Basic Information | |
---|---|
Family ID | F022246 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 215 |
Average Sequence Length | 39 residues |
Representative Sequence | MLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 215 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 64.95 % |
% of genes near scaffold ends (potentially truncated) | 43.72 % |
% of genes from short scaffolds (< 2000 bps) | 89.30 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.558 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.535 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.093 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.093 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 215 Family Scaffolds |
---|---|---|
PF03401 | TctC | 2.79 |
PF04392 | ABC_sub_bind | 1.86 |
PF01068 | DNA_ligase_A_M | 1.40 |
PF07045 | DUF1330 | 0.93 |
PF02586 | SRAP | 0.93 |
PF11295 | DUF3096 | 0.93 |
PF00589 | Phage_integrase | 0.93 |
PF03412 | Peptidase_C39 | 0.93 |
PF00239 | Resolvase | 0.93 |
PF00877 | NLPC_P60 | 0.47 |
PF13414 | TPR_11 | 0.47 |
PF12849 | PBP_like_2 | 0.47 |
PF13424 | TPR_12 | 0.47 |
PF13340 | DUF4096 | 0.47 |
PF07690 | MFS_1 | 0.47 |
PF04218 | CENP-B_N | 0.47 |
PF10518 | TAT_signal | 0.47 |
PF01425 | Amidase | 0.47 |
PF13817 | DDE_Tnp_IS66_C | 0.47 |
PF13361 | UvrD_C | 0.47 |
PF02798 | GST_N | 0.47 |
PF01565 | FAD_binding_4 | 0.47 |
PF12706 | Lactamase_B_2 | 0.47 |
PF14490 | HHH_4 | 0.47 |
PF07007 | LprI | 0.47 |
PF14659 | Phage_int_SAM_3 | 0.47 |
PF00353 | HemolysinCabind | 0.47 |
PF06411 | HdeA | 0.47 |
PF08281 | Sigma70_r4_2 | 0.47 |
PF10908 | DUF2778 | 0.47 |
COG ID | Name | Functional Category | % Frequency in 215 Family Scaffolds |
---|---|---|---|
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.79 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.86 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.40 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.40 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.93 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.93 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.93 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.93 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.56 % |
All Organisms | root | All Organisms | 47.44 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2065487018|GPINP_F5MS3JC02JGMQK | Not Available | 515 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10012560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2335 | Open in IMG/M |
3300000956|JGI10216J12902_101084126 | Not Available | 672 | Open in IMG/M |
3300000956|JGI10216J12902_102697325 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300002077|JGI24744J21845_10035535 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300002568|C688J35102_118025275 | Not Available | 523 | Open in IMG/M |
3300004479|Ga0062595_102361748 | Not Available | 526 | Open in IMG/M |
3300005093|Ga0062594_103313010 | Not Available | 506 | Open in IMG/M |
3300005162|Ga0066814_10068093 | Not Available | 619 | Open in IMG/M |
3300005332|Ga0066388_100714300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1607 | Open in IMG/M |
3300005332|Ga0066388_100857803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1492 | Open in IMG/M |
3300005332|Ga0066388_103069177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 853 | Open in IMG/M |
3300005437|Ga0070710_10354869 | Not Available | 972 | Open in IMG/M |
3300005536|Ga0070697_100926021 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300005554|Ga0066661_10841305 | Not Available | 537 | Open in IMG/M |
3300005578|Ga0068854_101354511 | Not Available | 642 | Open in IMG/M |
3300005713|Ga0066905_100675560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
3300005713|Ga0066905_100696310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
3300005713|Ga0066905_100747923 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005713|Ga0066905_100949462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 755 | Open in IMG/M |
3300005713|Ga0066905_101335644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 646 | Open in IMG/M |
3300005719|Ga0068861_100332506 | Not Available | 1327 | Open in IMG/M |
3300005764|Ga0066903_100236183 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
3300005764|Ga0066903_100642003 | Not Available | 1853 | Open in IMG/M |
3300005764|Ga0066903_101161386 | Not Available | 1430 | Open in IMG/M |
3300005764|Ga0066903_101326426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1346 | Open in IMG/M |
3300005764|Ga0066903_101875071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1147 | Open in IMG/M |
3300005764|Ga0066903_102303084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1040 | Open in IMG/M |
3300005764|Ga0066903_103116160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 897 | Open in IMG/M |
3300005764|Ga0066903_104332900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
3300005764|Ga0066903_104973975 | Not Available | 705 | Open in IMG/M |
3300005764|Ga0066903_105944154 | Not Available | 640 | Open in IMG/M |
3300005764|Ga0066903_106247629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 622 | Open in IMG/M |
3300005764|Ga0066903_106285299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 620 | Open in IMG/M |
3300005764|Ga0066903_106338781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
3300005764|Ga0066903_106988371 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300005764|Ga0066903_107202555 | Not Available | 576 | Open in IMG/M |
3300005937|Ga0081455_10009641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9910 | Open in IMG/M |
3300005937|Ga0081455_10020113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 6298 | Open in IMG/M |
3300005937|Ga0081455_10072144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2860 | Open in IMG/M |
3300006028|Ga0070717_10730881 | Not Available | 900 | Open in IMG/M |
3300006038|Ga0075365_10183915 | Not Available | 1462 | Open in IMG/M |
3300006038|Ga0075365_10270191 | Not Available | 1196 | Open in IMG/M |
3300006175|Ga0070712_100021198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4263 | Open in IMG/M |
3300006175|Ga0070712_100168616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1697 | Open in IMG/M |
3300006175|Ga0070712_100886835 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
3300006178|Ga0075367_10090545 | Not Available | 1861 | Open in IMG/M |
3300006844|Ga0075428_101578010 | Not Available | 686 | Open in IMG/M |
3300006844|Ga0075428_102256400 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300006853|Ga0075420_100191750 | Not Available | 1786 | Open in IMG/M |
3300006935|Ga0081246_1403772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 866 | Open in IMG/M |
3300006969|Ga0075419_10858447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
3300009012|Ga0066710_101583740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
3300009094|Ga0111539_11716703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
3300009100|Ga0075418_10959938 | Not Available | 925 | Open in IMG/M |
3300009148|Ga0105243_10330996 | Not Available | 1391 | Open in IMG/M |
3300009156|Ga0111538_13600624 | Not Available | 537 | Open in IMG/M |
3300009156|Ga0111538_14092169 | Not Available | 504 | Open in IMG/M |
3300009176|Ga0105242_12396128 | Not Available | 575 | Open in IMG/M |
3300009792|Ga0126374_10157512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1385 | Open in IMG/M |
3300010043|Ga0126380_10046323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2318 | Open in IMG/M |
3300010043|Ga0126380_10589750 | Not Available | 873 | Open in IMG/M |
3300010043|Ga0126380_10623468 | Not Available | 854 | Open in IMG/M |
3300010043|Ga0126380_12047642 | Not Available | 525 | Open in IMG/M |
3300010046|Ga0126384_12023017 | Not Available | 551 | Open in IMG/M |
3300010047|Ga0126382_10024984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3180 | Open in IMG/M |
3300010048|Ga0126373_12082121 | Not Available | 629 | Open in IMG/M |
3300010359|Ga0126376_10788337 | Not Available | 926 | Open in IMG/M |
3300010359|Ga0126376_11954475 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300010361|Ga0126378_12287178 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010362|Ga0126377_10352776 | Not Available | 1468 | Open in IMG/M |
3300010362|Ga0126377_12025869 | Not Available | 652 | Open in IMG/M |
3300010366|Ga0126379_12061837 | Not Available | 672 | Open in IMG/M |
3300010375|Ga0105239_10885779 | Not Available | 1024 | Open in IMG/M |
3300010376|Ga0126381_100663506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1489 | Open in IMG/M |
3300010376|Ga0126381_103808389 | Not Available | 589 | Open in IMG/M |
3300010376|Ga0126381_104440412 | Not Available | 542 | Open in IMG/M |
3300010401|Ga0134121_12317703 | Not Available | 576 | Open in IMG/M |
3300010863|Ga0124850_1004242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4414 | Open in IMG/M |
3300010868|Ga0124844_1120295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
3300012204|Ga0137374_10615769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
3300012212|Ga0150985_111215959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1277 | Open in IMG/M |
3300012212|Ga0150985_112979029 | Not Available | 602 | Open in IMG/M |
3300012212|Ga0150985_117391980 | Not Available | 833 | Open in IMG/M |
3300012212|Ga0150985_119490321 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300012355|Ga0137369_10831248 | Not Available | 627 | Open in IMG/M |
3300012356|Ga0137371_10168884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1716 | Open in IMG/M |
3300012356|Ga0137371_10411865 | Not Available | 1048 | Open in IMG/M |
3300012948|Ga0126375_10900439 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300012951|Ga0164300_10107863 | Not Available | 1235 | Open in IMG/M |
3300012951|Ga0164300_10122731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1176 | Open in IMG/M |
3300012951|Ga0164300_10179142 | Not Available | 1020 | Open in IMG/M |
3300012957|Ga0164303_10185684 | Not Available | 1137 | Open in IMG/M |
3300012957|Ga0164303_11188602 | Not Available | 557 | Open in IMG/M |
3300012960|Ga0164301_10203953 | Not Available | 1263 | Open in IMG/M |
3300012961|Ga0164302_11343667 | Not Available | 580 | Open in IMG/M |
3300012971|Ga0126369_10713147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1081 | Open in IMG/M |
3300012971|Ga0126369_12442524 | Not Available | 608 | Open in IMG/M |
3300012984|Ga0164309_11315465 | Not Available | 612 | Open in IMG/M |
3300013308|Ga0157375_11209058 | Not Available | 887 | Open in IMG/M |
3300014326|Ga0157380_12274248 | Not Available | 606 | Open in IMG/M |
3300015373|Ga0132257_100449011 | Not Available | 1575 | Open in IMG/M |
3300015373|Ga0132257_100887451 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300015374|Ga0132255_101390793 | Not Available | 1060 | Open in IMG/M |
3300016270|Ga0182036_10384741 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300016294|Ga0182041_10206861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1567 | Open in IMG/M |
3300016294|Ga0182041_12230882 | Not Available | 512 | Open in IMG/M |
3300016357|Ga0182032_10393518 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300016371|Ga0182034_11337757 | Not Available | 625 | Open in IMG/M |
3300016371|Ga0182034_11558924 | Not Available | 579 | Open in IMG/M |
3300016371|Ga0182034_11996467 | Not Available | 513 | Open in IMG/M |
3300016387|Ga0182040_11751986 | Not Available | 531 | Open in IMG/M |
3300017792|Ga0163161_11415007 | Not Available | 608 | Open in IMG/M |
3300018061|Ga0184619_10224133 | Not Available | 865 | Open in IMG/M |
3300019263|Ga0184647_1117008 | Not Available | 918 | Open in IMG/M |
3300019263|Ga0184647_1301758 | Not Available | 552 | Open in IMG/M |
3300019875|Ga0193701_1100913 | Not Available | 537 | Open in IMG/M |
3300019876|Ga0193703_1025116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
3300019881|Ga0193707_1127763 | Not Available | 734 | Open in IMG/M |
3300020016|Ga0193696_1021841 | Not Available | 1719 | Open in IMG/M |
3300021082|Ga0210380_10109736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d | 1223 | Open in IMG/M |
3300021363|Ga0193699_10236030 | Not Available | 761 | Open in IMG/M |
3300021475|Ga0210392_11361656 | Not Available | 531 | Open in IMG/M |
3300021560|Ga0126371_11012991 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300021560|Ga0126371_12130649 | Not Available | 676 | Open in IMG/M |
3300021560|Ga0126371_13075430 | Not Available | 565 | Open in IMG/M |
3300022694|Ga0222623_10363426 | Not Available | 552 | Open in IMG/M |
3300025905|Ga0207685_10339181 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300025910|Ga0207684_10967885 | Not Available | 713 | Open in IMG/M |
3300025919|Ga0207657_10548163 | Not Available | 904 | Open in IMG/M |
3300026067|Ga0207678_11939292 | Not Available | 513 | Open in IMG/M |
3300027383|Ga0209213_1011280 | Not Available | 1622 | Open in IMG/M |
3300027646|Ga0209466_1014239 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
3300027874|Ga0209465_10468826 | Not Available | 629 | Open in IMG/M |
3300027907|Ga0207428_10162682 | Not Available | 1694 | Open in IMG/M |
3300027909|Ga0209382_10215765 | Not Available | 2192 | Open in IMG/M |
3300028710|Ga0307322_10122527 | Not Available | 680 | Open in IMG/M |
3300028712|Ga0307285_10186076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 578 | Open in IMG/M |
3300028716|Ga0307311_10072446 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300028717|Ga0307298_10037744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1301 | Open in IMG/M |
3300028719|Ga0307301_10267254 | Not Available | 560 | Open in IMG/M |
3300028720|Ga0307317_10099244 | Not Available | 965 | Open in IMG/M |
3300028787|Ga0307323_10314619 | Not Available | 562 | Open in IMG/M |
3300028810|Ga0307294_10072874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1042 | Open in IMG/M |
3300028875|Ga0307289_10214245 | Not Available | 792 | Open in IMG/M |
3300028875|Ga0307289_10496130 | Not Available | 502 | Open in IMG/M |
3300028881|Ga0307277_10005250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4961 | Open in IMG/M |
3300028881|Ga0307277_10021992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2503 | Open in IMG/M |
3300031082|Ga0308192_1037543 | Not Available | 692 | Open in IMG/M |
3300031099|Ga0308181_1130116 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300031152|Ga0307501_10184021 | Not Available | 588 | Open in IMG/M |
3300031543|Ga0318516_10118557 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300031543|Ga0318516_10673261 | Not Available | 588 | Open in IMG/M |
3300031544|Ga0318534_10028275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3040 | Open in IMG/M |
3300031545|Ga0318541_10561562 | Not Available | 638 | Open in IMG/M |
3300031546|Ga0318538_10150827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1228 | Open in IMG/M |
3300031546|Ga0318538_10258102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 936 | Open in IMG/M |
3300031546|Ga0318538_10423898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 720 | Open in IMG/M |
3300031546|Ga0318538_10500988 | Not Available | 658 | Open in IMG/M |
3300031561|Ga0318528_10190778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1095 | Open in IMG/M |
3300031573|Ga0310915_10017171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4331 | Open in IMG/M |
3300031573|Ga0310915_10541772 | Not Available | 826 | Open in IMG/M |
3300031640|Ga0318555_10053323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2059 | Open in IMG/M |
3300031640|Ga0318555_10338612 | Not Available | 815 | Open in IMG/M |
3300031680|Ga0318574_10188799 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300031680|Ga0318574_10795779 | Not Available | 554 | Open in IMG/M |
3300031719|Ga0306917_10578926 | Not Available | 882 | Open in IMG/M |
3300031723|Ga0318493_10264731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
3300031740|Ga0307468_102130084 | Not Available | 541 | Open in IMG/M |
3300031744|Ga0306918_10200952 | Not Available | 1502 | Open in IMG/M |
3300031744|Ga0306918_10513138 | Not Available | 939 | Open in IMG/M |
3300031744|Ga0306918_10610836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
3300031763|Ga0318537_10023643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2155 | Open in IMG/M |
3300031763|Ga0318537_10394040 | Not Available | 511 | Open in IMG/M |
3300031765|Ga0318554_10215623 | Not Available | 1093 | Open in IMG/M |
3300031765|Ga0318554_10366440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
3300031768|Ga0318509_10791742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
3300031771|Ga0318546_10737685 | Not Available | 693 | Open in IMG/M |
3300031781|Ga0318547_10248957 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300031793|Ga0318548_10099400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1391 | Open in IMG/M |
3300031795|Ga0318557_10410630 | Not Available | 622 | Open in IMG/M |
3300031835|Ga0318517_10510894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 541 | Open in IMG/M |
3300031879|Ga0306919_10070249 | Not Available | 2383 | Open in IMG/M |
3300031879|Ga0306919_10177764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1569 | Open in IMG/M |
3300031879|Ga0306919_10196997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1495 | Open in IMG/M |
3300031879|Ga0306919_10484944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
3300031880|Ga0318544_10024011 | Not Available | 2071 | Open in IMG/M |
3300031880|Ga0318544_10356662 | Not Available | 568 | Open in IMG/M |
3300031890|Ga0306925_10099336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3096 | Open in IMG/M |
3300031890|Ga0306925_10235568 | Not Available | 1974 | Open in IMG/M |
3300031890|Ga0306925_10254557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1892 | Open in IMG/M |
3300031890|Ga0306925_10525520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1257 | Open in IMG/M |
3300031912|Ga0306921_10141185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2813 | Open in IMG/M |
3300031912|Ga0306921_10585792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1291 | Open in IMG/M |
3300031941|Ga0310912_10073276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2471 | Open in IMG/M |
3300031946|Ga0310910_11072309 | Not Available | 628 | Open in IMG/M |
3300031947|Ga0310909_10659469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 871 | Open in IMG/M |
3300031981|Ga0318531_10047428 | Not Available | 1816 | Open in IMG/M |
3300032001|Ga0306922_10316117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1676 | Open in IMG/M |
3300032042|Ga0318545_10028184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → sulfur-oxidizing symbionts → endosymbiont of Tevnia jerichonana → endosymbiont of Tevnia jerichonana (vent Tica) | 1827 | Open in IMG/M |
3300032051|Ga0318532_10033760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1715 | Open in IMG/M |
3300032059|Ga0318533_10267496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1236 | Open in IMG/M |
3300032059|Ga0318533_10988559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 617 | Open in IMG/M |
3300032060|Ga0318505_10088495 | Not Available | 1388 | Open in IMG/M |
3300032067|Ga0318524_10606094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 576 | Open in IMG/M |
3300032076|Ga0306924_10116262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3039 | Open in IMG/M |
3300032076|Ga0306924_10575592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1276 | Open in IMG/M |
3300032261|Ga0306920_100499878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1804 | Open in IMG/M |
3300032261|Ga0306920_101661759 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300032261|Ga0306920_103110034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
3300033290|Ga0318519_10290285 | Not Available | 955 | Open in IMG/M |
3300033290|Ga0318519_10812076 | Not Available | 575 | Open in IMG/M |
3300034447|Ga0370544_16326 | Not Available | 584 | Open in IMG/M |
3300034643|Ga0370545_064916 | Not Available | 737 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.02% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.70% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.72% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.86% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.86% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.40% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.40% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.47% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.47% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.47% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006935 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034447 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPINP_03664170 | 2065487018 | Soil | MEGTAMMAEIFMLRLEAAARAAKEAATTNSRFVPITLPAAKAS |
AF_2010_repII_A1DRAFT_100125601 | 3300000597 | Forest Soil | MLAEIFMLRLEAAARVAKFEAATPSRFVPITLPAAKAS* |
JGI10216J12902_1010841261 | 3300000956 | Soil | MLAEIFMLRLAAAARAGKEAANASSGSRFVPIKASCEGVL |
JGI10216J12902_1026973252 | 3300000956 | Soil | MLAEIFMLRLEATARATANGPTTSPSRFVPVVLKAKESK* |
JGI24744J21845_100355352 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAEIYMLRLEAAARATATATTNSRFVPITLPALP |
C688J35102_1180252751 | 3300002568 | Soil | MLAEIYMLRLEATARAAKEAAITRSTSVFVPVTLPPVKAS* |
Ga0062595_1023617482 | 3300004479 | Soil | MLAEIFFLRLEATARATKEATVTSSNSRFVPITLPTAKAS* |
Ga0062594_1033130101 | 3300005093 | Soil | MLAEIYMLRLEATARAAKEAAITRSTSAFVPVTLPPVKAS* |
Ga0066814_100680932 | 3300005162 | Soil | RSAVMLAEIYMLRLEAAARAAKEAATSSSRFVPVSLPGPKAS* |
Ga0066388_1007143001 | 3300005332 | Tropical Forest Soil | NQGGCAMLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAS* |
Ga0066388_1008578032 | 3300005332 | Tropical Forest Soil | PGRHAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAKTS* |
Ga0066388_1030691772 | 3300005332 | Tropical Forest Soil | MLAEIYTLKLEAAVRAAKEAATSASTSRFVPITLPAAKAS* |
Ga0070710_103548693 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGTAMMAEIFMLRLEAAARAAKEAAATSSRFVPITLPAAKAS* |
Ga0070697_1009260211 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GCAMLAEIFMIRLEAVARAAKEAANSPRFVPVTLPAAKAS* |
Ga0066661_108413051 | 3300005554 | Soil | MLAEIFLLRVEAAARAAKESSTTSSNSRFVPISMPAAKAS* |
Ga0068854_1013545112 | 3300005578 | Corn Rhizosphere | MLAEIYMLRLEAAARAVKEAATSSSQFVPISLPAVKAK* |
Ga0066905_1006755602 | 3300005713 | Tropical Forest Soil | MAEIFMLRLEAAARAAKEATSPFVRITLPAAKAS* |
Ga0066905_1006963101 | 3300005713 | Tropical Forest Soil | GCAMLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAS* |
Ga0066905_1007479231 | 3300005713 | Tropical Forest Soil | MLAEIFMLRLEAAARTAKEAANSSRFVPITLPSAKAS* |
Ga0066905_1009494622 | 3300005713 | Tropical Forest Soil | MLAEIFMLRLEAAARAAKEAANSSQFVPITLPTAKAS* |
Ga0066905_1013356441 | 3300005713 | Tropical Forest Soil | EIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS* |
Ga0068861_1003325062 | 3300005719 | Switchgrass Rhizosphere | MLAEIYMLRLEAAARAAKESATSSSQFVPVSLPAVKAS* |
Ga0066903_1002361836 | 3300005764 | Tropical Forest Soil | MLAEIFMIRLEAVARAAKEAANSPRFVPVTLPAAKAS* |
Ga0066903_1006420032 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLEAVARAAKEAATHSRFVPITLPAAKAS* |
Ga0066903_1011613864 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLETAARVAKEAAAPSRFVPITLPAAKAS* |
Ga0066903_1013264262 | 3300005764 | Tropical Forest Soil | MLVQARTEAAARAAKEAAGTSARFVPITLPAAKAS* |
Ga0066903_1018750713 | 3300005764 | Tropical Forest Soil | MLAEIFMLQLEAAARAAKEAANSSRFGPITLPTAKAS* |
Ga0066903_1023030842 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLEAAARAAKFEAATPFPITLPAAKAS* |
Ga0066903_1031161602 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLEAAARVVKFEAATPSRFVPIALPAAKAS* |
Ga0066903_1043329001 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLETAARVVKFEAATPSRFVPITLPAAKTS* |
Ga0066903_1049739751 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLEAAARATKEAAPPSRFVPITLPAAKAS* |
Ga0066903_1059441541 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLEAAAQAPKEAAATSSSSRFVPITLPVAKA* |
Ga0066903_1062476291 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS* |
Ga0066903_1062852992 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPIRLPSAKTS* |
Ga0066903_1063387811 | 3300005764 | Tropical Forest Soil | MLAEIFMLRLEAAARAAKEAANSWRFVPITLPTAKAS* |
Ga0066903_1069883712 | 3300005764 | Tropical Forest Soil | AMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS* |
Ga0066903_1072025551 | 3300005764 | Tropical Forest Soil | MLAEIYMLRLEAAARAAKEMSNSSRFVPITLPAAKAS* |
Ga0081455_100096418 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLAEIYMLRLEAAARAAKEAAATSSGSRFVPISLPAVRT* |
Ga0081455_1002011311 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLAEIFILRLEAAARAAKAVATSSRFVPITLPAAKAS* |
Ga0081455_100721443 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLAEIFMLRLEAATRAARETANTNSRFVPITLPVAKAS* |
Ga0070717_107308811 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAEIYMLRLEAAALAAKEAVTSSSRFVPISLPAVKAS* |
Ga0075365_101839156 | 3300006038 | Populus Endosphere | MDGTAMLVEIFMLRLEAAARAAKEAAATNSRFVPMTLPAAKAS* |
Ga0075365_102701913 | 3300006038 | Populus Endosphere | MLAEIYMLRLEAAARAAKEAATSSSRFVPVSLPGPKAS* |
Ga0070712_1000211984 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAEIFMLRLEAAARAAKEAAATSSRFVPITLPAAKAS* |
Ga0070712_1001686162 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAEIFLLRLEAAARAAKESSTASSNSRFVPIPMPAVKAS* |
Ga0070712_1008868352 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAEIFMLRLEAAARAAKEVAPVSNSQFVPITLPAARAS* |
Ga0075367_100905452 | 3300006178 | Populus Endosphere | MLAEIYMLRLEAAARAAKEAATSSSQFVPISLPAVKAK* |
Ga0075428_1015780101 | 3300006844 | Populus Rhizosphere | AMMAEIFMLRLEAAARAAKEAAATSLRFVPITLPAAKAS* |
Ga0075428_1022564002 | 3300006844 | Populus Rhizosphere | MLAEIYLLKLEAAVRAAREAANTSSRFVPITLPVAKAS* |
Ga0075420_1001917506 | 3300006853 | Populus Rhizosphere | MEGTVMMAEIFMLRLEAAARAAKEAAATNSRFLPMTLPAAKAS* |
Ga0081246_14037722 | 3300006935 | Tropical Rainforest Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS* |
Ga0075419_108584472 | 3300006969 | Populus Rhizosphere | MMAQIFMLRLEAAARAAKEAAGTSARFVPITLPAAKAS* |
Ga0066710_1015837402 | 3300009012 | Grasslands Soil | MLAEIFLLRVEAAARAAKESSTTSSNSRFVPIPMPAAKAS |
Ga0111539_117167031 | 3300009094 | Populus Rhizosphere | MEGTAVMAEIFMLRLEAAARAAKEAAGTSARFVPITLPAAKAS* |
Ga0075418_109599382 | 3300009100 | Populus Rhizosphere | MMAEIYMLRLEAAARAAKEAAAIGSRFVPITLPAVKAS* |
Ga0105243_103309962 | 3300009148 | Miscanthus Rhizosphere | MLAEIYMLRLEAAARAAKEAATSSSQFVPISLPVKAK* |
Ga0111538_136006242 | 3300009156 | Populus Rhizosphere | MLAEIYMLRLEAAARAAKEAAISSSQFVPISLPVKAK* |
Ga0111538_140921691 | 3300009156 | Populus Rhizosphere | LAEIYMLRLEAAARAAKEAATSSSQFVPISLPVKAK* |
Ga0105242_123961281 | 3300009176 | Miscanthus Rhizosphere | MLAEIFFLRLEATARATKEATVTSSNSRFVPITLPIAKAS* |
Ga0126374_101575122 | 3300009792 | Tropical Forest Soil | MSNQEGCAMLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAS* |
Ga0126380_100463231 | 3300010043 | Tropical Forest Soil | GRHAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS* |
Ga0126380_105897502 | 3300010043 | Tropical Forest Soil | REDMAMLAEIFMLRLEAAARAAKAVATSSRFVPITLPAAKAS* |
Ga0126380_106234681 | 3300010043 | Tropical Forest Soil | VKALEGAAMLAEIFMLRLEAATRAAKETANTSNNSRFVPITLPVAKAS* |
Ga0126380_120476422 | 3300010043 | Tropical Forest Soil | MLAEVFMLRLETAARVVKFEAATPSRFVPITLPAAKTS* |
Ga0126384_120230171 | 3300010046 | Tropical Forest Soil | MLAEIFMLRLEAVARTAKEAATTNSGSRFVPITLPAAKAS* |
Ga0126382_100249841 | 3300010047 | Tropical Forest Soil | MLAEIYMLRLEAAARTAKEAAAASSDPRFVPITSPATRAG* |
Ga0126373_120821212 | 3300010048 | Tropical Forest Soil | MLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAK |
Ga0126376_107883372 | 3300010359 | Tropical Forest Soil | MLAEIFMLRVEAEARTAKDEVTSSRFVPITLPTPVVKES* |
Ga0126376_119544751 | 3300010359 | Tropical Forest Soil | MLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKA |
Ga0126378_122871782 | 3300010361 | Tropical Forest Soil | MLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAP* |
Ga0126377_103527762 | 3300010362 | Tropical Forest Soil | MAMLAEIFMLRLEAAARAAKAVATSSRFVPITLPAVKAS* |
Ga0126377_120258691 | 3300010362 | Tropical Forest Soil | NRQPVKALEGTAMLAEIFMLRLEAATRAAGETANTSNNSRFVPITLPVAKAS* |
Ga0126379_120618371 | 3300010366 | Tropical Forest Soil | TAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS* |
Ga0105239_108857791 | 3300010375 | Corn Rhizosphere | PLVRSAVMLAEIYMLRLEAAARAAKESATSSSQFVPVSLPAVKAS* |
Ga0126381_1006635063 | 3300010376 | Tropical Forest Soil | MLAEIFMLRVEAAARVAKEAAATTSSSRFVPIIMLGGKT* |
Ga0126381_1038083891 | 3300010376 | Tropical Forest Soil | QPWSTAMLAEIFMLRLEAAARVAKKATTRSRFVPITLPAAMAS* |
Ga0126381_1044404121 | 3300010376 | Tropical Forest Soil | TMLAEIFMLRLEAAARVAKFESATPSRFVPITLPAARAS* |
Ga0134121_123177031 | 3300010401 | Terrestrial Soil | MLAEIYMLRLEAAARAAKESATSSSQFVPVSLPAVKKS* |
Ga0124850_10042422 | 3300010863 | Tropical Forest Soil | MLAEIFMLRLEAAARAAKEAAPPPRFVPITLPAAKAS* |
Ga0124844_11202952 | 3300010868 | Tropical Forest Soil | MLAEIYMLKLEAAVRATKEAATAVSTSRFVPATLPAAKAS* |
Ga0137374_106157691 | 3300012204 | Vadose Zone Soil | RGEPWSTAMLAEIFMLKLEAAARAAKLPSPSSQFVPVTLPAAKAS* |
Ga0150985_1112159592 | 3300012212 | Avena Fatua Rhizosphere | MLAEIYMLRLEAAARAPKEAATSSSQFVPISLPALKAK* |
Ga0150985_1129790291 | 3300012212 | Avena Fatua Rhizosphere | MLAEIYMLRLEAAARAANESATSSSQFVPVSLPAVKAS* |
Ga0150985_1173919801 | 3300012212 | Avena Fatua Rhizosphere | MLAEIYMLRLEAAARAAKEVATSSSQFVPVSLPAVKKS* |
Ga0150985_1194903212 | 3300012212 | Avena Fatua Rhizosphere | TKMLAEIYMLRLEATARAAKEAAIIRSTSGFVPVTLPPVKAS* |
Ga0137369_108312482 | 3300012355 | Vadose Zone Soil | MLAEIFMLKLEAAARAAKLPSPSSQFVPVTLPAAKAS* |
Ga0137371_101688841 | 3300012356 | Vadose Zone Soil | IIGSKPRSTAMLAEIFMLKLEAAARTAKEATRFVPITLPAPAAKAS* |
Ga0137371_104118652 | 3300012356 | Vadose Zone Soil | MLAEIFMLKLEAAARTAKEATRFVPITLPAAKAS* |
Ga0126375_109004391 | 3300012948 | Tropical Forest Soil | MLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAS* |
Ga0164300_101078631 | 3300012951 | Soil | MLAEIYMLRLEAAARAAKEVATSSSQFVPVSLPAVKAS* |
Ga0164300_101227311 | 3300012951 | Soil | MLAEIFMLRLEAAVRAAKEAAACQRFVPITLSPAKTT* |
Ga0164300_101791423 | 3300012951 | Soil | MMAEIFMLRLEAAARAAKEAAATSSRFVPIKLPAAKAS* |
Ga0164303_101856843 | 3300012957 | Soil | MLAEIYMLRLEAAALAAKEAITSSSRFVPISLPAVKAS* |
Ga0164303_111886021 | 3300012957 | Soil | SPLARSAVMLAEIYMLRLEAAARAAKEAATSSSQFVPISLPVKAK* |
Ga0164301_102039532 | 3300012960 | Soil | AMLAEIFMIRLEAVARAAKEAANSPRFVPVTLPAAKAS* |
Ga0164302_113436672 | 3300012961 | Soil | MLAEIYMLRLEAAARAAKEAATSSSRFVPVSLPAVKAS* |
Ga0126369_107131472 | 3300012971 | Tropical Forest Soil | MLAEIYLLNLEAAVRAAKEAATTVSTLRFVPITLPAAKAS* |
Ga0126369_124425241 | 3300012971 | Tropical Forest Soil | EIFMLRLEAAARAAKFEAAIPSRFVPITLPASAP* |
Ga0164309_113154652 | 3300012984 | Soil | ARSAVMLAEIYMLRLEAAARAAKQGATSSSQFVPVSLPAVKAS* |
Ga0157375_112090581 | 3300013308 | Miscanthus Rhizosphere | MLAEIYMLRLEAAARAAKEAATSSSQFVPISLPTLKAK* |
Ga0157380_122742481 | 3300014326 | Switchgrass Rhizosphere | QSPLVRSAVMLAEIYMLRLEAAARAAKESATSSSQFVPVSLPAVKAS* |
Ga0132257_1004490112 | 3300015373 | Arabidopsis Rhizosphere | LARSAVMLAEIYMLRLEAAARAAKEAAISSSQFVPISLPVKAK* |
Ga0132257_1008874512 | 3300015373 | Arabidopsis Rhizosphere | MMAEIFMLRLEAAARAAKEAAGTSARFVLITLLTAKAS* |
Ga0132255_1013907931 | 3300015374 | Arabidopsis Rhizosphere | MLAEIYMLRLEAAARAAKGAATSSSRFVPVSLPGPKAS* |
Ga0182036_103847411 | 3300016270 | Soil | MLAEIFMLRLETAIRAVKETAANGSRFVPITLSSAKAS |
Ga0182041_102068611 | 3300016294 | Soil | AMLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS |
Ga0182041_122308821 | 3300016294 | Soil | PGRHAMLAEIFMLRLEAAARAAKEAANCSRFVPIPTAKAS |
Ga0182032_103935183 | 3300016357 | Soil | MLAEIFMIRLEAVARAAKEAANSPRFVPITLPAAKAS |
Ga0182034_113377571 | 3300016371 | Soil | YAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0182034_115589242 | 3300016371 | Soil | AEIFMLRLEAAARVVKFEAATPSRFVPITLLAAKAS |
Ga0182034_119964672 | 3300016371 | Soil | LAEIFILRLEAVARAAKEAAPPSRFVPITLPAAKES |
Ga0182040_117519861 | 3300016387 | Soil | EIFMLRLEAAARVAKFEAATPSRFVPITLPAAKAS |
Ga0163161_114150072 | 3300017792 | Switchgrass Rhizosphere | MLAEIFFLRLEATARATKEATVTSSNSRFVPITLPTAKAS |
Ga0184619_102241332 | 3300018061 | Groundwater Sediment | MLAEIYMLRLEAAARGAKEAATSSSRFVPVSLPGPKAS |
Ga0184647_11170083 | 3300019263 | Groundwater Sediment | LARSTVMLAEIYMLRLEAAARGAKEAATSSSRFVPVSLPDVKAS |
Ga0184647_13017581 | 3300019263 | Groundwater Sediment | LVRSAVMLAEIYMLRLEAAARAAKESATSSSQFVPVSLPAVKAS |
Ga0193701_11009131 | 3300019875 | Soil | MLAEIFMLRLEATARAAKEAATITRTTSPFVPITLPPVKAS |
Ga0193703_10251161 | 3300019876 | Soil | MLAEIFFLRLEATARATKEATVTSSNSRFVPIALPTAKAS |
Ga0193707_11277633 | 3300019881 | Soil | MLAEIFMLRLEATARAAKEAATITRSTSPFVPVTL |
Ga0193696_10218411 | 3300020016 | Soil | MLAEIFFLRLEATARATKEATVTSSNSRFVPITLPTAKA |
Ga0210380_101097363 | 3300021082 | Groundwater Sediment | MLAEIYMLRLEAAARAAKESATSSSQFVPVSLPAVKAS |
Ga0193699_102360302 | 3300021363 | Soil | MMAEIFMLRLEAAARAAKEAATTNSRFVPITLAAAKAS |
Ga0210392_113616561 | 3300021475 | Soil | MMAEIFMLRLEAAARAAKEAAATSSRFVPIKLPAAKAS |
Ga0126371_110129912 | 3300021560 | Tropical Forest Soil | MLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAS |
Ga0126371_121306491 | 3300021560 | Tropical Forest Soil | MLAEIFMLRLEAAARVAKFEAATPSRFVPITLPAAKAS |
Ga0126371_130754301 | 3300021560 | Tropical Forest Soil | MLAEIFMIRLEAVARAAKEAANSPRFVPVTLPAAKAS |
Ga0222623_103634262 | 3300022694 | Groundwater Sediment | MEGTAMMAEIFMLRLEAAARAAKEAAATSSRFVPIKLPPAKAS |
Ga0207685_103391812 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAEIFMIRLEAVARAAKEAANSPRFVPVRLPLIK |
Ga0207684_109678851 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TGANHGGCAMLAEIFMIRLEAVARAAKEAANSPRFVPVTLPAAKAS |
Ga0207657_105481631 | 3300025919 | Corn Rhizosphere | MLAEIYMLRLEAAARAAKEAATSSSQFVPISLPVKAK |
Ga0207678_119392922 | 3300026067 | Corn Rhizosphere | MLAEIYMLRLEAAARAAKEAATSSSQFVPVSLPAVKKS |
Ga0209213_10112804 | 3300027383 | Forest Soil | MLAEIYMLRLEAAARAAKEAATSSSQFVPVSLPAVKAS |
Ga0209466_10142391 | 3300027646 | Tropical Forest Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS |
Ga0209465_104688261 | 3300027874 | Tropical Forest Soil | MERTSMLAEIFMLRLEATARAAKEAAPPARFIPIALPAAKAS |
Ga0207428_101626822 | 3300027907 | Populus Rhizosphere | MLAEIYMLRLEAAARATATATTNSRFVPITLPALPHQ |
Ga0209382_102157653 | 3300027909 | Populus Rhizosphere | MDGTAMLVEIFMLRLEAAARAAKEAAATNSRFVPMTLPAAKAS |
Ga0307322_101225271 | 3300028710 | Soil | MLAEIFFLRLEATARATKEATVTSSNSRFVPITLPSAKAS |
Ga0307285_101860762 | 3300028712 | Soil | MLAEIYMLRLEATARAAKEAAITRSTSVFVPVTLPPVKAS |
Ga0307311_100724463 | 3300028716 | Soil | PLSKGGTTMLAEIFMLRLEATARAAKEAATITRTTSPFVPITLPPVKAS |
Ga0307298_100377443 | 3300028717 | Soil | MLAEIFFLRLEATARATKEATVTSSKSRFVPITLPSAKAS |
Ga0307301_102672542 | 3300028719 | Soil | MLAEIYMLRLEAAARAAKQGATSSSQFVPVSLPAVKAS |
Ga0307317_100992442 | 3300028720 | Soil | MLAEIFMLRLEAAARAAKEAAATSSRFVPIKLPPAKAS |
Ga0307323_103146191 | 3300028787 | Soil | MMAEIFMLRLEAAARAAKEAAATSSRFVPIKLPPAKAS |
Ga0307294_100728741 | 3300028810 | Soil | MLAEIFFLRLEATARATKEATVTSSNSRFVPITLPTAK |
Ga0307289_102142452 | 3300028875 | Soil | TVMLAEIYMLRLEAAARGAKEAATSSSRFVPVSLPGPKAS |
Ga0307289_104961301 | 3300028875 | Soil | MLAEIFMLRLEAAARAAKEAAATSSRFVPIKLPPAK |
Ga0307277_100052504 | 3300028881 | Soil | MLAEIFTLRVGAAARVAKEAAATSSSGFVTLLAGKA |
Ga0307277_100219923 | 3300028881 | Soil | MLAEIFMLRLETAARVAKFEAATPSRFVPITLPGVRAS |
Ga0308192_10375432 | 3300031082 | Soil | MLAEIYMLRLEAAARTAKEAATSSSRFVPVSLPGPKAS |
Ga0308181_11301161 | 3300031099 | Soil | TKMLAEIYMLRLEATARAAKEAAITRSTSVFVPVTLPPVKAS |
Ga0307501_101840212 | 3300031152 | Soil | MAMLAEIYMLRLEAAARAAKEPARFIPITLAVKAS |
Ga0318516_101185574 | 3300031543 | Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPTTLPTAKAS |
Ga0318516_106732611 | 3300031543 | Soil | GCAMLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAS |
Ga0318534_100282756 | 3300031544 | Soil | MLAEIFMLRLEAVARAAKEAAPPSRFVPITLPAAKES |
Ga0318541_105615621 | 3300031545 | Soil | AMLAEIFMLQLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0318538_101508271 | 3300031546 | Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPLTLPTAKAS |
Ga0318538_102581021 | 3300031546 | Soil | MLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAADRFR |
Ga0318538_104238981 | 3300031546 | Soil | MLAEIFMLRLEAAARAAQEAANSSRFVPITLPSAKAS |
Ga0318538_105009881 | 3300031546 | Soil | ANQGGCAMLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAS |
Ga0318528_101907781 | 3300031561 | Soil | GGTAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0310915_100171711 | 3300031573 | Soil | AEIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS |
Ga0310915_105417722 | 3300031573 | Soil | MLAEIFMVRLEAAARAAKEAAATTPSRFVPITLPAAKAS |
Ga0318555_100533231 | 3300031640 | Soil | RFFMLRLEAAARMAKFEAATSSRFVPITLPAVKAS |
Ga0318555_103386121 | 3300031640 | Soil | GCAMLAEIFMIRLEAVARAAKEAANSPRFVPVTLPAAKAS |
Ga0318574_101887992 | 3300031680 | Soil | PWSTAMLAEIFMLRLEAAARVAKFEAATSSRFVPITLPAAKAS |
Ga0318574_107957791 | 3300031680 | Soil | PWSTAMLAEIFMLRLEAAARVAKFEAATPSRFVPITLPAAKAS |
Ga0306917_105789263 | 3300031719 | Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAK |
Ga0318493_102647311 | 3300031723 | Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPTTLPTAK |
Ga0307468_1021300841 | 3300031740 | Hardwood Forest Soil | MLAEIYMLRLEAAARAAKEVATSSSQFVPVSLPAVKKS |
Ga0306918_102009524 | 3300031744 | Soil | AMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0306918_105131382 | 3300031744 | Soil | MWRTAMLAEIFMVRLEAAARAAKEAAATTPSRFVPITLPAAKAS |
Ga0306918_106108361 | 3300031744 | Soil | MLAEIFMLRLEAAARAAKEAANCSRFVPITLPTAKA |
Ga0318494_108558551 | 3300031751 | Soil | MLAEIFMIRLEAIARAAKEAANIPRFVPVTLPAAK |
Ga0318537_100236433 | 3300031763 | Soil | MLAEIFMLRLEAAARVAKFEAATSSRFVPITLPAAKAS |
Ga0318537_103940402 | 3300031763 | Soil | AMLAEIFMLRLEAAARVAKFEAATPSRFVPITLPAAKAP |
Ga0318554_102156232 | 3300031765 | Soil | NQGGTAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0318554_103664401 | 3300031765 | Soil | NQGGTAMLAEIFMLRLEAAARAAKEATNSSRFVPITLPTAKAS |
Ga0318509_107917422 | 3300031768 | Soil | AEIFMLRLEAAARAAKEAANSSRFVPLTLPTAKAS |
Ga0318546_107376851 | 3300031771 | Soil | MLAEIFMLRLEATARAAKEAAPPSRFVPITSPAAKA |
Ga0318547_102489571 | 3300031781 | Soil | MLAEIFMLRLEAAARVVKFEAATPSRFVPITLLAAKAS |
Ga0318548_100994001 | 3300031793 | Soil | GTAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0318557_104106302 | 3300031795 | Soil | PGRHAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0318517_105108941 | 3300031835 | Soil | HAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS |
Ga0306919_100702491 | 3300031879 | Soil | MLAVIFMLRLEAAARVAKFEAATSSRFLPITLPAVKAS |
Ga0306919_101777643 | 3300031879 | Soil | TAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0306919_101969973 | 3300031879 | Soil | KPRRYAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS |
Ga0306919_104849442 | 3300031879 | Soil | YAMLAEIFMPRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0318544_100240111 | 3300031880 | Soil | LAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0318544_103566621 | 3300031880 | Soil | TAMLAEIFMLRLEAAARVAKFEAATPSRFVPITLPAAKAS |
Ga0306925_100993364 | 3300031890 | Soil | MLAEIFMLRLEAAARAAKEAAPPPRFVPITLPAAKAS |
Ga0306925_102355684 | 3300031890 | Soil | MLAEIFMIRLEAIARAAKEAANIPRFVPVTLPAAKAS |
Ga0306925_102545574 | 3300031890 | Soil | MVAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0306925_105255201 | 3300031890 | Soil | MLAEIFMLRLEAAARAAKEAATHSQFVPITLPATKAS |
Ga0306921_101411851 | 3300031912 | Soil | MLAEIFMLRLEAAARAAKEAANCSRFVPIPTAKAS |
Ga0306921_105857921 | 3300031912 | Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKA |
Ga0310912_100732761 | 3300031941 | Soil | MLVVLRLEAAARAAKEAANSSRFVPITMPTAKASYIPDV |
Ga0310910_110723091 | 3300031946 | Soil | PEQPWSTAMLAEIFMLRLEAAARVAKFEAATPSRFVPITLPAAKAS |
Ga0310909_106594691 | 3300031947 | Soil | AECKPRRCAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAKAS |
Ga0318531_100474281 | 3300031981 | Soil | AEIFMLRLEAAARAAKEAANSSRFVPTTLPTAKAS |
Ga0306922_103161171 | 3300032001 | Soil | MLAEIFVLRLEAAARAAKEAANSSRFVPITLPSAKAS |
Ga0318545_100281841 | 3300032042 | Soil | STAMLAKIFMLRLEAAARAAKKATTRSRFVPIRLPAAKAS |
Ga0318532_100337601 | 3300032051 | Soil | NQGGCAMLAEIFMLRLEAAARVVKFEAATPSRFVPITLPAAKAS |
Ga0318533_102674963 | 3300032059 | Soil | GANQGGTAMLAEIFMLRLEAAARAAKEATNSSRFVPITLPTAKAS |
Ga0318533_109885591 | 3300032059 | Soil | MLAEIFMLRLEAAARAAKEAANSSRFVLITLPSAKAS |
Ga0318505_100884954 | 3300032060 | Soil | MLAEIFMLQLEAATRVAEEAAATSSSSRFVPIRLLGGEGVV |
Ga0318524_106060942 | 3300032067 | Soil | SRGEPGRYAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0306924_101162621 | 3300032076 | Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKVS |
Ga0306924_105755921 | 3300032076 | Soil | AGANQGGTAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0306920_1004998783 | 3300032261 | Soil | MLAEIFMLRLEAAARAAKEAANSSRFVPITLPSAK |
Ga0306920_1016617592 | 3300032261 | Soil | MLAEIFMIRLEAVARAAKEAANSPRFVPVRLPAAKAS |
Ga0306920_1031100341 | 3300032261 | Soil | MLAEIYLLKLEAAAGAAKEAATTASTSRFVPITLPAGKAS |
Ga0318519_102902851 | 3300033290 | Soil | RYAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0318519_108120761 | 3300033290 | Soil | GANQGGTAMLAEIFMLRLEAAARAAKEAANSSRFVPITLPTAKAS |
Ga0370544_16326_346_462 | 3300034447 | Soil | MLAEIYMLRLEAAARAAKEAATSSSRFVPVSLPGPKAS |
Ga0370545_064916_602_736 | 3300034643 | Soil | LARSAAMLAEIYMLRLEAAARAAKEAATSSSRFVPVSLPAVKAS |
⦗Top⦘ |