Basic Information | |
---|---|
Family ID | F022947 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 212 |
Average Sequence Length | 41 residues |
Representative Sequence | QILEGKVLPGDHVRVDRDGQKDAMRFERAPAKQPAAAAGI |
Number of Associated Samples | 171 |
Number of Associated Scaffolds | 212 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.89 % |
% of genes near scaffold ends (potentially truncated) | 96.70 % |
% of genes from short scaffolds (< 2000 bps) | 90.57 % |
Associated GOLD sequencing projects | 162 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.642 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.642 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.302 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.642 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.71% Coil/Unstructured: 85.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 212 Family Scaffolds |
---|---|---|
PF01435 | Peptidase_M48 | 83.02 |
PF13490 | zf-HC2 | 4.25 |
PF03783 | CsgG | 1.89 |
PF08044 | DUF1707 | 0.47 |
PF00231 | ATP-synt | 0.47 |
PF13637 | Ank_4 | 0.47 |
PF01757 | Acyl_transf_3 | 0.47 |
PF00306 | ATP-synt_ab_C | 0.47 |
PF02518 | HATPase_c | 0.47 |
COG ID | Name | Functional Category | % Frequency in 212 Family Scaffolds |
---|---|---|---|
COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 1.89 |
COG0055 | FoF1-type ATP synthase, beta subunit | Energy production and conversion [C] | 0.47 |
COG0056 | FoF1-type ATP synthase, alpha subunit | Energy production and conversion [C] | 0.47 |
COG0224 | FoF1-type ATP synthase, gamma subunit | Energy production and conversion [C] | 0.47 |
COG1155 | Archaeal/vacuolar-type H+-ATPase catalytic subunit A/Vma1 | Energy production and conversion [C] | 0.47 |
COG1156 | Archaeal/vacuolar-type H+-ATPase subunit B/Vma2 | Energy production and conversion [C] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.64 % |
Unclassified | root | N/A | 27.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q01EQKRM | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
3300000178|FW301_c1056209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300001661|JGI12053J15887_10629827 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101250276 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300002557|JGI25381J37097_1003173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2801 | Open in IMG/M |
3300002916|JGI25389J43894_1002262 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
3300004080|Ga0062385_10120389 | Not Available | 1308 | Open in IMG/M |
3300004080|Ga0062385_10832757 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300004103|Ga0058903_1365518 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300005163|Ga0066823_10056886 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300005175|Ga0066673_10285363 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300005435|Ga0070714_101199658 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300005439|Ga0070711_100334765 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300005446|Ga0066686_10505981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
3300005467|Ga0070706_101118849 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300005531|Ga0070738_10210344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 881 | Open in IMG/M |
3300005536|Ga0070697_100591984 | Not Available | 974 | Open in IMG/M |
3300005555|Ga0066692_10199217 | Not Available | 1252 | Open in IMG/M |
3300005555|Ga0066692_10404769 | Not Available | 866 | Open in IMG/M |
3300005568|Ga0066703_10129701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1505 | Open in IMG/M |
3300005574|Ga0066694_10347722 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300005602|Ga0070762_10002817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8251 | Open in IMG/M |
3300005602|Ga0070762_10369029 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300005764|Ga0066903_102831319 | Not Available | 941 | Open in IMG/M |
3300006041|Ga0075023_100277006 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300006173|Ga0070716_100711873 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300006173|Ga0070716_100731925 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300006176|Ga0070765_100222907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1720 | Open in IMG/M |
3300006854|Ga0075425_102027368 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300007076|Ga0075435_101809713 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300007788|Ga0099795_10450627 | Not Available | 592 | Open in IMG/M |
3300009038|Ga0099829_10273998 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300009088|Ga0099830_10233871 | Not Available | 1449 | Open in IMG/M |
3300009088|Ga0099830_10352354 | Not Available | 1184 | Open in IMG/M |
3300009088|Ga0099830_10353636 | Not Available | 1182 | Open in IMG/M |
3300009089|Ga0099828_10845964 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300009089|Ga0099828_11602246 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300009101|Ga0105247_11223006 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300009137|Ga0066709_100781535 | Not Available | 1381 | Open in IMG/M |
3300009143|Ga0099792_10347662 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300009615|Ga0116103_1137730 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300009792|Ga0126374_11598332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300010046|Ga0126384_11908225 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300010048|Ga0126373_10345166 | Not Available | 1499 | Open in IMG/M |
3300010304|Ga0134088_10018607 | All Organisms → cellular organisms → Bacteria | 3055 | Open in IMG/M |
3300010339|Ga0074046_10074214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2217 | Open in IMG/M |
3300010358|Ga0126370_10862206 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300010358|Ga0126370_11689126 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300010359|Ga0126376_10117966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2064 | Open in IMG/M |
3300010362|Ga0126377_10463319 | Not Available | 1292 | Open in IMG/M |
3300010376|Ga0126381_103414411 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300010379|Ga0136449_102917354 | Not Available | 671 | Open in IMG/M |
3300010398|Ga0126383_10118523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2407 | Open in IMG/M |
3300010867|Ga0126347_1174205 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300011271|Ga0137393_10883993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300011271|Ga0137393_11354027 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300011271|Ga0137393_11464062 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300012096|Ga0137389_10855287 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300012189|Ga0137388_11046443 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300012189|Ga0137388_11934143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300012198|Ga0137364_10422940 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300012202|Ga0137363_10140807 | Not Available | 1885 | Open in IMG/M |
3300012202|Ga0137363_10264195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
3300012203|Ga0137399_10506494 | Not Available | 1013 | Open in IMG/M |
3300012351|Ga0137386_10268855 | Not Available | 1226 | Open in IMG/M |
3300012356|Ga0137371_10349080 | Not Available | 1150 | Open in IMG/M |
3300012361|Ga0137360_11631869 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300012582|Ga0137358_10269874 | Not Available | 1156 | Open in IMG/M |
3300012683|Ga0137398_11082838 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300012917|Ga0137395_10892366 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300012918|Ga0137396_10747782 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300012922|Ga0137394_10287808 | Not Available | 1405 | Open in IMG/M |
3300012923|Ga0137359_11275046 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300012924|Ga0137413_10769292 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300012925|Ga0137419_11899907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300012927|Ga0137416_11408173 | Not Available | 631 | Open in IMG/M |
3300012927|Ga0137416_11807167 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012929|Ga0137404_10535163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
3300012944|Ga0137410_10731742 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300012944|Ga0137410_11755370 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300012971|Ga0126369_10034483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4195 | Open in IMG/M |
3300012986|Ga0164304_11734631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300013296|Ga0157374_10284146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1634 | Open in IMG/M |
3300013308|Ga0157375_11883386 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300014150|Ga0134081_10099136 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300014152|Ga0181533_1327363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300015052|Ga0137411_1367051 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300015054|Ga0137420_1017936 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300015054|Ga0137420_1055073 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300015054|Ga0137420_1094616 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
3300015054|Ga0137420_1301025 | Not Available | 1982 | Open in IMG/M |
3300015054|Ga0137420_1397839 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300015241|Ga0137418_10858276 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300015245|Ga0137409_11168138 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300016294|Ga0182041_10874216 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300016319|Ga0182033_10403131 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300016357|Ga0182032_11229141 | Not Available | 645 | Open in IMG/M |
3300017657|Ga0134074_1381538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300017930|Ga0187825_10309510 | Not Available | 590 | Open in IMG/M |
3300017932|Ga0187814_10148691 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300017937|Ga0187809_10041823 | Not Available | 1472 | Open in IMG/M |
3300017973|Ga0187780_10128144 | Not Available | 1755 | Open in IMG/M |
3300017993|Ga0187823_10057895 | Not Available | 1080 | Open in IMG/M |
3300018012|Ga0187810_10005338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4463 | Open in IMG/M |
3300018012|Ga0187810_10075373 | Not Available | 1301 | Open in IMG/M |
3300018034|Ga0187863_10667679 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 586 | Open in IMG/M |
3300018085|Ga0187772_11224113 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300018088|Ga0187771_11801493 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300018482|Ga0066669_10403768 | Not Available | 1158 | Open in IMG/M |
3300018482|Ga0066669_11080405 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300019268|Ga0181514_1381279 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300020062|Ga0193724_1039150 | Not Available | 1008 | Open in IMG/M |
3300020170|Ga0179594_10041733 | Not Available | 1517 | Open in IMG/M |
3300020579|Ga0210407_10828463 | Not Available | 712 | Open in IMG/M |
3300020580|Ga0210403_10522913 | Not Available | 963 | Open in IMG/M |
3300020580|Ga0210403_11082872 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300020580|Ga0210403_11298435 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300020581|Ga0210399_10350158 | Not Available | 1233 | Open in IMG/M |
3300020581|Ga0210399_10757660 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300020581|Ga0210399_11026348 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300020582|Ga0210395_10192304 | Not Available | 1530 | Open in IMG/M |
3300020583|Ga0210401_10984975 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300021088|Ga0210404_10302029 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300021088|Ga0210404_10602439 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300021168|Ga0210406_11128268 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300021171|Ga0210405_10066101 | All Organisms → cellular organisms → Bacteria | 2853 | Open in IMG/M |
3300021178|Ga0210408_10742384 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300021178|Ga0210408_11385527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300021403|Ga0210397_10882750 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300021403|Ga0210397_11210624 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300021403|Ga0210397_11476908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300021403|Ga0210397_11604460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300021405|Ga0210387_10499317 | Not Available | 1081 | Open in IMG/M |
3300021405|Ga0210387_10632381 | Not Available | 950 | Open in IMG/M |
3300021407|Ga0210383_10517152 | Not Available | 1030 | Open in IMG/M |
3300021420|Ga0210394_10134811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2141 | Open in IMG/M |
3300021474|Ga0210390_10730653 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300021475|Ga0210392_11350131 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300021476|Ga0187846_10193878 | Not Available | 852 | Open in IMG/M |
3300021478|Ga0210402_10578480 | Not Available | 1041 | Open in IMG/M |
3300021478|Ga0210402_11080860 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300021479|Ga0210410_11309832 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300021559|Ga0210409_10201175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1814 | Open in IMG/M |
3300023259|Ga0224551_1005838 | Not Available | 2055 | Open in IMG/M |
3300024179|Ga0247695_1035178 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300024330|Ga0137417_1182533 | Not Available | 939 | Open in IMG/M |
3300025498|Ga0208819_1010867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2927 | Open in IMG/M |
3300025900|Ga0207710_10554040 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300026281|Ga0209863_10031236 | Not Available | 1612 | Open in IMG/M |
3300026285|Ga0209438_1208467 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300026317|Ga0209154_1023053 | All Organisms → cellular organisms → Bacteria | 2909 | Open in IMG/M |
3300026317|Ga0209154_1309520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300026328|Ga0209802_1078364 | Not Available | 1541 | Open in IMG/M |
3300026330|Ga0209473_1303723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300026374|Ga0257146_1057846 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300026555|Ga0179593_1080801 | Not Available | 1533 | Open in IMG/M |
3300026557|Ga0179587_10502103 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300027061|Ga0209729_1001150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2169 | Open in IMG/M |
3300027073|Ga0208366_1027387 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300027310|Ga0207983_1026192 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300027381|Ga0208983_1037608 | Not Available | 945 | Open in IMG/M |
3300027537|Ga0209419_1107828 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300027546|Ga0208984_1147145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia | 504 | Open in IMG/M |
3300027587|Ga0209220_1066738 | Not Available | 955 | Open in IMG/M |
3300027643|Ga0209076_1097248 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300027729|Ga0209248_10067897 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300027795|Ga0209139_10114029 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300027829|Ga0209773_10195448 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300027857|Ga0209166_10247088 | Not Available | 948 | Open in IMG/M |
3300027882|Ga0209590_10596288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
3300027908|Ga0209006_11513936 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300029636|Ga0222749_10020886 | All Organisms → cellular organisms → Bacteria | 2706 | Open in IMG/M |
3300030760|Ga0265762_1121317 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300030974|Ga0075371_11666444 | Not Available | 862 | Open in IMG/M |
3300031446|Ga0170820_16727962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1962 | Open in IMG/M |
3300031469|Ga0170819_12928409 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300031546|Ga0318538_10186530 | Not Available | 1105 | Open in IMG/M |
3300031708|Ga0310686_116812030 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300031720|Ga0307469_10645015 | Not Available | 953 | Open in IMG/M |
3300031720|Ga0307469_12256902 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300031724|Ga0318500_10741190 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031754|Ga0307475_10572056 | Not Available | 905 | Open in IMG/M |
3300031754|Ga0307475_11236998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300031770|Ga0318521_10947950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300031771|Ga0318546_10093425 | Not Available | 1962 | Open in IMG/M |
3300031771|Ga0318546_11088989 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300031782|Ga0318552_10614407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300031820|Ga0307473_11106989 | Not Available | 584 | Open in IMG/M |
3300031823|Ga0307478_10381915 | Not Available | 1164 | Open in IMG/M |
3300031833|Ga0310917_10493640 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300031879|Ga0306919_10022209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3864 | Open in IMG/M |
3300031890|Ga0306925_10016884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7200 | Open in IMG/M |
3300031893|Ga0318536_10501569 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300031942|Ga0310916_10301748 | Not Available | 1356 | Open in IMG/M |
3300031945|Ga0310913_10523522 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300031962|Ga0307479_11095915 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300032044|Ga0318558_10381556 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300032052|Ga0318506_10285859 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300032180|Ga0307471_100025428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4447 | Open in IMG/M |
3300032180|Ga0307471_100940771 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300032180|Ga0307471_101670298 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300032180|Ga0307471_102520849 | Not Available | 651 | Open in IMG/M |
3300032180|Ga0307471_103405121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300032205|Ga0307472_101357149 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300032205|Ga0307472_101771984 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300032205|Ga0307472_102054804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300032261|Ga0306920_101541965 | Not Available | 947 | Open in IMG/M |
3300033180|Ga0307510_10431027 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300033289|Ga0310914_10284063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
3300033804|Ga0314863_136791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300033808|Ga0314867_013639 | Not Available | 1913 | Open in IMG/M |
3300033977|Ga0314861_0351330 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.70% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.83% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.42% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.42% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.94% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.94% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.94% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.94% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.47% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.47% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.47% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.47% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.47% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.47% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.47% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.47% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.47% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.47% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000178 | Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced) | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_09046460 | 2170459005 | Grass Soil | QDPLAMQILEGKVLPGDHIRVDRDGRKDAMRFERTPSQKAEKQPAAAAGI |
FW301_10562091 | 3300000178 | Groundwater | PLALKILEGSVLPGDHIVVDRDSRSDAMRFDRLPAKQAVAAVRS* |
JGI12053J15887_106298271 | 3300001661 | Forest Soil | QILDGKVLPGDHIRVDRDGKSDSMRFERVQASKPAAAA* |
JGIcombinedJ26739_1012502761 | 3300002245 | Forest Soil | LAMQILEGKVLPGDQVRVDRDGQKDAMRFERVAKAKPVAAAVTQ* |
JGI25381J37097_10031731 | 3300002557 | Grasslands Soil | LALQILEGQVLPGDHVRVDRDGQKDAMRFERAPAKQPAAAAGI* |
JGI25389J43894_10022621 | 3300002916 | Grasslands Soil | LALQILEGAVLPGDHVRVDRHGQRDAMRFDRAPSKQPAAAAGI* |
Ga0062385_101203891 | 3300004080 | Bog Forest Soil | AMQILEGKVLPGEHVRVDRDGQKVAMRFESAGLKQPAAAARI* |
Ga0062385_108327572 | 3300004080 | Bog Forest Soil | AMQILEGKVLPGEHVRVDRDGHKDAMRFESAGLKQPASAARI* |
Ga0058903_13655181 | 3300004103 | Forest Soil | PLALQILDGKVLPGDRIRVDRDGKSDAMRFERVQAKKPAAAKA* |
Ga0066823_100568862 | 3300005163 | Soil | LALQILEGRVLPGDHVQVDRDGKRDAMKFERVPAKQPAAAARI* |
Ga0066673_102853631 | 3300005175 | Soil | LALQILEGTVLPGDHVRVDRDGQKDAMKFVRVPSKQPAAAARI* |
Ga0070714_1011996581 | 3300005435 | Agricultural Soil | PLALQILEGKILPGDHVRVDRDAQSATMRFERVQAKRPAAA* |
Ga0070711_1003347652 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LEGKVLPGDHIRVDRDGKNDAMRFERVAPGKTAKQPAAAAGI* |
Ga0066686_105059812 | 3300005446 | Soil | ILEGTVLPGDHVRVDRDGQKDAMCFVRAAAKQPVAAAGI* |
Ga0070706_1011188492 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QILEGKVLPGDHVRVDRDGKKDAMRFERTASQKTEKQPATAAGI* |
Ga0070738_102103442 | 3300005531 | Surface Soil | QDPLALHILEGKVLPGDHVLVDRDGNRDAMKFERVPRKQPAAAARI* |
Ga0070697_1005919841 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LAMQILEGKVLPGDRVRVDRDGGKDVMRIERAPAKQPAAAARI* |
Ga0066692_101992172 | 3300005555 | Soil | PLALQILEGTILPGDHVRVDRDGQKDAMKFVRVPSKQPAAAARI* |
Ga0066692_104047692 | 3300005555 | Soil | LPGDHIRVDRDGNKDAMRFERVASKTAKQPAAAAGI* |
Ga0066703_101297011 | 3300005568 | Soil | QILEGAVLPGDRVIVDRDGQKDAMRFERKPAKQPAAAARI* |
Ga0066694_103477221 | 3300005574 | Soil | LEGAVLPGDHVRVDRHGQKDAMRFERAPSKQPAAAAGI* |
Ga0070762_100028171 | 3300005602 | Soil | VLPGDHIRVDRDGQKDAMRFERSRAKQPAAAAGI* |
Ga0070762_103690292 | 3300005602 | Soil | QDPLAMQILEGKVLPGDHIRVDRDGQKSAMRFERSKAKQPAAAAGI* |
Ga0066903_1028313191 | 3300005764 | Tropical Forest Soil | EILNATILPGDHIRVDRDGKKEAMKFEPVPAKKPAAAAKTF* |
Ga0075023_1002770062 | 3300006041 | Watersheds | EGAILPGDHVKVHRDAKKDAMRFERVESKKPAAAAKG* |
Ga0070716_1007118732 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDHILVDRDGKKDAMRFERVASSAKAQKQPAAAAGI* |
Ga0070716_1007319251 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LEGTILPGDHVRVDRDGQGNAMRFERGLAKRPARASTAV* |
Ga0070765_1002229074 | 3300006176 | Soil | EGKVLPGDQVRVDRDGQKDAMRFERVAKAKPVAAAVTQ* |
Ga0075425_1020273681 | 3300006854 | Populus Rhizosphere | ILEGKILPGDHVHVDRDGKNDSMRFERSAAPKRRQPAAAAGI* |
Ga0075435_1018097131 | 3300007076 | Populus Rhizosphere | QILGGSVLPGDHVRVDRDGKDAAMRFERLNAAAQPRQPAAAAGI* |
Ga0099795_104506272 | 3300007788 | Vadose Zone Soil | ALQILEGKVLPGDHILVDRDGRKDAMRFERVAASAKAEKQPAAAAGI* |
Ga0099829_102739983 | 3300009038 | Vadose Zone Soil | QILEGKVLPGDHVRVDRDGQKDAMRFERAPAKQPAAAAGI* |
Ga0099830_102338713 | 3300009088 | Vadose Zone Soil | QILQGTVLPGDQVRVDRDGQKDTMRFERAPAKQPVTAAGI* |
Ga0099830_103523541 | 3300009088 | Vadose Zone Soil | LALQILQGTVLPGDHVRVDRDGQKDAMRFERAPSKQPAATVGI* |
Ga0099830_103536362 | 3300009088 | Vadose Zone Soil | QDPLAMQILEGKVLPGDGVRVDRDAQKDAMRFERVPSKKSAAAA* |
Ga0099828_108459642 | 3300009089 | Vadose Zone Soil | RLVQDPLAMQILEGKVLPGDRVRVDRDAQKDAMRFERVPSKKPAAAA* |
Ga0099828_116022462 | 3300009089 | Vadose Zone Soil | LQILQGTVLPGDHVRVDCDGQKDAMRFERAESRQPASAARI* |
Ga0105247_112230061 | 3300009101 | Switchgrass Rhizosphere | ILPGDHVKVDRDGKNDAMRFERLNAPSERRQPAAAAGI* |
Ga0066709_1007815351 | 3300009137 | Grasslands Soil | HILEGKVLPGDHVRVDRDGQKDAMRFERAPRKQPVAAAGI* |
Ga0099792_103476622 | 3300009143 | Vadose Zone Soil | ALQILDAKVLPGDHIRVDRDGKSDSMRFERVQAKKPATAA* |
Ga0116103_11377302 | 3300009615 | Peatland | MQILEGAILPGDHVRVDRDGPKDAMRFERVLAKAPAAAARK* |
Ga0126374_115983321 | 3300009792 | Tropical Forest Soil | ILEGKVLPGDHVIVDRDGQKDAMRFERKPSKQPVAAARI* |
Ga0126384_119082252 | 3300010046 | Tropical Forest Soil | VLPGDRVRVDRDGSKDAMRFERVQPKKPAVAATK* |
Ga0126373_103451661 | 3300010048 | Tropical Forest Soil | KVLPGDHVIVDRDGQKDAMRFERKPSKQPVAAARI* |
Ga0134088_100186071 | 3300010304 | Grasslands Soil | DPLALQILQGTVLQGDHVRVDRDGQKDAMKFVRARSKQPAAAAGI* |
Ga0074046_100742141 | 3300010339 | Bog Forest Soil | AILPGDQVRVDRDGKKDAMRFERVPPRKPKAAATQ* |
Ga0126370_108622061 | 3300010358 | Tropical Forest Soil | LPGDHVRVDRDGKNDAMRFERLNAPWPARQPAAAAGI* |
Ga0126370_116891262 | 3300010358 | Tropical Forest Soil | KVLPGDHIVVDRDGQKDAMRFERRPAKQPAAAARF* |
Ga0126376_101179661 | 3300010359 | Tropical Forest Soil | DPLALQILDGKILPGDLVLVDRDGESDSMKFERRPQKQPAAAARI* |
Ga0126377_104633192 | 3300010362 | Tropical Forest Soil | IQDPLALEILEGKILPGDHVRVDRDGKNDSMRFERSGAHGRRQPAAAAGI* |
Ga0126381_1034144112 | 3300010376 | Tropical Forest Soil | EGKVLPGEHIKVDRDGKNEAMKFESVAAKKPAAAAVTS* |
Ga0136449_1029173541 | 3300010379 | Peatlands Soil | ALQILEGSVLPGDHVRVDREGKKDAMRFERAPAKQATAAAKK* |
Ga0126383_101185231 | 3300010398 | Tropical Forest Soil | GAVLPGDHVVADRDGQKDVLRFDRKPAKQPAAAARI* |
Ga0126347_11742051 | 3300010867 | Boreal Forest Soil | MIQDPLAMQILEGKVLPGEHIRVDRDGKKEAMKFESVKASKPAVAAVTS* |
Ga0137393_108839931 | 3300011271 | Vadose Zone Soil | ILEGKVLPGDHVRVDRNGQKDAMRFERAPAKQPAAAAGI* |
Ga0137393_113540272 | 3300011271 | Vadose Zone Soil | LEGKVLPGDHVIVDRDGQKDVMRFERKPAKQPAAAARI* |
Ga0137393_114640622 | 3300011271 | Vadose Zone Soil | ALQILEGRVLPGDQVIADRDGQKEAMRFERVAAKLPAAAAKK* |
Ga0137389_108552871 | 3300012096 | Vadose Zone Soil | LQILEGKVLPGDHVRVDRDGQKDAMRFERTPAKQPAAAAGI* |
Ga0137388_110464431 | 3300012189 | Vadose Zone Soil | LALQILDGKVLPGDQIRVDRDGKSDSMRFERVQASKPAAAA* |
Ga0137388_119341431 | 3300012189 | Vadose Zone Soil | QILEGVVLPGDHVIVDRDGRKDAMRFERAPSKQPAAAARI* |
Ga0137364_104229402 | 3300012198 | Vadose Zone Soil | LALQILEGKVLPGDHVRVDRDGQKDAMRFERAPAKQPAAAAGI* |
Ga0137363_101408073 | 3300012202 | Vadose Zone Soil | ILEGKVLPGDHVRVDRDGQKDAMKFERAPAKQPAAAAGI* |
Ga0137363_102641953 | 3300012202 | Vadose Zone Soil | QDPLALQILEGKVLPGDHVRVDRDGKSDSMRFERVQTKRPAAA* |
Ga0137399_105064942 | 3300012203 | Vadose Zone Soil | GKVLPGDHVRVDRDGQKDAMKFERAPAKQPAAAAGI* |
Ga0137386_102688553 | 3300012351 | Vadose Zone Soil | GAILPGDHVRVDRDATKDAMRFERVAAKQPAAAARV* |
Ga0137371_103490802 | 3300012356 | Vadose Zone Soil | SQVPLARQILEGKVLPGDQLRVDRDGNKDVMGFERVASKAAKQPAAAAGI* |
Ga0137360_116318691 | 3300012361 | Vadose Zone Soil | ILEGKVLPGDHVLVDRDGKNEAMRFERLPLKQPAAAARI* |
Ga0137358_102698743 | 3300012582 | Vadose Zone Soil | PLAMQILEGQVLPGDHIRVDRDGNKDAMRFERTASQKTEKQPASAAGI* |
Ga0137398_110828381 | 3300012683 | Vadose Zone Soil | EGKVLPGDHIRVGRDGKKHAMGFERTASQKTEKQPATAAGI* |
Ga0137395_108923662 | 3300012917 | Vadose Zone Soil | SLKLHRVFLPSDHVSVDRDGQKDAMKFERVSAKQPAAAAGI* |
Ga0137396_107477821 | 3300012918 | Vadose Zone Soil | PLALQILEGKVLPGDPVRVDRDGQKDAMRFERAPAKQPAAAAGI* |
Ga0137394_102878081 | 3300012922 | Vadose Zone Soil | LALQILEGNVLPGDRVRVDRDGQKGAMRFERVTAKQPAAAGKK* |
Ga0137359_112750462 | 3300012923 | Vadose Zone Soil | QILESKVLPGDHVRVDRDGQRDAMRFERTPAKQPAAAAGI* |
Ga0137413_107692922 | 3300012924 | Vadose Zone Soil | DPLALQILEGKVLPGDHVLVDRDGKSEAMRFERVPAKQPAAAARI* |
Ga0137419_118999072 | 3300012925 | Vadose Zone Soil | QILQGTVLPGDHVRVDRDGQKDAMKFVRGPSKQPAAAVGI* |
Ga0137416_114081732 | 3300012927 | Vadose Zone Soil | TVLPGDRVRVDRDAKKDAMRFERALAKQPASAARI* |
Ga0137416_118071672 | 3300012927 | Vadose Zone Soil | LALQILEGKILPGDRVLVDRDGKSDSMRFERVQKKQPAAAASV* |
Ga0137404_105351631 | 3300012929 | Vadose Zone Soil | LQILEGKVLPGDHVRVDRDGQKDAMRFERAPAKQPAVAAGI* |
Ga0137410_107317421 | 3300012944 | Vadose Zone Soil | KILPGDHIRVERDGDKVAMRFERVAAKQPAAAARI* |
Ga0137410_117553701 | 3300012944 | Vadose Zone Soil | GKILPGDVVSVDRDGTKEAMRFERITKSKPATASVAH* |
Ga0126369_100344835 | 3300012971 | Tropical Forest Soil | ALQILEGKILPGDQVRVDRDGKSDAMHFERQASKQPAAAARI* |
Ga0164304_117346311 | 3300012986 | Soil | IQDPLALQILEGTVLPGDRLAVDRDGSKDAMRSERLVSARVEKQPAAAAGI* |
Ga0157374_102841461 | 3300013296 | Miscanthus Rhizosphere | DRVRVDRDGNNVSMRFERLNAPAQPRQPAAAAGI* |
Ga0157375_118833861 | 3300013308 | Miscanthus Rhizosphere | IQDPLALEILEGKVLPGDRVRVDRDGKNDAMLFERLNAPSPPRQPAAAAGI* |
Ga0134081_100991362 | 3300014150 | Grasslands Soil | LQILEGKVLPGDQVVVDRDGQKDVMRFERKPAKQPAAAARI* |
Ga0181533_13273632 | 3300014152 | Bog | VQDPLAMQILEGAVLPGDHVRVDRDGQKDAMRFERVPAKAPAAAARK* |
Ga0137411_13670512 | 3300015052 | Vadose Zone Soil | MQILQGTVLPGDHVRVDRDGQKDAMKFARAKPKQPAAAAGI* |
Ga0137420_10179363 | 3300015054 | Vadose Zone Soil | ALQILQGTVLPGDHVRVDRDGQKDAMRFERAPSKRPAAAAGI* |
Ga0137420_10550733 | 3300015054 | Vadose Zone Soil | PLALQILQGTVLPGDHVRVDRDGQKDAMRFERAPSKRPAAAAGI* |
Ga0137420_10946161 | 3300015054 | Vadose Zone Soil | QRLVQDPLPLQILDGKVLPGDHIRVDRDGKSDSMRFERVQASKPAAAA* |
Ga0137420_13010251 | 3300015054 | Vadose Zone Soil | RLVQDPLPLQILDGKVLPGDHIRVDRDGNKSDSMRFERVQASKPAAAA* |
Ga0137420_13978393 | 3300015054 | Vadose Zone Soil | ILQGTVLPGDHVRVDRDGQKDAMRFERAPSKRPAAAAGI* |
Ga0137418_108582761 | 3300015241 | Vadose Zone Soil | GKVLPGDHIRVVRDGTKDAMRFERTAPQKTEKQPATAAGI* |
Ga0137409_111681382 | 3300015245 | Vadose Zone Soil | DHIRVDRDGKKDAMRFERTASQKTEKQPATAAGAAGI* |
Ga0182041_108742161 | 3300016294 | Soil | DPLALEILNGSILPGDHIRVDRDGKKDAMKFERTPAKKPAAAAKTS |
Ga0182033_104031311 | 3300016319 | Soil | DPLAMQILEGAILPGDHVRVDRDGSKDAMRFERVQPKKPAAAATK |
Ga0182032_112291412 | 3300016357 | Soil | EGKILPGDHLRVDRDGKRDTMRFERVAPRRPAVAGRA |
Ga0134074_13815381 | 3300017657 | Grasslands Soil | LQILEGKVVPGDHLIVDRDGQKDAVRFERKPAKQPAAAARI |
Ga0187825_103095101 | 3300017930 | Freshwater Sediment | GKVLPGEHVRVDRDGKKDVMRFANAPAKQPASAARI |
Ga0187814_101486911 | 3300017932 | Freshwater Sediment | PLAMQILEGAILPGDHVRVEHDGQKDALRFERVPTKQPASAARI |
Ga0187809_100418231 | 3300017937 | Freshwater Sediment | LALQILEGAILPGDHVRVDRDGKKDVMRFERVQPKKPAAAATR |
Ga0187780_101281441 | 3300017973 | Tropical Peatland | ILEGAILPGDHVRVDRDGKKDGMRFERTHPKKPVAAAAN |
Ga0187823_100578951 | 3300017993 | Freshwater Sediment | KVLPGDHIRVDRDGKNDAMRFDRVSAKSDAKQPAAAAGI |
Ga0187810_100053382 | 3300018012 | Freshwater Sediment | MQILEGAILPGDHVRVDRDGKKDAVRFERVPAKKPAAAATQ |
Ga0187810_100753732 | 3300018012 | Freshwater Sediment | QDPLALQILEGARLPGDHEHVDRDAKKDAMRFERVPAKQPASAARI |
Ga0187863_106676791 | 3300018034 | Peatland | LALQILQGTVLPGDHVRDDRDGKKDAMRFERVALKAPAAAAKS |
Ga0187772_112241131 | 3300018085 | Tropical Peatland | GAILPGDHVRVDRDGTKEAMRFERVPSKSPAAAATR |
Ga0187771_118014932 | 3300018088 | Tropical Peatland | ALQILEGAILPGDRVRVERDGKKDAMRFERVPAKAPAAAATTK |
Ga0066669_104037682 | 3300018482 | Grasslands Soil | LEGKVLPGDHIRVDRDGSKDAMRFERAVPKKKQPAVAAGI |
Ga0066669_110804052 | 3300018482 | Grasslands Soil | EGTVLPGDHVRVDRDGQKDAMKFVRVPSKQPAAAARI |
Ga0181514_13812792 | 3300019268 | Peatland | ALQILEGKVLPGDHIKVDRDGRKDAMRFERFKAKQPAAAARI |
Ga0193724_10391502 | 3300020062 | Soil | KVLPGDRIRVDRDGKKDAMRFERTASQKTEKQPATAAGI |
Ga0179594_100417333 | 3300020170 | Vadose Zone Soil | PLALQILEGKILPGDRVRVDRDGQKEMMRFERVPAKQPAAAARI |
Ga0210407_108284632 | 3300020579 | Soil | QDPLALQILEGKVLPGDRVRVDRDGQKESMRFERVTAKQPAAAGKK |
Ga0210403_105229132 | 3300020580 | Soil | AMQILEGKVLPGDHVRVDRDGRKDAMRFEPMAAQKTDKQPAAAAGI |
Ga0210403_110828721 | 3300020580 | Soil | QGTVLPGDHVRVDRDGQKDAMRFERAPSKQPAAAARI |
Ga0210403_112984351 | 3300020580 | Soil | VQDTLALQILEGKVLPGDHVRVDRDGQSDSMRFERVQAKKQAAA |
Ga0210399_103501581 | 3300020581 | Soil | DPLALQSLEGRVLPGDHVRVDRDGQKDAMRFERTPAKQPAAAAGI |
Ga0210399_107576601 | 3300020581 | Soil | LAMQILQGTVLPGDHVRVDRDGQKDAMRFERAPSKQPAAAARI |
Ga0210399_110263482 | 3300020581 | Soil | QILEGKMLPGDHIRVDRDGQKDAMKFERKAVKQPAAAAGI |
Ga0210395_101923043 | 3300020582 | Soil | MIQDPLAMQILEGKVLPGEHIRVDRDGKKEAMKFESVAAKKPAAAAVTS |
Ga0210401_109849752 | 3300020583 | Soil | LNGTILPGDHIRVDRDGKKDAMKFERVPAKKPAAAAKTS |
Ga0210404_103020291 | 3300021088 | Soil | LALQILEGKVLPGDHVRVDRDGQKDAMRFERAPSKRPAAAAGI |
Ga0210404_106024391 | 3300021088 | Soil | QSTILPGDHVRVDRDAQKEAMRFERVPAKKPATAAGI |
Ga0210406_111282682 | 3300021168 | Soil | EGKVLPGEHLIVDRDSQKEAMRFERAKAKQPASAARM |
Ga0210405_100661014 | 3300021171 | Soil | QGTVLPGDHLRVDRDGQKDAMRFERANRKQPASAARI |
Ga0210408_107423841 | 3300021178 | Soil | LDGKVLPGDHIRVDRDGKSDSVRFERVQAKKPATAA |
Ga0210408_113855272 | 3300021178 | Soil | QILDGKVLPGDHIRVDRDGKSDSMRFERVQAKKKPAAA |
Ga0210397_108827502 | 3300021403 | Soil | QDPLAMQILEGKVLPGDHIRVDRDGQKDTMRFERAKAKQPAAAAGV |
Ga0210397_112106242 | 3300021403 | Soil | PLALQILEGKVLPADRVRVDRDGQKETMRFERVTVKQPAAAGKK |
Ga0210397_114769082 | 3300021403 | Soil | MIQDPLSMQILEGKVLPGDQVRVDRDGQKDAMRFERVAKAKPVAAAVTQ |
Ga0210397_116044602 | 3300021403 | Soil | IQDPLAMQILEGAILPGDHVKVHRDAKKDAMRFERVESKKPAAAAKG |
Ga0210387_104993171 | 3300021405 | Soil | DPLAMQILEGRVLPGDQVRVDRDGQKNAMRFERVAKAKPVAAAVTQ |
Ga0210387_106323811 | 3300021405 | Soil | GKVLPGDHIRVDRDGNKDAMKFERAAAKKTEKQPAAAAGI |
Ga0210383_105171521 | 3300021407 | Soil | EGKVLPGDHIRVERDGQKDTMRFERAKAKQPAAAAGV |
Ga0210394_101348114 | 3300021420 | Soil | ILQGSVLPGDHVRVDRDGQKDVMRFERVNRKQPASAARI |
Ga0210390_107306532 | 3300021474 | Soil | MQILEGKVLPGEHIRVDRDGKKEAMKFESVAAKKPVAAAVTS |
Ga0210392_113501312 | 3300021475 | Soil | ALRILEGTVLPGDHIAVDRDGQKDTMTFERSAVRKPAAAATK |
Ga0187846_101938782 | 3300021476 | Biofilm | GVLPGDHVVVDREGTKEAMRFERAKPKQPAAAARI |
Ga0210402_105784802 | 3300021478 | Soil | MQILQATVLPGDHVRVDRDGQKDAMRFERAPSKQPAAAARI |
Ga0210402_110808601 | 3300021478 | Soil | IQDPLAMQILEGKVLPGDRVRVDRDGQKESMRFERVTAKQPAVAAKK |
Ga0210410_113098321 | 3300021479 | Soil | ALQILEGKVLPGDHVRVDRDGQKDAMKFVRTASKQPAAAAGI |
Ga0210409_102011752 | 3300021559 | Soil | LAMQILEGKVLPGDHLRVDRDGQKGAMRFERSKAKQPAAAAGT |
Ga0224551_10058381 | 3300023259 | Soil | PLAMQILDGKILPGDRVKVDRDGKTEGMRFERVKPSTPKSAVAST |
Ga0247695_10351782 | 3300024179 | Soil | ILEGKVLPGDHVLVGRDGKNEAMRFERLPAKQPAAAARI |
Ga0137417_11825331 | 3300024330 | Vadose Zone Soil | GKVLPGDHVRVDRDGQKDIMRFERTPAKQPAAAAGS |
Ga0208819_10108674 | 3300025498 | Peatland | VQDPLAMQILEGAILPGDHVRVDRDGPKDAMRFERVLAKAPATAARK |
Ga0207710_105540401 | 3300025900 | Switchgrass Rhizosphere | ILPGDHVKVDRDGKNDAMRFERLNAPSERRQPAAAAGI |
Ga0209863_100312361 | 3300026281 | Prmafrost Soil | DPLAMQILEGKVLPGEHVRVDRDASGDKMKFEHAAGKQPAAAAGI |
Ga0209438_12084672 | 3300026285 | Grasslands Soil | LALQILDGKVLPGDHIRVDRDGKSDSMRFERVQASKPAAAA |
Ga0209154_10230534 | 3300026317 | Soil | DPLALQILEGQVLPGDHVRVDRDGQKDVMRFERAPAKQPAAAAGI |
Ga0209154_13095201 | 3300026317 | Soil | TVLPGDHVRVDRDGQKDVMKFIRVPSKQPAAAARI |
Ga0209802_10783643 | 3300026328 | Soil | PFARRDHVRADRDGQKDAMRFARVPSKQPAAAAGI |
Ga0209473_13037231 | 3300026330 | Soil | GTVLPGDHVRVDRDGQKDAMKFVRARSKQPAAAAGI |
Ga0257146_10578462 | 3300026374 | Soil | QILEGKVLPGDHIRVGRDGKKDTMRFERTASQKTEKQPATAARI |
Ga0179593_10808011 | 3300026555 | Vadose Zone Soil | ALQILEGRVLPGDRVIVDRDGQKEAMRFERVAAKLPAAAAKK |
Ga0179587_105021031 | 3300026557 | Vadose Zone Soil | QILEGRVLPGDHVRVDRDGQKDAMRFERAPSKQPAAAAGI |
Ga0209729_10011503 | 3300027061 | Forest Soil | MVGPWGIQDRLALQILEGKVLPGDHVTVDRDGQKDAVRFERKPAKQPAAAARI |
Ga0208366_10273872 | 3300027073 | Forest Soil | LAMQILEGTVLPGDHVRVDRDAKKDAMRFERVPPKQPAAAARI |
Ga0207983_10261921 | 3300027310 | Soil | PLALQILEGRVLPGDHVQVDRDGKRDAMKFERVPAKQPAAAARI |
Ga0208983_10376082 | 3300027381 | Forest Soil | QILQGTVLPGDHVRVDRDGQKDAMRFERAPSKRPAAAAGI |
Ga0209419_11078282 | 3300027537 | Forest Soil | QILEGKVLPGDRIRVDRDGQKDAMRFERVQSKKPAAA |
Ga0208984_11471452 | 3300027546 | Forest Soil | KLDGKVLPGDHIRVDRDGKSDSMRFERVQASKPAAAA |
Ga0209220_10667382 | 3300027587 | Forest Soil | LALQILDGKVLPGDHIRVDRDGKSDSVRFERVQAKKPATAA |
Ga0209076_10972481 | 3300027643 | Vadose Zone Soil | DPLALQILEGKVLPGDYVRVDRDGQKDAMKFERVPAKQPAAAAGI |
Ga0209248_100678971 | 3300027729 | Bog Forest Soil | DPLAMQILEGKVLPGDHIRVDRNGQKDTMRFERAKAKQPAAAAGI |
Ga0209139_101140291 | 3300027795 | Bog Forest Soil | QDPLAMQILEGKVLPGDLVRVDRDGQKDAIRFERVAKAKPVAAAVTQ |
Ga0209773_101954482 | 3300027829 | Bog Forest Soil | MQILEGAILPGDHVKVHRDAKKEEMRFERMAPKQPAAAAKG |
Ga0209166_102470882 | 3300027857 | Surface Soil | ARRAALQILEGKVLPGDRVLVDRDGKSQAMRFERLPAKQPAAAARI |
Ga0209590_105962881 | 3300027882 | Vadose Zone Soil | ALQILQGTVLPGDHVRVDRDGQKDAMKFVRAPSKQPAAAAGI |
Ga0209006_115139361 | 3300027908 | Forest Soil | ILEGVVLPGDRITVDRDGQKDTMTFERSAVRKPAAATAK |
Ga0222749_100208864 | 3300029636 | Soil | LAMQILQGTVLPSDHVRVDRDGQKDAMRFERVPSKQPAAAARI |
Ga0265762_11213172 | 3300030760 | Soil | AMQILEGKVLPGDHIRVDREGQKDTMRFERAKAKQPAAAAGV |
Ga0075371_116664441 | 3300030974 | Soil | LDGKVLPGDHVRVDRDGKSDSMRFERVQAKKPATAT |
Ga0170820_167279621 | 3300031446 | Forest Soil | LEFLEGKVLPGEHVRVDRDGKKEAMKFESVAASKPAAAAITS |
Ga0170819_129284092 | 3300031469 | Forest Soil | EGKVLPGDHIRVDRDGKKDAMRFERTPSQKAEKQPAAAAGI |
Ga0318538_101865301 | 3300031546 | Soil | VLPGDQIRVDRDGQKDAMRFERVPAKKPAAAAKKG |
Ga0310686_1168120302 | 3300031708 | Soil | MQILEGKVLPGDHIRVDRDGQKDTMRFERAKAKQPAAAAGV |
Ga0307469_106450152 | 3300031720 | Hardwood Forest Soil | LEGKVLPGDHVRVDRDGQKDAMKFERLKTKQTAAAAGIQ |
Ga0307469_122569021 | 3300031720 | Hardwood Forest Soil | DPLAMQILQGTVLPGDHVRVDRDGQKDAMRFERAPSKQPAAAARI |
Ga0318500_107411901 | 3300031724 | Soil | QDPLAMQILEGAILPGDHVRVDRDGNKDAMRFERVQPKKPAAAATK |
Ga0307475_105720561 | 3300031754 | Hardwood Forest Soil | ILEGKVLPGDHVRVDRDGQKDAMKFERSKTKQPAAAAGI |
Ga0307475_112369982 | 3300031754 | Hardwood Forest Soil | TVLPGDQVRVDRDGQKDAMKFERSPAKQPVAAAGI |
Ga0318521_109479501 | 3300031770 | Soil | VQDPLAMQILEGAILPGDHVPVHRDGSKDAMRFERVQPKKPAAAATK |
Ga0318546_100934251 | 3300031771 | Soil | LGGAVLPGDRVRVDRDGSKDAMRFERVQPKKPAVAATK |
Ga0318546_110889892 | 3300031771 | Soil | LQGKVLPGDHVRVDRDGTNDAMRFERLAPAKGRKQPAAAAGI |
Ga0318552_106144072 | 3300031782 | Soil | KVLPGDHVIVDRDGQKDAVRFERKPSKQPAAAARI |
Ga0307473_111069892 | 3300031820 | Hardwood Forest Soil | ATILPGDHIRVDRDGKKDAMKFEPVPAKKPAVAAKTS |
Ga0307478_103819152 | 3300031823 | Hardwood Forest Soil | DPLALQILEGAVLPGDHVRVDRDGQKDAMRFERVPAKRPASAARI |
Ga0310917_104936401 | 3300031833 | Soil | EGAVLPGDHVRVDRDGHKDAMRFERVPARKPAVAAKK |
Ga0306919_100222095 | 3300031879 | Soil | AMHILEGAILPGDHVRVDRDGNKDAVRFERVQPKKPAAAATK |
Ga0306925_100168841 | 3300031890 | Soil | ILEGKVLPGDHVIVDRDGQKDAVRFERKPSKQPAAAARI |
Ga0318536_105015692 | 3300031893 | Soil | IQDPLALEILEGKILPGDHVRVDRDGKNDSMRFERSGAHGRRQPAAAAGI |
Ga0310916_103017481 | 3300031942 | Soil | ILEGAVLPGDHVRVYRDGSKDAMRFERVQPKKPAAAATK |
Ga0310913_105235221 | 3300031945 | Soil | DPLAMQILEGAILPGDHVRVDRDGNKDAMRFERVQPKKPAAAATK |
Ga0307479_110959151 | 3300031962 | Hardwood Forest Soil | ALQILEGKVLPGDHVRVDRDGKSDSMRFERVQAKRPAAA |
Ga0318558_103815562 | 3300032044 | Soil | IQRLVQDPLAMQILEGAILPGDHVPVHRDGSKDAMRFERVQPKKPAAAATK |
Ga0318506_102858591 | 3300032052 | Soil | LEGKVLPGDHVIVDRDGQKDAVRFERKPSKQPAAAARI |
Ga0307471_1000254286 | 3300032180 | Hardwood Forest Soil | ILQATVLPGDHVRVDRDGQKDAMRFERAPSKQPAAAARI |
Ga0307471_1009407712 | 3300032180 | Hardwood Forest Soil | LQGTVLPGDHVRVDRDGQKDAMKFVRAPLKQPVAAAGI |
Ga0307471_1016702981 | 3300032180 | Hardwood Forest Soil | LQILEGKVLPGDRVRVDRDGQKEAMRFERVTAKQPAAAGKK |
Ga0307471_1025208492 | 3300032180 | Hardwood Forest Soil | DPLAMQILEGKILPGDHVRVDRDGKKDTMGFERVPAKQPAAAARI |
Ga0307471_1034051212 | 3300032180 | Hardwood Forest Soil | AMQILEGKVLPGDHIRVDRDGQKDAMRFERSKAKQPAAAARV |
Ga0307472_1013571491 | 3300032205 | Hardwood Forest Soil | DPLAMQILQGTILPGDHVRVDRDGKKDAMRFERAPAKKPAAATQSGG |
Ga0307472_1017719841 | 3300032205 | Hardwood Forest Soil | EGKVLPGDRVRVDRDGQKVAMRFERVTAKQPAAAGKK |
Ga0307472_1020548041 | 3300032205 | Hardwood Forest Soil | LALQILEGKVLPGDHVIADRDGQRDVMRFERKPAKQPAAAARI |
Ga0306920_1015419651 | 3300032261 | Soil | ALEIVEGKFLPGDIVSVDRDGRRDVIRFEREERKQPAAAARI |
Ga0307510_104310272 | 3300033180 | Ectomycorrhiza | LALQILEGKVLPGDRIKVDRDGGKDFMRFERIAAQKQEKQPAAAAGI |
Ga0310914_102840631 | 3300033289 | Soil | ILEGAVLPGDRVRVDRDGSKDAMRFERVQPKKPAVAATK |
Ga0314863_136791_7_132 | 3300033804 | Peatland | MQILEGAVLPGDHVRVDRDGQKDVMRFERVPAKAPAAAARK |
Ga0314867_013639_1797_1913 | 3300033808 | Peatland | LDGAILPGDHVVVDRDGEKDAMRFERKTAKPAVTAARG |
Ga0314861_0351330_503_628 | 3300033977 | Peatland | MQILEGEVLPGDHVHVERDAKKDAIRFERQPAKKPEVVATK |
⦗Top⦘ |