVAHTFTTLPAFVK |
Ga0307476_107653792 | 3300031715 | Hardwood Forest Soil | YLATANIRGTVEFGNPSGAQIAGLGIRIPAVAAHTYTTLPALAK |
Ga0307469_120734562 | 3300031720 | Hardwood Forest Soil | RTIRGTIEFDKPPNAQIGALGIRIPTGAAHTFTTLPALAK |
Ga0307469_121855382 | 3300031720 | Hardwood Forest Soil | IRGTIEFDTPAGAQIGALGIRIPPTQTYTTLPALAK |
Ga0307478_114559681 | 3300031823 | Hardwood Forest Soil | DRYPAALTIRGTIEFVKPANAQIGALGIRIPAGLDTTYTTLPALAK |
Ga0307470_100899771 | 3300032174 | Hardwood Forest Soil | GTIEFGKPLGAQIGALGIRIPAVAAHTYTTLPALAK |
Ga0307470_101374512 | 3300032174 | Hardwood Forest Soil | LRKYPATANIRGTIEFDKPANAQIGALGIRIPAGDAHTYTTLPALAK |
Ga0348332_141165421 | 3300032515 | Plant Litter | PILSLVKDKYPQTANIRGTIEFDAPGGVQIGAVGIRAPAALTYTSLPALAK |
Ga0326726_102221161 | 3300033433 | Peat Soil | VLDKYPGTANKRGTIEFDTPPGGQIGALGIRIPVAHTFTTLPALAK |
Ga0326726_120638252 | 3300033433 | Peat Soil | TDKYPAAANIRGTIEFDTAPDRPMSVLGIRIPTAHTFTTLPAFVK |
Ga0310811_106029412 | 3300033475 | Soil | NQFPVTANTQGTVEFDAPIGVQIGALGIRTPVAHTFTTLPALAK |
Ga0370515_0291902_564_689 | 3300034163 | Untreated Peat Soil | ALTIRGTIEFDTPASAQIGALGIRIPTGAAHTYTTLPALAK |
Ga0370481_0192803_2_151 | 3300034281 | Untreated Peat Soil | TLGSGKYPVTKGIRGTLEFDTPVNAQIGVVGIRIPAAAHTFTTLPALAK |
Ga0364943_0215981_553_708 | 3300034354 | Sediment | LAFTLATEKYPTTANIRGTIEFGRPPGVQIGVLGIRIPVAHTFTTLPPLAK |
⦗Top⦘ |