NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F022421

Metagenome / Metatranscriptome Family F022421

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F022421
Family Type Metagenome / Metatranscriptome
Number of Sequences 214
Average Sequence Length 78 residues
Representative Sequence LKFHDGANVLLADKTEAGWYYVPDRGFDIETNTRHGEFNPEHVHHNYLHTDVYEKSRKLRGVEGANHGQFLPKG
Number of Associated Samples 183
Number of Associated Scaffolds 214

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 45.28 %
% of genes near scaffold ends (potentially truncated) 26.64 %
% of genes from short scaffolds (< 2000 bps) 99.07 %
Associated GOLD sequencing projects 175
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.729 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(12.149 % of family members)
Environment Ontology (ENVO) Unclassified
(37.850 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(40.187 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.75%    β-sheet: 19.61%    Coil/Unstructured: 67.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 214 Family Scaffolds
PF00561Abhydrolase_1 4.21
PF04042DNA_pol_E_B 0.47

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 214 Family Scaffolds
COG1311Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit BReplication, recombination and repair [L] 0.47


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002024|MIS_1005918All Organisms → Viruses → Predicted Viral1471Open in IMG/M
3300002447|JGI24768J34885_10215703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea646Open in IMG/M
3300003413|JGI25922J50271_10029173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1328Open in IMG/M
3300004112|Ga0065166_10038001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1539Open in IMG/M
3300004112|Ga0065166_10052897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1355Open in IMG/M
3300004463|Ga0063356_101228321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1090Open in IMG/M
3300004764|Ga0007754_1082397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300004772|Ga0007791_10227120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300004777|Ga0007827_10079343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300004784|Ga0007744_1242012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300004789|Ga0007752_10932801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300004792|Ga0007761_10958800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea754Open in IMG/M
3300004793|Ga0007760_11310789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300004794|Ga0007751_11385871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1278Open in IMG/M
3300004796|Ga0007763_10710224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300004802|Ga0007801_10046779All Organisms → Viruses → Predicted Viral1292Open in IMG/M
3300005043|Ga0071100_1093851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300005069|Ga0071350_1029687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1442Open in IMG/M
3300005961|Ga0075157_10138773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea977Open in IMG/M
3300005987|Ga0075158_10121085All Organisms → Viruses → Predicted Viral1514Open in IMG/M
3300005988|Ga0075160_10299106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea878Open in IMG/M
3300006033|Ga0075012_10360723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea970Open in IMG/M
3300006105|Ga0007819_1122185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila506Open in IMG/M
3300006106|Ga0007833_1037528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila903Open in IMG/M
3300006121|Ga0007824_1018362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1418Open in IMG/M
3300006128|Ga0007828_1019448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1429Open in IMG/M
3300006357|Ga0075502_1715395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1136Open in IMG/M
3300006392|Ga0075507_1564995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1302Open in IMG/M
3300006641|Ga0075471_10289576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea835Open in IMG/M
3300006803|Ga0075467_10153637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1319Open in IMG/M
3300006803|Ga0075467_10301065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum854Open in IMG/M
3300006875|Ga0075473_10167725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea884Open in IMG/M
3300007230|Ga0075179_1325918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300007231|Ga0075469_10159901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea611Open in IMG/M
3300007545|Ga0102873_1047332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1318Open in IMG/M
3300007552|Ga0102818_1093042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300008108|Ga0114341_10140584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1415Open in IMG/M
3300008111|Ga0114344_1080336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1210Open in IMG/M
3300008116|Ga0114350_1074580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1146Open in IMG/M
3300008119|Ga0114354_1083502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1297Open in IMG/M
3300008119|Ga0114354_1093395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1204Open in IMG/M
3300009003|Ga0102813_1046928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1481Open in IMG/M
3300009068|Ga0114973_10416162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300009071|Ga0115566_10581425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300009154|Ga0114963_10620650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300009182|Ga0114959_10235502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea934Open in IMG/M
3300009263|Ga0103872_1021654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum791Open in IMG/M
3300009265|Ga0103873_1062646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum731Open in IMG/M
3300009347|Ga0115920_1385673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea835Open in IMG/M
3300009422|Ga0114998_10528968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300009432|Ga0115005_11340566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300009434|Ga0115562_1073031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1432Open in IMG/M
3300009442|Ga0115563_1364287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300009476|Ga0115555_1304132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300009526|Ga0115004_10165460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1333Open in IMG/M
3300009538|Ga0129287_10078494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1394Open in IMG/M
3300009543|Ga0115099_10243608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300009592|Ga0115101_1625662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1298Open in IMG/M
3300009592|Ga0115101_1629900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300009606|Ga0115102_10239646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum971Open in IMG/M
3300009705|Ga0115000_10910246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300010299|Ga0129342_1197688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300010392|Ga0118731_100189362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1291Open in IMG/M
3300010885|Ga0133913_11623208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1630Open in IMG/M
3300010885|Ga0133913_11904142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1482Open in IMG/M
3300012504|Ga0129347_1073039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1344Open in IMG/M
3300012504|Ga0129347_1111833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300012756|Ga0138272_1199125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea807Open in IMG/M
3300012943|Ga0164241_10506551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea869Open in IMG/M
3300012952|Ga0163180_10326829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1098Open in IMG/M
3300012953|Ga0163179_11549897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300012954|Ga0163111_12680708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300012962|Ga0129335_1018343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300013004|Ga0164293_10210758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1396Open in IMG/M
3300013087|Ga0163212_1289741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300013115|Ga0171651_1060060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1208Open in IMG/M
3300013233|Ga0172420_10329439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1145Open in IMG/M
3300013295|Ga0170791_10187039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300013295|Ga0170791_11392335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1314Open in IMG/M
3300013295|Ga0170791_15757133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea957Open in IMG/M
3300013296|Ga0157374_12230786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300016743|Ga0182083_1835263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300016776|Ga0182046_1226930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300017262|Ga0186220_108485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1244Open in IMG/M
3300017957|Ga0181571_10206007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1272Open in IMG/M
3300018418|Ga0181567_10202066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1360Open in IMG/M
3300018622|Ga0188862_1004919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1075Open in IMG/M
3300018684|Ga0192983_1012779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1047Open in IMG/M
3300018692|Ga0192944_1007349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1324Open in IMG/M
3300018741|Ga0193534_1037822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea747Open in IMG/M
3300018758|Ga0193058_1079299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300018831|Ga0192949_1050086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum849Open in IMG/M
3300018846|Ga0193253_1103239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300018873|Ga0193553_1075243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea903Open in IMG/M
3300018873|Ga0193553_1083031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea846Open in IMG/M
3300018926|Ga0192989_10063973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum946Open in IMG/M
3300018989|Ga0193030_10083499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea950Open in IMG/M
3300018989|Ga0193030_10315624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300019017|Ga0193569_10238513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea786Open in IMG/M
3300019021|Ga0192982_10157866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum796Open in IMG/M
3300019050|Ga0192966_10104347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum977Open in IMG/M
3300019149|Ga0188870_10100758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea693Open in IMG/M
3300019153|Ga0192975_10114591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum982Open in IMG/M
3300019153|Ga0192975_10138894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea883Open in IMG/M
3300019266|Ga0182061_1295925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300019266|Ga0182061_1308052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1129Open in IMG/M
3300019280|Ga0182068_1177258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1292Open in IMG/M
3300019459|Ga0181562_10136674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1348Open in IMG/M
3300020014|Ga0182044_1287456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300020147|Ga0196976_1040198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1027Open in IMG/M
3300020161|Ga0211726_10153276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1444Open in IMG/M
3300020183|Ga0194115_10132508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1328Open in IMG/M
3300020190|Ga0194118_10309719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea839Open in IMG/M
3300020205|Ga0211731_10236355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1488Open in IMG/M
3300020214|Ga0194132_10241748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea991Open in IMG/M
3300020221|Ga0194127_10289049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1112Open in IMG/M
3300020529|Ga0208233_1013671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1121Open in IMG/M
3300021091|Ga0194133_10222480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1231Open in IMG/M
3300021359|Ga0206689_10054943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea570Open in IMG/M
3300021910|Ga0063100_1114900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300021940|Ga0063108_1020586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1262Open in IMG/M
3300021964|Ga0222719_10673881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300022752|Ga0214917_10387757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300024343|Ga0244777_10400802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum854Open in IMG/M
3300024346|Ga0244775_11274849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea570Open in IMG/M
3300024346|Ga0244775_11463956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300025417|Ga0208616_1010057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1577Open in IMG/M
3300025451|Ga0208426_1011590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1279Open in IMG/M
3300025680|Ga0209306_1043939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1461Open in IMG/M
3300025809|Ga0209199_1231105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300025848|Ga0208005_1163274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea694Open in IMG/M
3300025869|Ga0209308_10272008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300025879|Ga0209555_10089796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1332Open in IMG/M
3300025887|Ga0208544_10096493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1340Open in IMG/M
3300026513|Ga0247590_1105840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300027192|Ga0208673_1065301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300027571|Ga0208897_1046819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1157Open in IMG/M
3300027720|Ga0209617_10079628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1340Open in IMG/M
3300027749|Ga0209084_1149025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum982Open in IMG/M
3300027771|Ga0209279_10042717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1299Open in IMG/M
3300027781|Ga0209175_10095698All Organisms → Viruses → Predicted Viral1274Open in IMG/M
3300027781|Ga0209175_10138878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1043Open in IMG/M
3300027789|Ga0209174_10204608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea886Open in IMG/M
3300027791|Ga0209830_10400286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300027849|Ga0209712_10609898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea606Open in IMG/M
3300027851|Ga0209066_10240795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1050Open in IMG/M
3300027885|Ga0209450_10716869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea726Open in IMG/M
3300027899|Ga0209668_10132944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1490Open in IMG/M
3300028134|Ga0256411_1195363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea642Open in IMG/M
3300028290|Ga0247572_1150687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300030539|Ga0210281_1513533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300030591|Ga0247626_1119796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea689Open in IMG/M
3300030608|Ga0247651_10218535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea593Open in IMG/M
3300030609|Ga0247634_10523839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300030625|Ga0210259_11924489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300030699|Ga0307398_10211437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1031Open in IMG/M
3300030702|Ga0307399_10096944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1235Open in IMG/M
3300030738|Ga0265462_12683116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300030741|Ga0265459_10857059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea919Open in IMG/M
3300030741|Ga0265459_12048914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300030741|Ga0265459_12784599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300030743|Ga0265461_13815174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300030775|Ga0074021_1388433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea594Open in IMG/M
3300030778|Ga0075398_11564673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea522Open in IMG/M
3300030840|Ga0074020_10068357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea989Open in IMG/M
3300030840|Ga0074020_11067108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea692Open in IMG/M
3300031002|Ga0074014_1030107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea523Open in IMG/M
3300031034|Ga0074041_11040518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300031231|Ga0170824_101995213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300031231|Ga0170824_104034172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
3300031231|Ga0170824_107086519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea613Open in IMG/M
3300031469|Ga0170819_12175929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
3300031522|Ga0307388_10770007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300031522|Ga0307388_11193738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300031569|Ga0307489_10128567All Organisms → Viruses → Predicted Viral1497Open in IMG/M
3300031569|Ga0307489_10134976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1466Open in IMG/M
3300031569|Ga0307489_10953386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300031602|Ga0307993_1028497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1398Open in IMG/M
3300031602|Ga0307993_1127999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300031622|Ga0302126_10229238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300031638|Ga0302125_10175860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300031710|Ga0307386_10106315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1239Open in IMG/M
3300031710|Ga0307386_10656348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300031710|Ga0307386_10685645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300031717|Ga0307396_10121274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1202Open in IMG/M
3300031725|Ga0307381_10170478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea752Open in IMG/M
3300031725|Ga0307381_10318013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300031729|Ga0307391_10113129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1325Open in IMG/M
3300031729|Ga0307391_10160694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1151Open in IMG/M
3300031734|Ga0307397_10099580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1194Open in IMG/M
3300031734|Ga0307397_10621393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea507Open in IMG/M
3300031737|Ga0307387_10150266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1280Open in IMG/M
3300031739|Ga0307383_10280149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum803Open in IMG/M
3300031758|Ga0315907_10696519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300031784|Ga0315899_10705271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea937Open in IMG/M
3300032463|Ga0314684_10152534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1239Open in IMG/M
3300032481|Ga0314668_10140533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1188Open in IMG/M
3300032491|Ga0314675_10111754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1249Open in IMG/M
3300032517|Ga0314688_10419179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300032522|Ga0314677_10315074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum829Open in IMG/M
3300032708|Ga0314669_10332304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea822Open in IMG/M
3300032708|Ga0314669_10690072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300032714|Ga0314686_10633323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300032727|Ga0314693_10145751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1162Open in IMG/M
3300032752|Ga0314700_10137996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1200Open in IMG/M
3300032756|Ga0315742_11691578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea689Open in IMG/M
3300032756|Ga0315742_12237812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea617Open in IMG/M
3300032756|Ga0315742_12714987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea568Open in IMG/M
3300033981|Ga0334982_0550376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300033984|Ga0334989_0513471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300034018|Ga0334985_0626480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300034105|Ga0335035_0221200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1155Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.15%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.48%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.54%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.61%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.21%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.21%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.27%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.27%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.27%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent3.27%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.34%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.34%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.34%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.40%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.40%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.40%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.40%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.93%
WatershedsEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.93%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.47%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.47%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.47%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater0.47%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.47%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.47%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.47%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.47%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.47%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.47%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.47%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine0.47%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.47%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.47%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.47%
Swimming Pool Sandfilter BackwashEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash0.47%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002024Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5kEnvironmentalOpen in IMG/M
3300002447Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion MetagenomeEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004764Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004772Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5MEnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004784Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005961Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNAEngineeredOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006033Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15EnvironmentalOpen in IMG/M
3300006105Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09EnvironmentalOpen in IMG/M
3300006106Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07EnvironmentalOpen in IMG/M
3300006121Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08EnvironmentalOpen in IMG/M
3300006128Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007230Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009347Microbial communities from sand-filter backwash in Singapore swimming pools - JW-1EngineeredOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013115Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300013233Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300016743Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017262Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)Host-AssociatedOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020147Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13CEnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020214Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020529Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025417Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027789Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027851Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031002Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MIS_100591813300002024Sinkhole FreshwaterMYRWLRWSDGANVLLADKSEAGWFFVPDRGFDTITNTTHGEYTPEHVHHNYLYTDEYEKSRKQRGKDGANHG*
JGI24768J34885_1021570323300002447Freshwater And SedimentMLADKSEAGWVYIPDRGWDVNATGEHTPEHVHHNYLHSDAYXQSRKARGVEGASHGQFLERNKFGK*
JGI25922J50271_1002917313300003413Freshwater LakeMLADKSEAGWYFVPDRGFDTVTNTTHGEYTPEHVHHNYLYTDAYEKSRAARGKEGA
Ga0065166_1003800113300004112Freshwater LakeMLADKSEAGWYFVPDRGFDTVTNTTHGEYTPEHVHHNYLYTDAYEKSRAARGKEGASHGQFLPVGQFSPKDKWF*
Ga0065166_1005289713300004112Freshwater LakeMLADKSEAGWYFVPDRGFDKVTNTFHGEYTPEHVHHNYLYTDAYEKSRAARGKEGASHGQFLPVGQFSPKDKWF*
Ga0063356_10122832113300004463Arabidopsis Thaliana RhizosphereMSRWLRWHDGANLLLADKSEAGWYYVPDRGFDTVTNTTHGEYTPEHVHHNYLYTDVYEESRKARGKEGANHGQFLPVGQFSPKDKWM*
Ga0007754_108239713300004764Freshwater LakeLKYHDGTSALLADKTEAGWYYVPDRGFDIETNTRHGEYIPEHVHHNYLYSDVYEKSRKLRGVEGANHGQFLPKGKFSDESKW*
Ga0007791_1022712013300004772FreshwaterLRYHDGKNILLADKTEAGWYYVPDRGFDIETNTRHGEYVPEHVHHNYLYSDVYEKSRKLRNVEGANHGQFLPKGKFSDESKW*
Ga0007827_1007934313300004777FreshwaterLRYHDGKNVLLADKTEAGWYYVPDRGFDIETNTRHGEYVPEHVHHNYLYSDVYEKSRKLRNVEGANHGQFLPKGKFSDESKW*
Ga0007744_124201223300004784Freshwater LakeLRWNDGTNLMLADKSEAGWVYIPDRGWDVNATGEHTPEHVHHNYLHSDAYIQSRKARGVEGASHGQFLERNKFGK*
Ga0007752_1093280113300004789Freshwater LakeLKYHDGTNALLSDKTEAGWYYVPDRGFDIETNTRHGEFIPEHVHHNYLYSDVYEKSRKLRGVEGANHG
Ga0007761_1095880023300004792Freshwater LakeVHHISNKMWRWLRWNDGTNLMLADKSEAGWVYIPDRGWDVNATGEHTPEHVHHNYLHSDAYIQSRKARGVEGASH
Ga0007760_1131078923300004793Freshwater LakeMTHWIHEEPSDQVHHISNKMWRWLRWNDGTNLMLADKSEAGWVYIPDRGWDVNATGEHTPEHVHHNYLHSDAYIQSRKARGVEGASHGQFL
Ga0007751_1138587123300004794Freshwater LakeHVWHLSQQIWRWLKYHDGTNALLSDKTEAGWYYVPDRGFDIETNTRHGEFIPEHVHHNYLYSDVYEKSRKLRGVEGANHGQFLPKGKFSDESKW*
Ga0007763_1071022413300004796Freshwater LakeMLADKSEAGWVYIPDRGWDVNATGEHTPEHVHHNYLHSDAYNQSRKARGVEGASHGQFLERNKF
Ga0007801_1004677913300004802FreshwaterLADKSEAGWLYVPDRGFDTVTNTTHGEYTPEHVHHNYLYSDAYEQSRKTRGKEGAAHGQFLPVGQFSPKDKWF*
Ga0071100_109385113300005043Marine Subseafloor AquiferMHEGPDKETVWHLSQQLWRWLKWHDGCNVMLADKSEAGWHYIPDRGFDVECNTRHGEFIPEHVHHNYLHSDVYQQSRDARQVEGASSG*
Ga0071350_102968743300005069FreshwaterVLLADKSEAGWYFVPDRGVDPNTGTRHGEYNPEHVHHNYLYTNEYVNSRKARGKDGAAPG
Ga0075157_1013877313300005961Wastewater EffluentMARFLRWNDGANLLLADKSEAGWYFVPDRGFDTITNTTHGEYTPEHVHHNYLYTKEYELSRERRGKEGAAHGQFLPVGQFSPKDKWF*
Ga0075158_1012108513300005987Wastewater EffluentMQRFLRWNDGAHVMLADKSEAGWYYVPDRGFDTITNTIHGEYTPEHVHHNYLYTKEYEKSRERRGKEGAGHGQFLPVG*
Ga0075160_1029910613300005988Wastewater EffluentVLLADKSEAGWFNIPDRGFDTNTNTRQGEYTPEHVHHNYLHTNAYVESRKARGKEGAAHGEFLQVGKFAPEDKWL*
Ga0075012_1036072343300006033WatershedsMARWLRWNDGAHVLLADKSEAGWYFLPDRGFDTVTNTTHGEYTPEHVHHNYLYTDEYERSRQQRGKE
Ga0007819_112218513300006105FreshwaterLRYHDGKNILLADKTEAGWYYVPDRGFDIETNTRHGEYVPEHVHHNYLYSDVYEKSRKLRNVEGANHGQFLPKGKFSDESKW*LIYLFFIKDCVIFNLK*
Ga0007833_103752813300006106FreshwaterLRYHDGKNILLADKTEAGWYYVPDRGFDIETNTRHGEYVPEHVHHNYLYSDVYEKSRKLRNVEGANHGQFLPKGKFSDESKW*LIYSFFIKDCVIFNLK*
Ga0007824_101836243300006121FreshwaterLRYHDGKNVLLADKTEAGWYYVPDRGFDIETNTRHGEYVPEHVHHNYLYSDVYEKSRKLRNVEGANHGQFLPKGKFSDESKW*LIYSFLIKDCVIFNLK*
Ga0007828_101944833300006128FreshwaterLRYHDGKNVLLADKTEAGWYYVPDRGFDIETNTRHGEYVPEHVHHNYLYSDVYEKSRKLRNVEGANHGQFLPKGKFSDESKW*LIYSFFIKDCVIFNLK*
Ga0075502_171539513300006357AqueousLSQRLWRWLRYHDGCNVNLADKTEAGWFYVPDRGYCAETNTRHGEYTPEHVHHNYLHTKEYEKSRERRGKEGAEHGQFLPVGKYSPEDKWF*
Ga0075507_156499513300006392AqueousLSQRLWRWLRYHDGCNVNLADKTEAGWFYVPDRGYCAETNTRHGEYTPEHVHHNYLHTKEYEKSRERRGKEGAEHGEFLPVGKYSPEDKWF*
Ga0075471_1028957633300006641AqueousMHRWLRWNDGAHVLLADKSEAGWYFLPDRGVDPNTGTRHGEYNPEHVHHNYMYTDAYVNSRKARGKEGAN
Ga0075467_1015363713300006803AqueousMWRWLRWSDGAHVLLADKSEAGWKYISDRGWDVNATGEYTPEHVHHNYLHTDAYEKSRKERGVEGAAHGQYLPRNAWSVR*
Ga0075467_1030106523300006803AqueousMWRWLKWHDGANVLLADKSEAGWHYIPDRGFDVEQNTRHGEYIPEHVHHNYLHSDVYEKSREARGVEGASPNQFLPKGQFNDETRW*
Ga0075464_1001240013300006805AqueousMTHWIHEEPSDQVHHISNKMWRWLRWNDGTNLMLADKSEAGWVYIPDRGWDVNATGEHTPEHVHHNYLHSDAYIQSRKARGVEGASHGQF
Ga0075473_1016772523300006875AqueousMHRWLRWNDGAHVLLADKSEAGWYFLPDRGVDPNTGTRHGEYNPEHVHHNYMYTDAYVNSRKARGKEGANQGQFLPVGRFSPEDKQF*
Ga0075179_132591813300007230Wastewater EffluentMQRFLRWNDGAHVMLADKSEAGWYYVPDRGFDTITNTIHGEYTPEHVHHNYLYTKEYEKSRERRGKEGAGHGQFLPVGQFSPKDKWF*
Ga0075469_1015990123300007231AqueousMYIPDRGYDLVTNTSQGEYIPEHVHHNYLYTDEYEKSRENRGKEGAAHGQFLPKGQFSPEDKW*
Ga0102873_104733233300007545EstuarineMWRWLKNHDGTNVMLADKTEAGWFYVPDRGFDVEQNTRHGEYTPEHVHHNYLHSDIYEKSRAARGKQGASPNQFLTKGQFSDESRW*
Ga0102818_109304223300007552EstuarineMARWLRWNDGTNVHLADKSEAGWYNIPDRGFDVEQNTRHGEYNPEHVHHNYLYTDVYEKSRQARGVEGAHPQQNLQKGQFSDETRW*
Ga0114341_1014058423300008108Freshwater, PlanktonLKFHDGANVLLADKTEAGWYYVPDRGFDIETNTRHGEFNPEHVHHNYLHTDVYEKSRKLRGVEGANHGQFLPKGKFSDESKW*
Ga0114344_108033613300008111Freshwater, PlanktonLKFHDGANVLLADKTEAGWYYVPDRGFDIETNTRHGEFNPEHVHHNYLHTDVYEKSRKLRGVEGANHGQFLPKGKFSDE
Ga0114350_107458013300008116Freshwater, PlanktonLKFHDGANVLLADKTEAGWYYVPDRGFDIETNTRHGEFNPEHVHHNYLHTDVYEKSRKLRGVEGANHGQFLPKG
Ga0114354_108350223300008119Freshwater, PlanktonMWRWLRWNDGTNLMLADKSEAGWVYVPDRGWDVNATGEYTPEHVHHNYLHTDAYTQSRKHRGVESAGHG*
Ga0114354_109339513300008119Freshwater, PlanktonLKWHDGANVLLADKSEAGWYYVPDRGFDIETNTRHGEYTPEHVHHNYLYSDVYEKSRKQRGVEGA
Ga0102813_104692823300009003EstuarineMWRWLKWHDGCNVLLADKTEAGWYNVPDRGFDIETNTRHGEFNPEHVHHNYLHTDAYVKSREARGVIGANNN*
Ga0114973_1041616223300009068Freshwater LakeLKYHDGTNALLADKTEAGWYYVPDRGFDIETNTRHGEFIPEHVHHNYLYSDVYEKSRKLRGVEGANHGQFLPKGKFSDESKW*
Ga0115566_1058142513300009071Pelagic MarineMWRWLKFYDGCHVLLADKTEAGWYNIPDRGPDPETNTRMGEFNPEHVHHNYLYTDAYEKSRAERGATASNAGNFLPRGQFSDESRW*
Ga0114963_1062065013300009154Freshwater LakeMYRWLRWNDGANVLLADKSEAGWMYISDRGTDANVTGEYTPEHVHHNYLHTDLYEKSRQERGKVGASHGEF
Ga0114959_1023550223300009182Freshwater LakeLADKSEAGWLYVPDRGFDTVTNTTHGEYTPEHVHHNYLYSDAYEQSRKARGKEGAAHGQFLPVGQFSPKDKWF*
Ga0103872_102165423300009263Surface Ocean WaterMWRFLKWHDGTNVMLADKSEAGWYYVPDRGFDVECNTRHGEYIPEHVHHNYLHSDVYEKSREARGVTGANPGQFLPKGQFNDESRW*
Ga0103873_106264613300009265Surface Ocean WaterMLSQRLWRWLKWHDGTNVMLADKSEAGWYYVPDRGTDNETNTRQGEFTPEHVHHNYLYSDAYQKSREARGVDGANNGQFLPRGSFSDESRW*
Ga0115920_138567313300009347Swimming Pool Sandfilter BackwashMARWLRWNDGAHVLLADKSEAGWYFLPDRGFDTVTNTTHGEYTPEHVHHNYLYTDEYERSRQQRGKEGAGHG*
Ga0114998_1052896813300009422MarineMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDVYEKSREARGEEGANVGQFLPRGTFNDEKRW*
Ga0115005_1134056613300009432MarineMAHWLRWMDGTNVMLANKSEAGWYYVPDRGFDIEANTTQGEYTPEHVHHNYLYTDAYEKSRAKRGGVEGANHGQYLPRGQFSPNEKWF*
Ga0115562_107303123300009434Pelagic MarineMLADKSEAGWYYVPDRGFDVECNTRHGEYTPEHVHHNYLHTEAYEQSRAARDVQGANPGQFLPKGQFTDESKW*
Ga0115563_136428713300009442Pelagic MarineWRWLKFYDGCHVLLADKTEAGWYNIPDRGPDPETNTRMGEFNPEHVHHNYLYTDAYEKSRAERGATASNAGNFLPRGQFSDESRW*
Ga0115555_130413223300009476Pelagic MarineMWRWLKFYDGCHVLLADKTEAGWYNIPDRGPDPETNTRMGEFNPEHVHHNYLYTDAYEKSRAERGATASNAGNFLPRGQFSDKSRW*
Ga0115571_123731713300009495Pelagic MarineMWRWLKFYDGCHVLLADKTEAGWYNIPDRGPDPETNTRMGEFNPEHVHHNYLYTDAYEKSRAERGA
Ga0115004_1016546013300009526MarineMWRWLKFYDGCHVLLADKTEAGWYNIPDRGPDPETNTRMGEFNPEHVHHNYLYTDAYEKSRAERGATASNAGNFLPRGQFNDESRW*
Ga0129287_1007849423300009538Beach Aquifer PorewaterMWRWLKWHDGCHVLLADKTETGWFYVPDRGFDVEQNTRHGEYNPEHVHHNYLYTDLYEESRKARGVEGAEPGQFLPKGKFSKNN*
Ga0115099_1024360813300009543MarineVLLADKSEAGWRYIGDRGWDVNATGEYTPEHVHHNYLHTDLYEKSRQARGVEGASHGQYLERNKWSPRQ*
Ga0115101_162566233300009592MarineMWRWLKWHDGCHVLLADKTEAGWYNISDRGVDPETNTRHGEFNPEHVHHNYLYTDVYEKSRSERGATASNSGNFLPRGQFNDESRW*
Ga0115101_162990013300009592MarineMWRWLKFYDGCHVLLADKTEAGWYNIPDRGPDPETNTRMGEFNPEHVHHNYLYTNAYEKSRAERGATASNAGNFLPRGQFSDESRW*
Ga0115102_1023964613300009606MarineVLLADKSEAGWYNLPDRGADPNIATRPGESNPEFVHHNYVHSDAYEKSRAARGVEGANQGQFLAKNSFSSKW*
Ga0115000_1091024623300009705MarineMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDVYEKSRAARGEEGAGVGQFLPRG*
Ga0129342_119768823300010299Freshwater To Marine Saline GradientMWRWLKWHDGTNVMLADKSEAGWYYVPDRGTDNETNTRQGEFTPEHVHHNYLYSDAYQKSREARGVDGANNGQFLPRGSFSDESRW*
Ga0118731_10018936213300010392MarineMHESSEDDVWHLHQRMSRWLRWKDGAHVLLADKSEAGWFNIPDRGFDVNTNTRQGEFTPEHVHHNYLHSNVYEQSRKQRGVEGANNGEFLTPGKFSPEEKWL*
Ga0133913_1162320833300010885Freshwater LakeMHRWLRWHDGCNLMLADKSEAGWYFVPDRGFDKVTNTFHGEYTPEHVHHNYLYTDAYEKSRAARGKEGASHGQFLPVGQFSPKDKWF*
Ga0133913_1190414213300010885Freshwater LakeLKYHDGTSTLLADKTEAGWYYVPDRGFDIETNTRHGEYIPEHVHHNYLYSDVYEKSRKLRGVEGANHGQFLPKGKFSDESKW*
Ga0129347_107303913300012504AqueousMWRWLRWKDGAHVLLADKSEAGWYYVPDRGYDPNTDTKNGEYVPEHVHHNYLYTDEYAKSRARRGKEAASPGQFLPQGEYTPEDKL*
Ga0129347_111183323300012504AqueousMLADKSEAGWYYVPDRGFDVECNTRHGEFTPEHVHHNYLHSDIYEKSRAARGVEGANPGQFLPKGQFSDEAKW*
Ga0138272_119912513300012756Freshwater LakeLADKSEAGWLYVPDRGFDTVTNTTHGEYTPEHVHHNYLYTDAYEQSRKARGKEGAGHGQFLPVGQFSPKDKWF*
Ga0164241_1050655123300012943SoilVNLADKSEAGWYFVPDRGFDTVTNTTHGEYTPEHVHHNYMYTDVYEKSRKDRAKEGANHGQFLPVGQFSPKDKWF*
Ga0163180_1032682943300012952SeawaterMWRWLRNHDGAHVLLADKTEAGWYYVPDRGFDVETNTRHGEYTPEHVHHNYLYTDAYTKAREARGAEGANPN*
Ga0163179_1154989723300012953SeawaterMWRWLRHKDGANVLLADKTEAGWYHLPDRGFDVECNTRQGEYNPEHVHHNYLHTDAYEKCREARGVEGANPGQFLPK
Ga0163111_1268070813300012954Surface SeawaterMLADKSEAGWYYVPDRGFDVECNTRHGEFTPEHVHHNYLHSDIYEKSRAARGVEGANP
Ga0129335_101834313300012962AqueousMWRWLKNHDGTNVMLADKTEAGWFYVPDRGFDVEQNTRHGEYTPEHVHHNYLHSDIYEKSRAARGKQGASPNQFLTK
Ga0164293_1021075813300013004FreshwaterMHKWLRWKDGCNLLLADKSEAGWYWVPDRGFDTVTNTTHGEYTPEHVHHNYLYTDAYEKSRKARGKEGASHGQFLPVGQFSPK
Ga0163212_128974123300013087FreshwaterMHRFLRWNDGCNLMLSDKSEAGWYFVPDRGFDTVTNTTHGEYTPEHVHHNYLYTDAYEKSRKARGKEG
Ga0171651_106006033300013115MarineMARWLRWKDGAHVLLADKSEAGWYFVQDRGYAPETNNTGEYTPEHVHYDYLHTNAYEKGAKERAAHGQFLPPGRWNEE*
Ga0172420_1032943923300013233MarineMHEGSQRDTWHLSQRMARWLRWKDGCHVLLADKSEAGWFNIADRGFDTNCNTRQGEYNPEHVHHNYLHTKVYEDSQKKRGVEGANQGEF
Ga0170791_1018703923300013295FreshwaterLKYHDGTNALLADKTEAGWYYVPDRGFDIETNTRHGEFIPEHVHHNYLYSDVYEKSRKLRGVE
Ga0170791_1139233513300013295FreshwaterLYVPDRGFDTVTNTTHGEYTPEHVHHNYLYTDAYEQSRKARGKEGAGHGQFLPVGQFSPKDKWF*
Ga0170791_1575713333300013295FreshwaterMYRWLRWNDGANVLLADKSEAGWMYISDRGTDANVTGEYTPEHVHHNYLHTDLYEKSRQERGKVGASHGEFLARNKFSPRQ*
Ga0157374_1223078623300013296Miscanthus RhizosphereMFRWLKWHDGKNVLLSDKSEAGWYYLPDRGFDSITNTTHGEYVPEHVHHNYMYTDAYEKSRSARGVEGANHGQYLPVGKFSPTDKW*
Ga0182083_183526313300016743Salt MarshMWRWLKWHDGTNTLLSDKSEAGWYYVPDRGYDPNIHTRHGESTPEHVHHNYLHTDVYEKSRQARGVEGSNGAFLPPNRFHDESRW
Ga0182046_122693023300016776Salt MarshMWRWLKWHDGTHVLLADKSEAGWYNIPDRGFDVEQNTRQGEYNPEHVHHNYLHSDVYEKSRAARGVEGASPNQFLQKGQFSDES
Ga0186220_10848513300017262Host-AssociatedVFYLSQKFYRWLRWQDGTHLMLADKSEAGWYFVPDRGYDLVTNTISGEYTPEHVHHNYLYTDAYEKSRQARGKEGASHGQFLPSGQFSPKDKWF
Ga0181571_1020600723300017957Salt MarshMSTWMLSQRLWRWLKWHDGTNVMLADKSEAGWYNVPDRGFDVECNTRHGEFTPEHVHHNYLHTDVYEKSREARGVQGANPG
Ga0181567_1020206613300018418Salt MarshMLSQRLWRWLKWHDGTNVMLADKSEAGWYNVPDRGFDVECNTRHGEFTPEHVHHNYLHTDVYEKSREARGVQGANPG
Ga0188862_100491913300018622Freshwater LakeMLLADKSEAGWYYVPDRGYDTNTGTRDGEYTPEHVHHDYKNTKEYAESRQRRGKEAADKGQFLPFGEFAPADKQL
Ga0192983_101277943300018684MarineMLADKSEAGWYYVPDRGFDVETNTRHGEYTPEHVHHNYLHTKQYENSRAQRGVEGANHGQHLPKG
Ga0192944_100734933300018692MarineMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDAYEKSREERGVEGAKVGEFLPRG
Ga0193534_103782213300018741MarineMHEDPEGQSWRLSQRMWRWLRWNDGANVLLADKSEAGWYFVSDRGTDSNTGTPQGEYNPEHVHHNYLYTDEYEKSREFRGKEGANPG
Ga0193058_107929913300018758MarineMHEHPAEDVKSLSNNMYRWLRWQDGTSVHLSDKSEAGWMYVNERGFDSTIGTPAGEFIPEHVHHDYLHTKAYEESRAE
Ga0192949_105008613300018831MarineMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDAYEKSREERGVEGAKVGEFL
Ga0193253_110323913300018846MarineMWRWLKWHDGCHVLLADKTEAGWYNISDRGVDPETNTRQGEFNPEHVHHNYLYTDAYEKSRTERGATASNSGNFLPRGQFNDESRW
Ga0193553_107524323300018873MarineMARWLRWNDGANVMLADKSEAGWYYVPDRGVDYETGTTHGEYTPEHVHHNYLYTKEYELSRQARGKEAAGHGQFLPVGSFSPVDRQ
Ga0193553_108303123300018873MarineMARWLRWHDGTNVMLADKSEAGWYYVPDRGVDYETGTTHGEYTPEHVHHNYLYTKEYELSRQERGKEAAGHGQFLPVGSFSPEDRQ
Ga0192989_1006397323300018926MarineVLLADKSEAGWYNLPDRGADPNIATRPGESNPEFVHHNYVHSDAYEKSRAARGVEGANQGQFLAKNSFSSKW
Ga0193030_1008349923300018989MarineMHEDPEGQSWRLSQRMWRWLRWNDGANVLLADKSEAGWYFVSDRGTDSNTGTPHGEYNPEHVHHNYLYTDEYEKSREFRGKEGANPG
Ga0193030_1031562413300018989MarineMWRWLRWHDGCHVLLADKSEAGWYNLPDRGVDPETNTRHGEFNPEHVHHNYLYTDAYEKSRAERGASGANSGGFLPRG
Ga0193569_1023851323300019017MarineLARWLRWHDGANVLLADKSEAGWYYVPDRGVDYETGTTHGEYTPEHVHHNYLYTKEYELSRQARGKEAAGHGTFLPVGQFSPEDRQ
Ga0192982_1015786613300019021MarineMLADKSEAGWYYVPDRGFDVECNTRHGEFTPEHVHHNYLHTEAYEKSRAERGVEGANPGQFLPKG
Ga0192966_1010434713300019050MarineMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDAYEKSREERGVEGANVGQFLPRG
Ga0188870_1010075813300019149Freshwater LakeMWRWLRYHDGVNVNLADKTEAGWFYVPDRGYCAETNTRHGEYTPEHVHHNYLHTKEYEQSRQRRGKEGADHGQFLPVGKYSPEDKWF
Ga0192975_1011459133300019153MarineMLADKSEAGWYYVPDRGFDVETNTRHGEYTPEHVHHNYLHTKQYENSRAQRGVEGANHGQHLPK
Ga0192975_1013889413300019153MarineVLLADKSEAGWYVLPDRGYDQNTNTRHGECNPEHVHHNYLQTDEYEKSRAFRGKEGASQGQFLPIGQFSPDDKQL
Ga0182061_129592513300019266Salt MarshMWRWLKWHDGTHVLLADKSEAGWYNIPDRGFDVEQNTRQGEYNPEHVHHNYLHSDVYEKSRAARG
Ga0182061_130805213300019266Salt MarshMLSQRLWRWLKWHDGTNVMLADKSEAGWYNVPDRGFDVECNTRHGEFTPEHVHHNYLHTDVYEKSREARGV
Ga0182068_117725813300019280Salt MarshMWRWLRYHDGCNVNLADKTEAGWFYVPDRGYCAETNTRHGEYTPEHVHHNYLHTKEYEKSRERRGKEGAEHGQFLPVGKYSPEDKWF
Ga0181562_1013667413300019459Salt MarshMWRWLKWHDGTHVLLADKSEAGWYNIPDRGFDVEQNTRQGEYNPEHVHHNYLHSDVYEKSRAARGVEGASPNQFLQKGQFSDESRW
Ga0182044_128745613300020014Salt MarshMWRWLKWHDGTHVLLADKSEAGWYNIPDRGFDVEQNTRQGEYNPEHVHHNYLHSDVYEKSRAARGVEGASPNQFLQKGQF
Ga0196976_104019813300020147SoilVWYLSQKLHRFLRWHDGTNVLLADKSEAGWYFLPDRGFDTITNTIHGEYNPEHVHHNYLYTDAYEKSRAKRGKEGAAHGQFLPTGQFSPKDKWF
Ga0211726_1015327613300020161FreshwaterVLLADKSEAGWYFVPDRGIDPNTGTKHGEYNPEHVHHNYLYTNEYVNSRKARGKDAAAPGQFLPVGQFTADDKQV
Ga0194115_1013250823300020183Freshwater LakeMLADKSEAGWVYIPDRGWDVNATGEFTPEHVHHNYLHTDAYVQSRKARGVEGASHGQFLERNKFSK
Ga0194118_1030971913300020190Freshwater LakeMLADKSEAGWVYIPDRGWDVNATGEFTPEHVHHNYLHTDAYVQSRKARGVEG
Ga0211731_1023635533300020205FreshwaterLKWHDGANVLLADKSEAGWYYVPDRGFDIETNTRHGEYTPEHVHHNYLYSDVYEKSRKQRGVEGAIHGQFIPKGKFSDESKWXFNI
Ga0194132_1024174823300020214Freshwater LakeMLADKSEAGWVYIPDRGWDVNATGEFTPEHVHHNYLHTDAYVQSRKARGVEGASHGQFLE
Ga0194127_1028904923300020221Freshwater LakeMLADKSEAGWVYIPDRGWDVNATGEFTPEHVHHNYLHTDAYVQSRKARGVEGASHGQFLERNKK
Ga0208233_101367113300020529FreshwaterMWRWLRWNDGTNLMLADKSEAGWVYVPDRGWDVNATGEYTPEHVHHNYLHTDAYTQSRKHRGVESAGHG
Ga0194133_1022248023300021091Freshwater LakeMLADKSEAGWVYIPDRGWDVNATGEFTPEHVHHNYLHTDAYVQSRKARGVEGASH
Ga0206689_1005494313300021359SeawaterMWRWLRWNDGCNRLLSDKSETGWVFVPDRGFDLETNTPHGEYTPEHVHHNYLYTDEYEKSRKARGVEGANHG
Ga0063100_111490023300021910MarineMWRWLRFYDGCNVNLADKTEAGWFYIPDRGYDTNTNTRHGEYTPEHVHHDYLNTKEYEKSRQKRGVEGAEHGQFLPVGKFSPEEKWF
Ga0063108_102058643300021940MarineMTHWMHEDPAGESWKLSQHMYRFLRWHDGANVLLADKSEAGWYVLPDRGVDYNTNTRMGETTPEHVHHNYLYTDEYEKSRQHRGKEAAAPGQFVPVGQFSPEDKW
Ga0222719_1067388113300021964Estuarine WaterMWRWLKWHDGCHVLLADKTEAGWYNIPDRGFDVEQNTRQGEYNPEHVHHNYLHSDIYEKSRAARGVEGANPNQFLQKGQFNDESRW
Ga0214917_1038775723300022752FreshwaterLKWHDGANVLLADKSEAGWYYVPDRGFDVETNTRHGEYTPEHVHHNYLYSDVYEKSRKQRGVEGASHGQFIPKGKFSDESKW
Ga0244777_1040080233300024343EstuarineMWRWLKNHDGTNVMLADKTEAGWFYVPDRGFDVEQNTRHGEYTPEHVHHNYLHSDIYEKSRAARGKQGASPNQFLTKGQFSDESRW
Ga0244775_1127484913300024346EstuarineMLADKSEAGWVYIPDRGWDVNATGEHTPEHVHHNYLHSDAYIQSRKARGVEGASHGQFLERNKFGK
Ga0244775_1146395623300024346EstuarineMARWLRWNDGTNVHLADKSEAGWYNIPDRGFDVEQNTRHGEYNPEHVHHNYLYTDVYEKSRQARGVEGAHPQQNLQKGQFSDETRW
Ga0208616_101005713300025417FreshwaterLRYHDGKNVLLADKTEAGWYYVPDRGFDIETNTRHGEYVPEHVHHNYLYSDVYEKSRKLRNVEGANHGQFLPKGKFSDESKWXLIYSFFIKDCVIFNLK
Ga0208426_101159013300025451AqueousMWRWLKWNDGTNVLLADKSEAGWMFVPDRGYDIPTNTRHGEYIPEHVHHNYLYTDEYKKSREARGKKGAEHNQFLPVGQFSPVDKQF
Ga0209306_104393933300025680Pelagic MarineMWRWLKFYDGCHVLLADKTEAGWYNIPDRGPDPETNTRMGEFNPEHVHHNYLYTDAYEKSRAERGATASNAGNFLPRGQFSDESRW
Ga0209199_123110523300025809Pelagic MarineMLADKSEAGWYYVPDRGFDVECNTRHGEYTPEHVHHNYLHTEAYEQSRAARDVQGANPGQFLPKGQFTDESKW
Ga0208005_116327423300025848AqueousMHRWLRWNDGAHVLLADKSEAGWYFLPDRGVDPNTGTRHGEYNPEHVHHNYMYTDAYVNSRKARGKEGANQGQFLPVGRFSPEDKQF
Ga0209308_1027200813300025869Pelagic MarineMWRWLKWHDGANVMLADKSEAGWFYVPDRGFCVETNTRHGEYTPEHVHHNYLHTKLYEDSRAERGVEGASPG
Ga0209555_1008979623300025879MarineMWRFLKWHDGNNVLLADKSEAGWRYLPDRGFDVECNTRQGEYTPEFVHHNYLHSDAYQQSREARGVEGANPGQFLPKGKFSDEAKW
Ga0208544_1009649323300025887AqueousMWRWLRWSDGAHVLLADKSEAGWKYISDRGWDVNATGEYTPEHVHHNYLHTDAYEKSRKERGVEGAAHGQYLPRNAWSVR
Ga0247590_110584023300026513SeawaterMLSQKMWRWLRWQDGAHVLLADKSEAGWYNIPDRGFDVEQNTRHGEYNPEAVHHNYLHSDVYEQSRQARGVQGANNGQFLQRSIQR
Ga0208673_106530113300027192EstuarineMLADKTEAGWFYVPDRGFDVEQNTRHGEYTPEHVHHNYLHSDIYEKSRAARGKQGASPNQ
Ga0208897_104681933300027571EstuarineMWRWLKNHDGTNVMLADKTEAGWFYVPDRGFDVEQNTRHGEYTPEHVHHNYLHSDIYEKSRAARGKQGASPNQFLTKGQFSDESR
Ga0209617_1007962833300027720Freshwater And SedimentLKYHDGTNALLADKTEAGWYYVPDRGFDIETNTRHGEFIPEHVHHNYLYSDVYEKSRKLRGVEGANHGQFLPKGK
Ga0209084_114902513300027749Freshwater LakeLKYHDGTNALLADKTEAGWYYVPDRGFDIETNTRHGEFIPEHVHHNYLYSDVYEKSRKLRGVEGANHGQFLPKGKFSDESKW
Ga0209279_1004271743300027771MarineMWRWLKWHDGTNVMLADKSEAGWFYVPDRGFCVETNTRHGEFTPEHVHHNYLHTKLYEDSRAERGVQGANPGQFLPKGQF
Ga0209175_1009569843300027781Wastewater EffluentMLADKSEAGWYYVPDRGFDTITNTIHGEYTPEHVHHNYLYTKEYEKSRERRGKEGAGHGQFLPVG
Ga0209175_1013887813300027781Wastewater EffluentVLLADKSEAGWFNIPDRGFDTNTNTRQGEYTPEHVHHNYLHTNAYVESRKARGKEGAAHGEFLQVGKFAPEDKWL
Ga0209174_1020460813300027789Wastewater EffluentMQRFLRWNDGAHVMLADKSEAGWYYVPDRGFDTITNTIHGEYTPEHVHHNYLYTKEYEKSRERRGKEGAGHGQFLPVG
Ga0209830_1040028613300027791MarineMWRWLKFYDGCHVLLADKTEAGWYNIPDRGPDPETNTRMGEFNPEHVHHNYLYTDAYEKSRAERGATASNAGNFLPRGQFNDESRW
Ga0209712_1060989823300027849MarineMDGTNVMLANKSEAGWYYVPDRGFDIEANTTQGEYTPEHVHHNYLYTDAYEKSRAKRGGVEGANHGQYLPRGQFSPNEKWF
Ga0209066_1024079543300027851WatershedsMARWLRWNDGAHVLLADKSEAGWYFLPDRGFDTVTNTTHGEYTPEHVHHNYLYTDEYERSRQQRGKEGAGHG
Ga0209450_1071686913300027885Freshwater Lake SedimentMWRWLRWNDGANVLLADKSEAGWHYINDRGWDQNATGEYTPEHVHHNYLHTDVYEQSRQQRGKVGANHGEFLDRTKYSPRQ
Ga0209668_1013294413300027899Freshwater Lake SedimentLKYHDGTSTLLADKTEAGWYYVPDRGFDIETNTRHGEYIPEHVHHNYLYSDVYEKSRKLRGVEGANHGQFLPKGKFSDESKWXSIQTKQHLYFSISSTLIF
Ga0256411_119536323300028134SeawaterMLADKSEAGWYYVPDRGVSSETNTRHGEFTPEHVHHNYLYSDKYEKSRAARGVDGANSGQFLPRGQFSNESKW
Ga0247572_115068713300028290SeawaterMWRWLKWHDGCHVLLADKTEAGWYNISDRGVDPETNTRHGEFNPEHVHHNYLYTDVYEKSRNERGATASNSGNFLPRGQFNDESRW
Ga0210281_151353313300030539SoilVLLADKSEAGWYFVPDRGFDTNTNTGHGEYTPEHVHHNYLYTDEYEKSRKGRGKEGANHG
Ga0247626_111979623300030591SoilMFRWLRWQDGANVLLADKSEAGWYFVPDRGVDPNTNTGHGEYTPEHVHHNYLYTDAYEKSRKEREKEGAAHG
Ga0247651_1021853513300030608SoilMYRWLRWHDGTNVMLADKSEAGWYYVPDRGFDTNANTPHGEYTPEHVHHNYLHTDAYEKSRKERRTVGATHG
Ga0247634_1052383913300030609SoilMYRWLRWKDGSHVLLADKSEAGWVYIPDRGFDTITNTTQGEYIPEHVHHNYLYTDAYEKSRKGRGKEGAAHG
Ga0210259_1192448913300030625SoilVLLADKSEAGWYFVPDRGFDTVTNTGHGEYTPEHVHHNYLYTDEYEKSRKGRGKEGANHG
Ga0307398_1021143723300030699MarineMWRWLKWHDGKNVMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDAYEKSREERGVEGAKVGEFLPRG
Ga0307399_1009694413300030702MarineMTRWLRWHDGAHVLLADKSEAGWYYVPDRGFDVETNTRHGEFTPEHVHHNYLYTDAYQKSREARGAEGANANQFLPKG
Ga0265462_1268311613300030738SoilMFRWLRWHDGCNVLLADKSEAGWHFVPDRGFDVQTNTTHGEYTPEHVHHNYLYTDAYDKSRKERGKEAANHGQFLPVGQFSPKDKWF
Ga0265459_1085705913300030741SoilVTNTTHGEYTPEHVHHNYLYTDAYEKSRKERGKEGAAHGQFLPVGKFSPKDKWF
Ga0265459_1204891423300030741SoilLADKSEAGWYFVPDRGFDTVTNTTHGEYSPEHVHHNYLYSDVYEKSRKERGKEGAAHG
Ga0265459_1278459913300030741SoilMFRWLRWHDGCNVLLADKSEAGWYYLPDRGFDTQTNTTHGEYTPEHVHHNYLYTDAYEKSRKSRGKEGASHGQYLPVGQFSPKDKWF
Ga0265461_1381517413300030743SoilVLLADKTEAGWYYIRDRGVDYNTNTGDGEYTPEHVHHNYLYTDSYEKSRKARGKEGAAHG
Ga0074021_138843313300030775SoilMYRWLRWKDGAHVLLADKSEAGWYYVPDRGFDSVTNTVHGEYIPEHVHHNYLYTDAYEKSRTRRGKEAATHGQFLIPGKFSPGADNSK
Ga0075398_1156467323300030778SoilMFRWLRWQDGAHPMLADKSEAGWYFVPDRGFDSITNTSMGEFTPEHVHHNYLYTDEYEKSRQKRGKEGAQHGQFLPVGQFSPKDKWF
Ga0074020_1006835723300030840SoilMYRWLRWKDGAHVLLADKSEAGWYYVPDRGFDSVTNTVHGEYIPEHVHHNYLYTDAYEKSRTRRGKEAATHGQFLVPGKFSPGADNSK
Ga0074020_1106710813300030840SoilMYRWLRWKDGAHVLLADKSEAGWYYVPDRGFDSVTNTVHGEYIPEHVHHNYLYTDAYEKSRTNRGKEAAAHGQFLASGKFSPGATANKDYFPPGTEDVK
Ga0074014_103010713300031002SoilLADKSEAGWHYIPDRGFDTVTNTTHGEYIPEHVHHNYLHTDLYEKSREARGVKEGANHGQFLAPGKFSEANTK
Ga0074041_1104051823300031034SoilMYRWLRWKDGAHVLLADKSEAGWYYVPDRGFDSVTNTVHGEYIPEHVHHNYLYTDAYEKSRTNRGKEAAAHGQFLAPGKFSPGATANKDYFPPGTEDVK
Ga0170824_10199521313300031231Forest SoilMYRWLRWKDGCHVLLADKSEVGWYYVPDRGFDTVTNTTHGEYIPEHVHHNYLNTDEYEKSRERRGKEGANHGQFLPVG
Ga0170824_10403417223300031231Forest SoilMLADKSEAGWYFVPDRGFDTNTNTTHGEYTPEHVHHNYLYTNEYELSRQRRGKEGAAHGQFLPVG
Ga0170824_10708651923300031231Forest SoilVHLADKSEAGWYFVPDRGFDTNANTTHGEYTPEHVHHNYLYTDEYEKSRKLRNKEGSNHGQFLPVGQFSPKDKWF
Ga0170819_1217592913300031469Forest SoilVLLADKSEAGWYFLPDRGFDTITNTTHGEYTPEHVHHNYLYSNAYDQSRKERGKEGASHGQFLPVG
Ga0307388_1077000713300031522MarineMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDVYEKSREARGEEGASVGQFLPRG
Ga0307388_1119373813300031522MarineMWRWLKWHDGTHVLLADKSEAGWYNIPDRGFDVEQNTRQGEYNPEHVHHNYLHSDVYEKSREARGVDGSSSGQFLPKGQFNNEGR
Ga0307489_1012856733300031569Sackhole BrineVLLADKSEAGWYFLPDRGVDPNTGTKDGEYNPEHVHHNYLYTDEYEKSREARGKDGANPGQFLPVGKFTPDDKQF
Ga0307489_1013497613300031569Sackhole BrineVLLADKSEAGWYFLPDRGVDYNTGTKHGEYNPEHVHHNYLYTDEYEKSREARGKDGASPG
Ga0307489_1095338623300031569Sackhole BrineMARFLRWNDGTNVHLVDKTEAGWYNIPDRGFDIEQNTRHGEYNPEHVHHNYLHSDVYEKSREARGVEGAQPNQFLQKGQFSDESRW
Ga0307993_102849733300031602MarineMLADKSEAGWLYINERGTDTNTGTPGGEYIPEHVHYDYVHTKAYEESRAERGVEGANHGEFLERG
Ga0307993_112799913300031602MarineMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDVYEKSREARGEEGASVGQFLPRG
Ga0302126_1022923813300031622MarineMLADKSEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDVYEKSRAARGEEGAGVGQFLPRG
Ga0302125_1017586023300031638MarineMLADKSEAGWYYVPDRGFDVECNTRHGEYTPEHVHHNYLHTEAYEQSRAARDVEGANPGQFLPKGQFTDENKW
Ga0307386_1010631533300031710MarineMWRWLKDHDGCHVLLADKTETGWYNIADKGFDVEQNTRTGEYNPEHVHHNYLYTDEYEKSREARGVEGA
Ga0307386_1065634823300031710MarineMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDAYEKSREARGVEGAKVGEFLP
Ga0307386_1068564513300031710MarineMTRWLRWHDGAHVLLADKSEAGWYYVPDRGFDVETNTRHGEFTPEHVHHNYLYTDAYQKSREARGAEGANAN
Ga0307396_1012127433300031717MarineMLADKSEAGWYYVPDRGFDVECNTRHGEFTPEHVHHNYLHTEAYEKSRAERGVEGANPGQFLPKGQFNNESKW
Ga0307381_1017047813300031725MarineMARWLRWKDGAHVLLADKSEAGWYYLPDRGYCPNVNTSSSELTPEHFHFYYLHTDEYAKSQKTRGKEGADHGQFLAP
Ga0307381_1031801313300031725MarineMTRWLRWHDGAHVLLADKSEAGWYYVPDRGFDVEINTRHGEFTPEHVHHNYLYTDAYQKSREARGAEGANA
Ga0307391_1011312913300031729MarineVLLADKSEAGWYVLPDRGYDQNTNTRHGECNPEHVHHNYLQTDEYEKSRAFRGKEGAAQGQFLPIGQFSPDDKQL
Ga0307391_1016069433300031729MarineMLADKSEAGWYYVPDRGFDVETNTRHGEYTPEHVHHNYLHTKQYENSRAQRGVEGANHGQHLP
Ga0307397_1009958033300031734MarineMLADKSEAGWYYVPDRGFDVECNTRHGEFTPEHVHHNYLHTEAYEKSRAERGVEGANPGQFLPKGQFNNESK
Ga0307397_1062139313300031734MarineMWRWLKWHDGKNVMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDAYEKSREERGVEGAKV
Ga0307387_1015026633300031737MarineMLSNKMWRWLKWHDGTHVLLADKSEAGWYNIPDRGFDVEQNTRQGEYNPEHVHHNYLHSDVYEKSREARGVDGSSSGQFLPKGQFNNEGRW
Ga0307383_1028014913300031739MarineMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEHIPEHVHHNYLYSDAYEKSREERGVEGAKVGEFLPRG
Ga0315907_1069651913300031758FreshwaterVLLADKTEAGWYYVPDRGFDIETNTRHGEFNPEHVHHNYLHTDVYEKSRKLRGVEGANHGQFLPKGKFSDESKW
Ga0315899_1070527113300031784FreshwaterMHRFLRWNDGCNLMLADKSEAGWYFVPDRGFDTVTNTTHGEYTPEHVHHNYLYTDAYEKSRKARGKEGAAHGQFLPVGQFSPKDKWF
Ga0314684_1015253413300032463SeawaterMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDVYEKSREARGEEGANVGQFLPRGTFNDEKRW
Ga0314668_1014053333300032481SeawaterMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDVYEKSREARGEEGANVGQFLPRGTF
Ga0314675_1011175433300032491SeawaterMLADKSEAGWYYVPDRGFDVECNTRHGEYTPEHVHHNYLHTEAYEQSRATRDVQGANPGQFLPKGQFTDESKW
Ga0314688_1041917913300032517SeawaterMWRWLKWYDGKNVLLADKTEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDIYEKSRAARGQEGANVGQFLRKGTFNDEERW
Ga0314677_1031507423300032522SeawaterMLADKSEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDVYEKSREARGEEGANVGQFLPRGTF
Ga0314669_1033230423300032708SeawaterVLLADKSEAGWRYIGDRGWDVNATGEYTPEHVHHNYLHTDLYEKSRQARGVEGASHGQYLERNKWSPRQ
Ga0314669_1069007213300032708SeawaterMWRWLKWYDGKNVLLADKTEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDIYEKSRAARGQEGANVGQFLRKGTFNDEE
Ga0314686_1063332313300032714SeawaterMWRWLKWHDGKHVMLADKSEAGWYYVPDRGTCNETNTRQGEFIPEHVHHNYLYSDVYEKSREARGEEGANVGQFLPRGTFN
Ga0314693_1014575113300032727SeawaterMLADKSEAGWYYVPDRGFDVECNTRHGEYTPEHVHHNYLHTEAYEQSRAARDVQGANP
Ga0314700_1013799613300032752SeawaterMLADKSEAGWYYVPDRGFDVECNTRHGEYTPEHVHHNYLHTEAYEQSRAARDVQGANPGQFLPKGQFTDE
Ga0315742_1169157823300032756Forest SoilMYRWLRWKDGAHVLLADKSEAGWYYVPDRGFDSVTNTVHGEYIPEHVHHNYLYTDAYEKSRTSRGKEAAAHGQFLAPGKFSPGATANKDYFPPGTEDVK
Ga0315742_1223781213300032756Forest SoilMLADKSEAGWYFVPDRGFDVVTNTTHGEYTPEHVHHNYLYTDEYEKSRAGRGKEGANHG
Ga0315742_1271498713300032756Forest SoilLRWKDGAHVLLADKSEAGWYYVPDRGFDTVTNTTHGEYIPEHVHHNYLHTDAYEKSREGRGKEGANHG
Ga0334982_0550376_105_2753300033981FreshwaterMLADKSEAGWVYVPDRGWDVNATGEYTPEHVHHNYLHTDAYTQSRKHRGVESAGHG
Ga0334989_0513471_131_3793300033984FreshwaterLKYHDGTSTLLADKTEAGWYYVPDRGFDIETNTRHGEYIPEHVHHNYLYSDVYEKSRKLRGVEGANHGQFLPKGKFSDESKW
Ga0334985_0626480_97_3183300034018FreshwaterLADKSEAGWLYVPDRGFDTVTNTTHGEYTPEHVHHNYLYSDAYEKSRKARGKEGAAHGQFLPVGQFSPKDKWF
Ga0335035_0221200_789_10523300034105FreshwaterMHRWLRWKDGCNVLLADKSEAGWYWIPDRGFDTVTNTTHGEYTPEHVHHNYLYTDAYEKSRKSRGKDGAAHGQFLPVGQFSPKDKWF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.