NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025837

Metagenome / Metatranscriptome Family F025837

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025837
Family Type Metagenome / Metatranscriptome
Number of Sequences 200
Average Sequence Length 44 residues
Representative Sequence TANIRGTIEFDTPVGAQIGALGIRIPVAHTFTTLPALAK
Number of Associated Samples 126
Number of Associated Scaffolds 200

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.51 %
% of genes near scaffold ends (potentially truncated) 95.50 %
% of genes from short scaffolds (< 2000 bps) 89.50 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere
(12.000 % of family members)
Environment Ontology (ENVO) Unclassified
(61.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(69.500 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 25.37%    Coil/Unstructured: 74.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 200 Family Scaffolds
PF01425Amidase 5.50
PF07883Cupin_2 4.50
PF11954DUF3471 2.50
PF07728AAA_5 2.50
PF05016ParE_toxin 2.00
PF02900LigB 2.00
PF04389Peptidase_M28 2.00
PF07746LigA 2.00
PF13418Kelch_4 1.50
PF13637Ank_4 1.50
PF12796Ank_2 1.50
PF16396DUF5005 1.50
PF00909Ammonium_transp 1.00
PF02452PemK_toxin 1.00
PF07043DUF1328 1.00
PF03712Cu2_monoox_C 1.00
PF15919HicB_lk_antitox 1.00
PF01321Creatinase_N 1.00
PF00891Methyltransf_2 1.00
PF03693ParD_antitoxin 1.00
PF00005ABC_tran 0.50
PF13810DUF4185 0.50
PF00654Voltage_CLC 0.50
PF01027Bax1-I 0.50
PF01479S4 0.50
PF13673Acetyltransf_10 0.50
PF07494Reg_prop 0.50
PF07589PEP-CTERM 0.50
PF04909Amidohydro_2 0.50
PF13906AA_permease_C 0.50
PF07719TPR_2 0.50
PF13649Methyltransf_25 0.50
PF00413Peptidase_M10 0.50
PF01553Acyltransferase 0.50
PF00572Ribosomal_L13 0.50
PF07690MFS_1 0.50
PF02913FAD-oxidase_C 0.50
PF12867DinB_2 0.50
PF13924Lipocalin_5 0.50
PF03466LysR_substrate 0.50
PF01522Polysacc_deac_1 0.50
PF06282DUF1036 0.50
PF06094GGACT 0.50
PF13857Ank_5 0.50
PF01979Amidohydro_1 0.50
PF00449Urease_alpha 0.50
PF00034Cytochrom_C 0.50
PF07626PSD3 0.50
PF01569PAP2 0.50
PF07811TadE 0.50
PF00903Glyoxalase 0.50
PF03544TonB_C 0.50
PF00027cNMP_binding 0.50
PF13490zf-HC2 0.50
PF00535Glycos_transf_2 0.50
PF00588SpoU_methylase 0.50
PF09586YfhO 0.50
PF04368DUF507 0.50
PF07238PilZ 0.50
PF13466STAS_2 0.50
PF04972BON 0.50

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 200 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 5.50
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 1.00
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 1.00
COG5487Uncharacterized membrane protein YtjA, UPF0391 familyFunction unknown [S] 1.00
COG3609Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domainTranscription [K] 1.00
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 1.00
COG5549Predicted Zn-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.50
COG5480Uncharacterized membrane proteinFunction unknown [S] 0.50
COG3292Periplasmic ligand-binding sensor domainSignal transduction mechanisms [T] 0.50
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.50
COG0804Urease alpha subunitAmino acid transport and metabolism [E] 0.50
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.50
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.50
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.50
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.50
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.50
COG0102Ribosomal protein L13Translation, ribosomal structure and biogenesis [J] 0.50
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.00 %
UnclassifiedrootN/A28.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig169973Not Available680Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101505027All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300000789|JGI1027J11758_12422438All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300004092|Ga0062389_101841808Not Available784Open in IMG/M
3300004114|Ga0062593_101037920Not Available844Open in IMG/M
3300005329|Ga0070683_102398708All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300005334|Ga0068869_101084016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300005334|Ga0068869_101875838Not Available537Open in IMG/M
3300005335|Ga0070666_10756573Not Available714Open in IMG/M
3300005336|Ga0070680_100234513Not Available1550Open in IMG/M
3300005336|Ga0070680_100497739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1043Open in IMG/M
3300005356|Ga0070674_102135407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300005366|Ga0070659_100510949All Organisms → cellular organisms → Bacteria → Acidobacteria1025Open in IMG/M
3300005367|Ga0070667_100790975All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300005439|Ga0070711_101863319All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005440|Ga0070705_101930665Not Available503Open in IMG/M
3300005456|Ga0070678_101170125All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005458|Ga0070681_10227490Not Available1780Open in IMG/M
3300005458|Ga0070681_10496488All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1133Open in IMG/M
3300005458|Ga0070681_11603681Not Available576Open in IMG/M
3300005530|Ga0070679_100180618All Organisms → cellular organisms → Bacteria → Acidobacteria2082Open in IMG/M
3300005535|Ga0070684_100532291All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300005535|Ga0070684_101321373All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005547|Ga0070693_100674522All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005563|Ga0068855_100211361All Organisms → cellular organisms → Bacteria2180Open in IMG/M
3300005563|Ga0068855_100544418All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300005564|Ga0070664_101774189All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300005578|Ga0068854_102144752Not Available516Open in IMG/M
3300005614|Ga0068856_101253962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales757Open in IMG/M
3300005616|Ga0068852_102034153All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300005618|Ga0068864_100113101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2420Open in IMG/M
3300005618|Ga0068864_102612883All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300005718|Ga0068866_10896490Not Available623Open in IMG/M
3300005842|Ga0068858_100745353All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300005842|Ga0068858_100872141All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300005842|Ga0068858_102557491All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005843|Ga0068860_101591392All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300006047|Ga0075024_100765040Not Available537Open in IMG/M
3300006050|Ga0075028_100332058Not Available855Open in IMG/M
3300006052|Ga0075029_100999762All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300006059|Ga0075017_100813337All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300006162|Ga0075030_100672470All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300006162|Ga0075030_101265949All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300006162|Ga0075030_101376374All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300006172|Ga0075018_10310415All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16780Open in IMG/M
3300006174|Ga0075014_100818988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium551Open in IMG/M
3300006237|Ga0097621_100229269All Organisms → cellular organisms → Bacteria1621Open in IMG/M
3300006354|Ga0075021_11016932All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300006358|Ga0068871_100659625All Organisms → cellular organisms → Bacteria → Acidobacteria956Open in IMG/M
3300006358|Ga0068871_101391891All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300006358|Ga0068871_101521039All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300006755|Ga0079222_10050930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1923Open in IMG/M
3300006854|Ga0075425_102383602All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300006881|Ga0068865_100070636Not Available2474Open in IMG/M
3300009012|Ga0066710_104916577All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300009088|Ga0099830_11514067Not Available559Open in IMG/M
3300009093|Ga0105240_10713656Not Available1093Open in IMG/M
3300009093|Ga0105240_11115192All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300009098|Ga0105245_10023660All Organisms → cellular organisms → Bacteria → Acidobacteria5392Open in IMG/M
3300009098|Ga0105245_10102109Not Available2655Open in IMG/M
3300009098|Ga0105245_11674556Not Available688Open in IMG/M
3300009098|Ga0105245_12146791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300009101|Ga0105247_11200366All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300009101|Ga0105247_11789636All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300009148|Ga0105243_10147412Not Available2015Open in IMG/M
3300009148|Ga0105243_12151632Not Available594Open in IMG/M
3300009148|Ga0105243_12562664Not Available549Open in IMG/M
3300009174|Ga0105241_10234657All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium CSLD101548Open in IMG/M
3300009174|Ga0105241_10713382All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300009174|Ga0105241_11596278Not Available631Open in IMG/M
3300009174|Ga0105241_12417367All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300009176|Ga0105242_12816268All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300009177|Ga0105248_11313633All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300009545|Ga0105237_10554431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha1156Open in IMG/M
3300009545|Ga0105237_11179338All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300009545|Ga0105237_12097142All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009551|Ga0105238_10146529All Organisms → cellular organisms → Bacteria2337Open in IMG/M
3300009553|Ga0105249_11948933All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium660Open in IMG/M
3300009764|Ga0116134_1208058All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300010159|Ga0099796_10408212All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300010373|Ga0134128_10735651All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300010373|Ga0134128_13218184All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300010375|Ga0105239_10264696All Organisms → cellular organisms → Bacteria → Acidobacteria1933Open in IMG/M
3300010375|Ga0105239_11339931Not Available826Open in IMG/M
3300010397|Ga0134124_13224958All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300010399|Ga0134127_13136738Not Available540Open in IMG/M
3300010400|Ga0134122_13042252All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300010401|Ga0134121_12568897All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300011119|Ga0105246_10567090All Organisms → cellular organisms → Bacteria → Acidobacteria975Open in IMG/M
3300012212|Ga0150985_112621017All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.1420Open in IMG/M
3300012357|Ga0137384_10357271All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300012361|Ga0137360_10430630All Organisms → cellular organisms → Bacteria → Acidobacteria1115Open in IMG/M
3300012923|Ga0137359_10516302All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300013104|Ga0157370_10387348All Organisms → cellular organisms → Bacteria → Acidobacteria1287Open in IMG/M
3300013104|Ga0157370_10416509All Organisms → cellular organisms → Bacteria → Acidobacteria1236Open in IMG/M
3300013104|Ga0157370_11295008All Organisms → cellular organisms → Bacteria → Proteobacteria657Open in IMG/M
3300013296|Ga0157374_10078531Not Available3126Open in IMG/M
3300013296|Ga0157374_11325574All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300013296|Ga0157374_11670673All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300013296|Ga0157374_11692665All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300013297|Ga0157378_11448181Not Available731Open in IMG/M
3300013297|Ga0157378_12870785All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300013306|Ga0163162_12090805Not Available649Open in IMG/M
3300013307|Ga0157372_10186709All Organisms → cellular organisms → Bacteria → Acidobacteria2401Open in IMG/M
3300013307|Ga0157372_11946397All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300013307|Ga0157372_13070881All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300013308|Ga0157375_10026585All Organisms → cellular organisms → Bacteria5397Open in IMG/M
3300013308|Ga0157375_13565593Not Available518Open in IMG/M
3300013308|Ga0157375_13664604Not Available511Open in IMG/M
3300014199|Ga0181535_10445234All Organisms → cellular organisms → Bacteria → Acidobacteria754Open in IMG/M
3300014200|Ga0181526_11063185Not Available508Open in IMG/M
3300014838|Ga0182030_10323776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1675Open in IMG/M
3300014969|Ga0157376_11376436Not Available737Open in IMG/M
3300015063|Ga0167649_100749All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4640Open in IMG/M
3300015203|Ga0167650_1038845All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1238Open in IMG/M
3300015203|Ga0167650_1045690All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300016750|Ga0181505_10313671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia941Open in IMG/M
3300016750|Ga0181505_10953668All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300017946|Ga0187879_10534691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300018035|Ga0187875_10259832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium946Open in IMG/M
3300018038|Ga0187855_10948129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300018086|Ga0187769_11445743Not Available520Open in IMG/M
3300021432|Ga0210384_10129971Not Available2260Open in IMG/M
3300021432|Ga0210384_11158336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300025903|Ga0207680_10339793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha1053Open in IMG/M
3300025903|Ga0207680_11186661Not Available544Open in IMG/M
3300025911|Ga0207654_10306219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1082Open in IMG/M
3300025911|Ga0207654_10507902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium852Open in IMG/M
3300025911|Ga0207654_10843568All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300025911|Ga0207654_10928380Not Available631Open in IMG/M
3300025911|Ga0207654_11306579Not Available529Open in IMG/M
3300025912|Ga0207707_11510295All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300025913|Ga0207695_10172877All Organisms → cellular organisms → Bacteria → Acidobacteria2085Open in IMG/M
3300025913|Ga0207695_10971418All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300025913|Ga0207695_11586246Not Available535Open in IMG/M
3300025914|Ga0207671_10883528Not Available707Open in IMG/M
3300025914|Ga0207671_10991706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha662Open in IMG/M
3300025914|Ga0207671_11239055Not Available582Open in IMG/M
3300025914|Ga0207671_11598285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium501Open in IMG/M
3300025917|Ga0207660_10405829All Organisms → cellular organisms → Bacteria → Acidobacteria1098Open in IMG/M
3300025917|Ga0207660_10721906Not Available813Open in IMG/M
3300025920|Ga0207649_11100246All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300025927|Ga0207687_10530234All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales986Open in IMG/M
3300025927|Ga0207687_10628831All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300025927|Ga0207687_10958286All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300025927|Ga0207687_11380299All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300025934|Ga0207686_10147200All Organisms → cellular organisms → Bacteria → Acidobacteria1635Open in IMG/M
3300025934|Ga0207686_10404066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1041Open in IMG/M
3300025934|Ga0207686_11301650All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300025935|Ga0207709_10382841All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300025935|Ga0207709_11363714All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300025937|Ga0207669_11743465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300025941|Ga0207711_10571387Not Available1055Open in IMG/M
3300025942|Ga0207689_11167123All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300025944|Ga0207661_10216645All Organisms → cellular organisms → Bacteria1690Open in IMG/M
3300025944|Ga0207661_10230156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1641Open in IMG/M
3300025949|Ga0207667_10049529All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4436Open in IMG/M
3300025949|Ga0207667_10277381All Organisms → cellular organisms → Bacteria → Proteobacteria1713Open in IMG/M
3300025949|Ga0207667_10336942Not Available1540Open in IMG/M
3300025986|Ga0207658_10901068All Organisms → cellular organisms → Bacteria → Acidobacteria805Open in IMG/M
3300026023|Ga0207677_10145932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1818Open in IMG/M
3300026041|Ga0207639_10237668Not Available1582Open in IMG/M
3300026041|Ga0207639_10349622All Organisms → cellular organisms → Bacteria → Acidobacteria1320Open in IMG/M
3300026041|Ga0207639_10727203Not Available922Open in IMG/M
3300026041|Ga0207639_10763727Not Available899Open in IMG/M
3300026041|Ga0207639_10837739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium858Open in IMG/M
3300026041|Ga0207639_10872396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium840Open in IMG/M
3300026078|Ga0207702_10030592All Organisms → cellular organisms → Bacteria → Proteobacteria4485Open in IMG/M
3300026078|Ga0207702_10277505All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1583Open in IMG/M
3300026078|Ga0207702_11055054All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales806Open in IMG/M
3300026088|Ga0207641_10011530All Organisms → cellular organisms → Bacteria7256Open in IMG/M
3300027432|Ga0209421_1098841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17596Open in IMG/M
3300027787|Ga0209074_10328784All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300027905|Ga0209415_10778503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium670Open in IMG/M
3300027915|Ga0209069_10700893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300028381|Ga0268264_10495424Not Available1191Open in IMG/M
3300028381|Ga0268264_10636937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1054Open in IMG/M
3300028381|Ga0268264_12050878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300031236|Ga0302324_100927101Not Available1194Open in IMG/M
3300031241|Ga0265325_10183517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium973Open in IMG/M
3300031469|Ga0170819_16033060All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300031708|Ga0310686_100465945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium588Open in IMG/M
3300031712|Ga0265342_10577795Not Available568Open in IMG/M
3300031715|Ga0307476_10765379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium715Open in IMG/M
3300031720|Ga0307469_12073456All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300031720|Ga0307469_12185538All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300031823|Ga0307478_11455968All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300032174|Ga0307470_10089977Not Available1724Open in IMG/M
3300032174|Ga0307470_10137451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1472Open in IMG/M
3300032515|Ga0348332_14116542All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300033433|Ga0326726_10222116All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300033433|Ga0326726_12063825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300033475|Ga0310811_10602941Not Available1102Open in IMG/M
3300034163|Ga0370515_0291902Not Available690Open in IMG/M
3300034281|Ga0370481_0192803Not Available719Open in IMG/M
3300034354|Ga0364943_0215981All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium709Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere12.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere9.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere9.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere8.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.50%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.00%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.50%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.00%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.00%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.50%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.50%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.50%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.50%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.50%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.50%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.50%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015063Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015203Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_034303902140918007SoilAAGIRGTIEFDTPANAQIGALGIRIPAGAHTFTTLPALVK
INPhiseqgaiiFebDRAFT_10150502723300000364SoilMVPAPAFTLVTDKYPATANTRGTIEFDTPADAQIGELGIRIPPTRTYTTLPTLAK*
JGI1027J11758_1242243813300000789SoilVFDRYPATANIRGTIEFGTPAGAQIGALGIRIPNVAAHTYTTLPALAK*
Ga0062389_10184180813300004092Bog Forest SoilNIRGTIEFDAPAGAQIGALGIRIPAGAAHTYTTLPALAK*
Ga0062593_10103792023300004114SoilLAFTLGSGKYPATAGIRGTIEFDTPPNAQIGALGIRIPAAAHTFTTLPALAK*
Ga0070683_10006716133300005329Corn RhizosphereFTLAVDKFPETARIRGTIELDAPPGTQISVLGIRVRPAHTFTTLPALTK*
Ga0070683_10239870823300005329Corn RhizosphereLAFTLVTDKYLNTAGIRGTIEFDTPPGAQIGALGIRIPVAHTFTTLPALVR*
Ga0068869_10108401613300005334Miscanthus RhizosphereTANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK*
Ga0068869_10187583813300005334Miscanthus RhizosphereKYQVTQNIRGTVEFDTPAGAQIGALGIRIPLAHTFTTLPALAK*
Ga0070666_1075657313300005335Switchgrass RhizosphereLVTDKYPGTANIRGTIEFDKPANGQIGALGIRIPAGSAHTYTTLPALAK*
Ga0070680_10023451313300005336Corn RhizosphereGKYPATAGVRGTLEFDTPANAQIGVLGIRIPSAAHTFTTLPALAK*
Ga0070680_10049773933300005336Corn RhizosphereTLATDKYPVTANRRGTIEFDAPAGVQIGVLGIRIPIAHTFTSLPALAN*
Ga0070674_10213540723300005356Miscanthus RhizosphereYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK*
Ga0070659_10051094913300005366Corn RhizosphereAFTLVTDKYPMTANIRGTIEFDAPPGGQIGALAFRIPTAHTFTTLPALAK*
Ga0070667_10079097523300005367Switchgrass RhizosphereNIRGIIEFDAPPGAQIGALGIRIPNSAAHTYTTLPALAK*
Ga0070711_10186331923300005439Corn, Switchgrass And Miscanthus RhizosphereLGIDKYPAALSVRGTIEFDTPAGAQIGALGIRIPNSAAHTYTTLPALAK*
Ga0070705_10193066513300005440Corn, Switchgrass And Miscanthus RhizosphereAFTLAKDRYPGTANIRGTIEFDKPPGGQIGALAFRIPTAHTFTTLPALVK*
Ga0070678_10117012523300005456Miscanthus RhizosphereVTLNLRGTIEFDAPAGAQIGALGIRIPLAHTFTTLPALAK*
Ga0070681_1022749013300005458Corn RhizosphereKYPATIGARGTLEFDTPANAQIGVLGIRIPSAAHTFTTLPALAK*
Ga0070681_1049648833300005458Corn RhizosphereNIRGTIEFDAPAGAQIGALGIRMPSGASHTYTTLPALAK*
Ga0070681_1160368123300005458Corn RhizosphereAFTLVTDKYPATANTRGTIEFDKPANGQIGVLGIRIPPTSTYTTLPALAK*
Ga0070679_10018061843300005530Corn RhizosphereTDKYPATVNIRGTIEFDAPPGAQIGALGIRIPVAHTFTTLPALAK*
Ga0070684_10053229123300005535Corn RhizosphereTANIRGTVEFDTPAGGQIGALGIRIPTGAAHTYTTLPALAK*
Ga0070684_10132137323300005535Corn RhizospherePATAGGPGTIEFDTPAGAQIGGLGIRIPLAHNFTTFSALVK*
Ga0068853_10010388523300005539Corn RhizosphereLAVDKFPETARIRGTIELDAPPGTQISVLGIRVRPAHTFTTLPALTK*
Ga0070693_10067452223300005547Corn, Switchgrass And Miscanthus RhizosphereHVAFTLVTDKYPQTANIRGTIEFGTPSGGQIGALGIRIPIAHTFTTLPALAR*
Ga0068855_10021136133300005563Corn RhizosphereNGHLAFTLVADKYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK*
Ga0068855_10054441823300005563Corn RhizosphereMRGTIEFDKPPNGQIGALGIRIPTGAAHTFTTLPALAK*
Ga0070664_10177418923300005564Corn RhizosphereTTQAPVGVAIGALGIRITAGATPTYTTLPALARQ*
Ga0068854_10214475223300005578Corn RhizosphereIEFDKPAGAQIGALGIRIPSGAAHTYTSLPGLAK*
Ga0068856_10125396223300005614Corn RhizosphereVTEKYPATANVRGTIEFDKPANAQIGVLGIRIPPTQTYTTLPVLVK*
Ga0068852_10203415323300005616Corn RhizosphereANIRGTIEFGKPANAQIAALGIRIPTGAAHAYTTLPALAK*
Ga0068864_10011310113300005618Switchgrass RhizosphereHSAFALGVDRFPAAAGIRGTIEFDVPAGAQIGALGIRTPLAHTFTTLPALTK*
Ga0068864_10261288323300005618Switchgrass RhizosphereTLGTDKYLGTLGIRGTIEFDTPAGAQIGALGIRIPIAHTFTTLPALVR*
Ga0068866_1089649023300005718Miscanthus RhizosphereIEFDTPVGAQIGAVGIRIPAGVAHTYTTLPALVK*
Ga0068858_10074535313300005842Switchgrass RhizosphereNILNIRGTIEFLAPLGASIGALGIRIPVGAAPTYTTLPSLARQ*
Ga0068858_10087214123300005842Switchgrass RhizosphereIRGTIEFDAPAGAQIGALGIRIPIAHTFTTLPALTK*
Ga0068858_10255749113300005842Switchgrass RhizosphereVVDKFAMTNGIRGTLEFDAPAGSQISALGIRIPQAHTFTTLPALAK*
Ga0068860_10159139213300005843Switchgrass RhizosphereTIRGTIEFDKPPNAQIGALGIRIPTGEAHTFTTLPALAK*
Ga0075024_10076504023300006047WatershedsVAFTLVTDKYPATANIRGTIEFDSPVGAQIGALALRIPPGAAHTYTSLPALAK*
Ga0075028_10033205813300006050WatershedsHYAFTMVVDKYSATAGIRGTIEFGKPANGQIGVLGIRIPAIAHTFTTLPALAK*
Ga0075029_10099976213300006052WatershedsANIRGTIEFDTPAGAQIGALGIRIPAGAAHTYTTLPALAK*
Ga0075017_10081333723300006059WatershedsQNIPNILNIRGTIEFDKPPTAQIGALGIRIPTGAAHTFTTLPALAK*
Ga0075030_10067247023300006162WatershedsDKYPAANNMRGTIEFDKPPNGQIGAVGIRIPASAAHTYTTLPSLAK*
Ga0075030_10126594923300006162WatershedsRGTIEFDTPSGGQIGALGIRIPVGHTFTTLPALAK*
Ga0075030_10137637423300006162WatershedsNIRGTIEFDTPAAAQIGALGIRIPAGVAHTYTTLPALPK*
Ga0075018_1031041523300006172WatershedsYPATAGIRGTIEFDKPANGQIGLLGIRIPAVAHTFTSLPALAR*
Ga0075014_10081898823300006174WatershedsLGVNKYTFTGNKRGTEFATPSGGQIGALGIRIPPKLTFTTLPARAK*
Ga0097621_10022926933300006237Miscanthus RhizosphereIEFDKPAGAQIGALGIRIPTGTAHTYTTLPALAK*
Ga0075021_1101693213300006354WatershedsNIRGTIEFDAPTGVQIGALGIRMPTGAAHAYTTLPALAK*
Ga0068871_10065962513300006358Miscanthus RhizosphereSIQGTIEFDTPAGSQIGALGIRIPDVPAHTYTTLPALAK*
Ga0068871_10139189123300006358Miscanthus RhizosphereGSDRYQAAATIRGTIEFDKPPNAQIGALGIRIPTGAAHTFTTLPALAK*
Ga0068871_10152103913300006358Miscanthus RhizosphereQKYPATANIRGTIEFDTPSAAANAQIGVVGIRIPTGAAHAYTTLPALAK*
Ga0079222_1005093033300006755Agricultural SoilGSDRYQAAATMRGTIEFDKPPNGQIGALGIRIPTGAAHTFTTLPALAK*
Ga0075425_10238360223300006854Populus RhizosphereIRGTIEFDTTQAPVGVAIGALGIRITAGATPTYTTLPALARQ*
Ga0068865_10007063643300006881Miscanthus RhizosphereTLGVDRYPATVGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK*
Ga0066710_10491657713300009012Grasslands SoilTANKRGTIEFVRPAGAQIGVLGIRIPVTNTFTTLPALAK
Ga0099830_1151406713300009088Vadose Zone SoilNIRGTIEFDTPTNGQIGALGIRIPAAHTFTTLPALVK*
Ga0105240_1071365633300009093Corn RhizosphereRGTIEFDTPAGAQIGALGIRMPAGAAHTYTTLPALAK*
Ga0105240_1111519233300009093Corn RhizosphereFKYSQTAGIRGTLEFQTPIGAQIGALGIRIPVAHTFTTLPALAK*
Ga0105245_1002366043300009098Miscanthus RhizosphereMHVQAANIRGTIEFDTPAGATIGAPGIRIPPGALTTYTTLPALTK*
Ga0105245_1010210913300009098Miscanthus RhizosphereIEFDKPAGAQIGALGIRIPAVAAHTYTTLPGLAK*
Ga0105245_1167455613300009098Miscanthus RhizosphereSAFTLGTDKYPGTANIRGTIEFDTPANAQIGALGIRIPSTQTYTTLPALVK*
Ga0105245_1214679123300009098Miscanthus RhizosphereIRGTIEFVTPSGAKIGALGIRTPVAHTFTTLPALAK*
Ga0105247_1120036623300009101Switchgrass RhizosphereYPAAAAIRGTIEFDKPPNAQIGALGIRIPTGPAHTFTTLPALAK*
Ga0105247_1178963613300009101Switchgrass RhizosphereYPGAAHIRGTIEFDKPTGAQIGALGIRIPAVAAHTYTTLPALAK*
Ga0105243_1014741213300009148Miscanthus RhizosphereNRGTIEFDAPAGVTIGALGIRTPIAHTFTTLPALAK*
Ga0105243_1215163213300009148Miscanthus RhizosphereQTANIRGTIEFGTPSGGQIGALGIRIPIAHTFTTLPALAK*
Ga0105243_1256266413300009148Miscanthus RhizosphereDKYQVTQNIRGTVEFDTPAGAQIGALGIRIPLAHTFTTLPALAK*
Ga0105241_1023465713300009174Corn RhizosphereTAGLRGTLEFDTPAGGEIGVLGIRVGVAHTFTTLPALAK*
Ga0105241_1071338213300009174Corn RhizosphereIRGTIEFVAPTGAAIGALGIRIPAGATTTYTTLPALAK*
Ga0105241_1159627813300009174Corn RhizosphereDRYPATAAIRGTIEFVKPVSAQIAALGIRIPAGPAHTYTTLPALAK*
Ga0105241_1241736723300009174Corn RhizosphereRGTVEFDKPAVAQIGVLGIRVPVTHTFTTLPSLAK*
Ga0105242_1281626813300009176Miscanthus RhizosphereYPAALHIRGTIEFVAPTGAAIGALGIRIPAGATTTYTTLPALAK*
Ga0105248_1131363313300009177Switchgrass RhizosphereIRGTIEFDTPSAAANAQIGVVGIRIPTGAAHAYTTLPALAK*
Ga0105237_1055443113300009545Corn RhizosphereFALGDKYSAAATIRGTIEFDTPPGGQIGVLGIRTPVAHTFTTLPALTR*
Ga0105237_1117933833300009545Corn RhizosphereYPFARTIRGTIEFLAPTGVSIGALGIRISPGATTTYTTLPALARQ*
Ga0105237_1209714213300009545Corn RhizosphereVDKYQGAANIRGTIEFDKPGNAQIGALGIRIPTGAAHTFTTLPALAK*
Ga0105238_1014652913300009551Corn RhizosphereLSFTLVTDKYPQTADIRGTIEFGAPLNTRIGALGIRIPVTHTFTTLPALTK*
Ga0105249_1194893313300009553Switchgrass RhizosphereKYAATANIRGTIEFDKPSNAQIGALGIRIPAGVAHTYTTLPALAK*
Ga0116134_120805823300009764PeatlandFTLAVDKYPAAANIRGTIEFDTPAGARIGVLGIRIPVAHTFTTLPALVK*
Ga0099796_1040821223300010159Vadose Zone SoilIRGTIELDTPFGAQIGALGIRIPAGGAHTYTTLPALAK*
Ga0134128_1073565123300010373Terrestrial SoilANIRGTVEFDTPAGAQIGALGIRIPSGAAHTYTTLPALAK*
Ga0134128_1321818423300010373Terrestrial SoilNIRGTIEFDTTQAPVGVAIGALGIRITAGATPTYTTLPALARQ*
Ga0105239_1026469613300010375Corn RhizosphereHLAFTLGTDKYPATATIRGTIEFDTPPGGQIGVLGIRIPIAHTFTTLPALTR*
Ga0105239_1133993113300010375Corn RhizosphereVRGTIEFDTPANAKIGVLGIRIPPTQTYTTLPALAK*
Ga0134124_1322495813300010397Terrestrial SoilATVGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK*
Ga0134127_1313673813300010399Terrestrial SoilGTVEFDTPAGAQIGALGIRIPTGAAHTYTTLPALAK*
Ga0134122_1304225213300010400Terrestrial SoilMRGTIQFDTPANAPIGVLGIRIPAAAHTFTTLPALAK*
Ga0134121_1256889713300010401Terrestrial SoilPAALHIRGTIEFVAPTGAAIGALGIRIPAGATTTYTTLPALAK*
Ga0105246_1056709023300011119Miscanthus RhizosphereFTLGIDKYPAALAIRGTIEFDKPAGAQIGALGIRIPSGAAHTYTSLPGLAK*
Ga0150985_11262101723300012212Avena Fatua RhizosphereIQGTAEFDAPIGVQIGALGIRTPLAHTFTTLPALVK*
Ga0137384_1035727123300012357Vadose Zone SoilVADKYPATANIRGTIEFDTPLGGQIGALGIRIPIAHTFTTLPALAR*
Ga0137360_1043063023300012361Vadose Zone SoilHLAFTLVTDKYPAAAHIRGTIEFDTPPGGQIGALGIRIPIAHTFTTLPALAK*
Ga0137359_1051630223300012923Vadose Zone SoilGHTQFTLVTDKYAATANIRGTIEFDKPANAKIGVLGIRIPPTQTYTTLPALAK*
Ga0157370_1038734813300013104Corn RhizosphereLASDKYPATAGIRGTIEFDTPANAQIGVLGIRIPAAAHTFTTLPALAK*
Ga0157370_1041650933300013104Corn RhizosphereHLAFTLVTDKYLNTAGIRGTIEFDTPPGAQIGALGIRIPVAHTFTTLPALVR*
Ga0157370_1129500823300013104Corn RhizosphereANIRGTIEFDTPAGVQIGALGIRIPVAHTFTTLPALAK*
Ga0157374_1007853113300013296Miscanthus RhizosphereLVTDKYPQTANIRGTIEFGTPSGGQIGALGIRIPTAHTFTTLPALAR*
Ga0157374_1132557413300013296Miscanthus RhizosphereLAFTLGTDKYLGTLGIRGTIEFDTPAGAQIGAMGIRIPIAHTFTTLPALVR*
Ga0157374_1167067323300013296Miscanthus RhizosphereCTANIRGTIEFDTPAGAQIGALGIRIPSSAAHAYTTLPALAK*
Ga0157374_1169266513300013296Miscanthus RhizosphereANIRGTIEFDRPANAQIGALGIRIPSGTAHTYTTLPALAK*
Ga0157378_1144818113300013297Miscanthus RhizosphereIEFVKPVSAQIAALGILIPAGPAHTYTTLPALAK*
Ga0157378_1287078523300013297Miscanthus RhizosphereYPETANIRGTIEFGKPANAQIGALGIRIPTGAAHAYTTLPALAK*
Ga0163162_1209080513300013306Switchgrass RhizosphereIEFDTPAGAQIGALGIRIPNVAAHTYTTLPALAK*
Ga0157372_1018670963300013307Corn RhizosphereGSDKYPATANIRGTIEFDKPANGQIGVLGIRIPVAHTFTTLPALAK*
Ga0157372_1194639713300013307Corn RhizosphereLAFTLGVDRYPATVGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK*
Ga0157372_1307088113300013307Corn RhizosphereRGTIELDAPLNTQIGALGIRIPVTHTFTTLPALTK*
Ga0157375_1002658513300013308Miscanthus RhizosphereLGTDKYPATVNLRGTIEFDAPAGAQIGALGIRAPLAHTFTTLPALAK*
Ga0157375_1356559313300013308Miscanthus RhizosphereTQNIRGTIEFDTPAGAQIGALGIRVPLAHTFTTLPALGK*
Ga0157375_1366460413300013308Miscanthus RhizosphereTLTIRGTIEFDKPPNAQIGALGIRIPAGDAHTYTTLPALAK*
Ga0181535_1044523423300014199BogVMGHRGTIELDTPSGGQITALGIRQAASGAITTVPALVK*
Ga0181526_1106318523300014200BogDRYPATANIRGTIEFDKPVGAQIGALGIRIPTGAAHTYTTLPALAK*
Ga0182030_1032377613300014838BogAAGIRGTIEFDAPAGAQIGALGIRIPVAHTFTTLPALAK*
Ga0157376_1137643623300014969Miscanthus RhizosphereSSDKYPATYGIRGTIEFNKPANGQIGVLGIRMPAGQTHTFTTLPALAK*
Ga0167649_10074973300015063Glacier Forefield SoilKFQDPILNIRNMRGTIEFDTKQVPVGAAIGALGIRIRPGATATYTTLPALARQ*
Ga0167650_103884513300015203Glacier Forefield SoilTQKYPVTANIRGTIEFDAPIGAQIGALGIRIPSGAAHAYTTLPALAK*
Ga0167650_104569013300015203Glacier Forefield SoilYAFTMVVDKYPTTAGIRGTIEFDKPANGQIGVLGIRIPAVAHTFTSIPSLPK*
Ga0181505_1031367113300016750PeatlandATANIRGTIEFDTPAGARIGVLGIRMPVAHTFTTLPALVR
Ga0181505_1095366833300016750PeatlandPATANLRGTIEFDTPAGAQIGVLGIRTLAGHTFTALPVLVR
Ga0187879_1053469123300017946PeatlandANIRGTIEFGTPAGAQIGVMGIRTPAGHTFTALPVLPK
Ga0187875_1025983223300018035PeatlandDKYAATASIRGTIEFGTPAGAQIGVVGIRTPAGHTFTALPVLAK
Ga0187855_1094812923300018038PeatlandATANIRGTIEFGTPAGAQIGVMGIRTPAGHTFTALPVLPK
Ga0187769_1144574313300018086Tropical PeatlandNGHLSFTLVTDKYANTAGIRGTLEFDTPPGGQIGTLGIRIPLAHTFTTLPALAR
Ga0210384_1012997143300021432SoilTLVVDKFPVTAGIRGTLELDAPTGGQIGALGIRIAPAHTFTTLPALVK
Ga0210384_1115833623300021432SoilLVTDKYAATANIRGTIEFDKPANAQIGVLGIRIPPTQTYTTLPALAK
Ga0207680_1033979313300025903Switchgrass RhizosphereLAFTLGTDKYPATATIRGTIEFDTPPGGQIGVLGIRIPIAHTFTTLPALTR
Ga0207680_1118666113300025903Switchgrass RhizosphereGHTQFTLVTDKYPGTANIRGTIEFDKPANGQIGALGIRIPAGSAHTYTTLPALAK
Ga0207654_1030621923300025911Corn RhizosphereTLVSDKYSVTQNIRGTIEFDTPAGAQIGALGIRIPVAHTFTTLPALGK
Ga0207654_1050790213300025911Corn RhizosphereTLVADKYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK
Ga0207654_1084356823300025911Corn RhizospherePGTAGIRGTIQFDTPAGAQIGALGIRIPSVAAHTYTTLPALAK
Ga0207654_1092838023300025911Corn RhizosphereDRYPATAAIRGTIEFVKPVSAQIAALGIRIPAGPAHTYTTLPALAK
Ga0207654_1130657913300025911Corn RhizosphereTAGLRGTLEFDTPAGGEIGVLGIRVGVAHTFTTLPALAK
Ga0207707_1151029513300025912Corn RhizosphereYPATASIRGTIEFDTPPGAQIGALAFRIPTAHTFTTLPALVK
Ga0207695_1017287743300025913Corn RhizosphereRFPITAGIRETIEFDTPTGAQIGALGIRIPVAHTFTSLPALVK
Ga0207695_1097141813300025913Corn RhizospherePNILNIRGTIEFVTPQGAAIGALGIRIPAGAAHTYTTLPALAR
Ga0207695_1158624623300025913Corn RhizosphereTAGMRGTIEFDTPANAQIGVLGIRIPAAAHTFTTLPALAK
Ga0207671_1088352813300025914Corn RhizosphereAFTLGSDRYPGALNIRGTIEFVKPADAQISALGIRIPGGAAHTYTTLPALAK
Ga0207671_1099170613300025914Corn RhizosphereFALGDKYSAAATIRGTIEFDTPPGGQIGVLGIRTPVAHTFTTLPALTR
Ga0207671_1123905513300025914Corn RhizosphereSDRYPATAAIRGTIEFVKPVSAQIAALGIRIPAGPAHTYTTLPALAK
Ga0207671_1159828513300025914Corn RhizosphereGLRGTLEFDTPAGGEIGVLGIRVGVAHTFTTLPALAK
Ga0207660_1040582923300025917Corn RhizosphereGADQFLAAAGIRGTIEFDAPAGAQIGALGIRIPIAHTFTTLPALTK
Ga0207660_1072190623300025917Corn RhizosphereLAFTLVSDKYSVTQNIRGTIEFDTPAGAQIGALGIRIPVAHTFTTLPALGK
Ga0207649_1110024623300025920Corn RhizosphereTAGIRGTIEFDTPPNAQIGALGIRIPAAAHTFTTLPALAK
Ga0207687_1053023433300025927Miscanthus RhizosphereIRGTIEFDKPTGAQIGALGIRIPAVAAHTYTTLPALAK
Ga0207687_1062883113300025927Miscanthus RhizosphereFTRVSDKYQVTLNKRGTIEFDAPAGVQIGALGIRIPAGDAHTYTTLPALAK
Ga0207687_1095828613300025927Miscanthus RhizosphereTDRYPATATIRGTIEFVKPANAQIGALGIRIPAGAAHTYTTLPALAK
Ga0207687_1138029923300025927Miscanthus RhizosphereALTIRGTIEFDTPAGAQIGALGIRIPNVAAHTYTTLPALAK
Ga0207686_1014720013300025934Miscanthus RhizosphereKYSAAATIRGTIEFDTPPGGQIGVLGIRTPVAHTFTTLPALTR
Ga0207686_1040406613300025934Miscanthus RhizosphereAVTLVADKYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK
Ga0207686_1130165023300025934Miscanthus RhizosphereYPAALHIRGTIEFVAPTGAAIGALGIRIPAGATTTYTTLPALAK
Ga0207709_1038284133300025935Miscanthus RhizosphereYPATAKIRGTIEFDAPAGAQIGALGIRMPIGAAHAYTTLPALAK
Ga0207709_1136371413300025935Miscanthus RhizosphereAAANIRGTIEFDTPAGAQIGALGIRIPDSAAHTYTTLPALAK
Ga0207669_1174346523300025937Miscanthus RhizosphereYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK
Ga0207711_1057138713300025941Switchgrass RhizosphereATVGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK
Ga0207689_1116712313300025942Miscanthus RhizosphereTANIRGTIELDAPLNTQIGALGIRIPVTHTFTTLPALTK
Ga0207661_1021664513300025944Corn RhizosphereRGTIEFGTPSGGQIGALGIRIPIAHTFTTLPALAK
Ga0207661_1023015613300025944Corn RhizosphereGIRGTIEFDAPAGAQIGALGIRIPIAHTFTTLPALTK
Ga0207661_1124093723300025944Corn RhizosphereGHSAFTLAVDKFPETARIRGTIELDAPPGTQISVLGIRVRPAHTFTTLPALTK
Ga0207667_1004952973300025949Corn RhizosphereVTTNMQGTVEFDAPIGVQIGALGIRTPIAHTFTTLPALAK
Ga0207667_1027738113300025949Corn RhizosphereFPITAGIRGTIEFDTPTGAQIGALGIRIPVAHTFTSLPALVK
Ga0207667_1033694223300025949Corn RhizosphereLGSGKYPATAGIRGTIEFDTPPNAQIGALGIRIPAAAHTFTTLPALAK
Ga0207658_1090106813300025986Switchgrass RhizosphereNIRGIIEFDAPPGAQIGALGIRIPNSAAHTYTTLPALAK
Ga0207677_1014593213300026023Miscanthus RhizosphereGHLAFTLGSQKYPETANIRGTIEFGKPANAQIGALGIRIPTGAAHAYTTLPALAK
Ga0207639_1023766833300026041Corn RhizosphereGLRGTIEFDAPASAQIGALGIRIPVAHTFTTLPALAK
Ga0207639_1034962213300026041Corn RhizosphereYLGTLGIRGTIEFDTPAGAQIGALGIRIPIAHTFTTLPALVR
Ga0207639_1072720313300026041Corn RhizosphereGKYPGTAGIRGTIEFDTPPNAQIGALGIRIPAAAHTFTTLPALAK
Ga0207639_1076372723300026041Corn RhizosphereNVRGTIEFDTPANAKIGVLGIRIPPTQTYTTLPALAK
Ga0207639_1083773933300026041Corn RhizosphereNIRGTIEFGKPANGQIGVLGIRIPVAHTFTTLPALAK
Ga0207639_1087239613300026041Corn RhizosphereLGVDKYWSTGNGRGTIEFAKPSNGQIAVLGIRIPATQTYTTLPALAK
Ga0207702_1003059273300026078Corn RhizosphereDQFPAALGIRGTIEFDAPAGAQIGALGIRIPIAHTFTTLPALTK
Ga0207702_1027750523300026078Corn RhizosphereKYPSTGNIRGTIEFDTPPGTQMGALGIRIPVGHTFTTLPALAR
Ga0207702_1105505423300026078Corn RhizosphereSAFTLVTEKYPATANVRGTIEFDKPANAQIGVLGIRIPPTQTYTTLPVLVK
Ga0207641_10011530103300026088Switchgrass RhizosphereRGTIEFATPAGAQIGALGIRTPVAHTFTTLPALVR
Ga0209421_109884113300027432Forest SoilHVAFTLGVDKYTAAAAVRGTIEFDTPTGAQIGALGIRIPVAHTFTTLPALVK
Ga0209074_1032878413300027787Agricultural SoilQAAATMRGTIEFDKPPNGQIGALGIRIPTGAAHTFTTLPALAK
Ga0209415_1077850323300027905Peatlands SoilTANIRGTIEFDTPVGAQIGALGIRIPVAHTFTTLPALAK
Ga0209069_1070089323300027915WatershedsDKFPEAAGIRGTIEFDKPANAQIGALGIRIPTGAAHTFTTLPALAK
Ga0268264_1049542433300028381Switchgrass RhizosphereHTQFTLVTDKYPGTANIRGTIEFDKPANGQIGALGIRIPAGSAHTYTTLPALAK
Ga0268264_1063693723300028381Switchgrass RhizosphereGNIRGTIEFDTPAGTQMGALGIRIPVAHTFTTLPALAR
Ga0268264_1205087813300028381Switchgrass RhizosphereDKYLATANIRGTIEFDPPAGAQIGALGIRIPIAHTFTTLPALAK
Ga0170824_10766527013300031231Forest SoilSLRGTIEFDTPAGAQISVLGIRTPPAFTFTTLPALTK
Ga0302324_10092710133300031236PalsaLGTGRYPATASIRGTIEFDAPAGAQIGALGIRIPVGAAHTYTTLPALAK
Ga0265325_1018351713300031241RhizosphereTLVADKYPGTANIRGTIEFATPPGGQIGALGIRIPVAHTFTTLPALAK
Ga0170819_1603306013300031469Forest SoilPAAAAIRGTIEFDKPPNGQIGALGIRIPTGAAHTFTTLPALAK
Ga0310686_10046594523300031708SoilRGTIEFDTPVGSQIGALGIRIPVAHTFTTLPALAK
Ga0265342_1057779523300031712RhizosphereAVDKYPAAANIRGTVEFDAPAGAQIGALGIRIPVAHTFTTLPAFVK
Ga0307476_1076537923300031715Hardwood Forest SoilYLATANIRGTVEFGNPSGAQIAGLGIRIPAVAAHTYTTLPALAK
Ga0307469_1207345623300031720Hardwood Forest SoilRTIRGTIEFDKPPNAQIGALGIRIPTGAAHTFTTLPALAK
Ga0307469_1218553823300031720Hardwood Forest SoilIRGTIEFDTPAGAQIGALGIRIPPTQTYTTLPALAK
Ga0307478_1145596813300031823Hardwood Forest SoilDRYPAALTIRGTIEFVKPANAQIGALGIRIPAGLDTTYTTLPALAK
Ga0307470_1008997713300032174Hardwood Forest SoilGTIEFGKPLGAQIGALGIRIPAVAAHTYTTLPALAK
Ga0307470_1013745123300032174Hardwood Forest SoilLRKYPATANIRGTIEFDKPANAQIGALGIRIPAGDAHTYTTLPALAK
Ga0348332_1411654213300032515Plant LitterPILSLVKDKYPQTANIRGTIEFDAPGGVQIGAVGIRAPAALTYTSLPALAK
Ga0326726_1022211613300033433Peat SoilVLDKYPGTANKRGTIEFDTPPGGQIGALGIRIPVAHTFTTLPALAK
Ga0326726_1206382523300033433Peat SoilTDKYPAAANIRGTIEFDTAPDRPMSVLGIRIPTAHTFTTLPAFVK
Ga0310811_1060294123300033475SoilNQFPVTANTQGTVEFDAPIGVQIGALGIRTPVAHTFTTLPALAK
Ga0370515_0291902_564_6893300034163Untreated Peat SoilALTIRGTIEFDTPASAQIGALGIRIPTGAAHTYTTLPALAK
Ga0370481_0192803_2_1513300034281Untreated Peat SoilTLGSGKYPVTKGIRGTLEFDTPVNAQIGVVGIRIPAAAHTFTTLPALAK
Ga0364943_0215981_553_7083300034354SedimentLAFTLATEKYPTTANIRGTIEFGRPPGVQIGVLGIRIPVAHTFTTLPPLAK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.