Metagenome / Metatranscriptome Family F021762

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F021762
Family Type	Metagenome / Metatranscriptome
Number of Sequences	217
Average Sequence Length	36 residues
Representative Sequence	MKYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Number of Associated Samples	119
Number of Associated Scaffolds	215

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	87.04 %
% of genes near scaffold ends (potentially truncated)	16.13 %
% of genes from short scaffolds (< 2000 bps)	79.72 %
Associated GOLD sequencing projects	111
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (84.793 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (11.982 % of family members)
Environment Ontology (ENVO)	Unclassified (42.857 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.926 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 12.50% β-sheet: 0.00% Coil/Unstructured: 87.50%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.23
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 215 Family Scaffolds
PF13620	CarboxypepD_reg	8.37
PF07687	M20_dimer	6.98
PF01546	Peptidase_M20	5.12
PF00793	DAHP_synth_1	4.65
PF00015	MCPsignal	4.19
PF14498	Glyco_hyd_65N_2	2.79
PF01434	Peptidase_M41	2.33
PF17200	sCache_2	1.40
PF06057	VirJ	0.93
PF00326	Peptidase_S9	0.93
PF00733	Asn_synthase	0.93
PF11138	DUF2911	0.93
PF07495	Y_Y_Y	0.93
PF12710	HAD	0.47
PF00510	COX3	0.47
PF09924	LPG_synthase_C	0.47
PF12697	Abhydrolase_6	0.47
PF02153	PDH_N	0.47
PF09937	DUF2169	0.47
PF10067	DUF2306	0.47
PF03446	NAD_binding_2	0.47
PF00005	ABC_tran	0.47
PF07485	DUF1529	0.47
PF02583	Trns_repr_metal	0.47
PF07715	Plug	0.47
PF00970	FAD_binding_6	0.47
PF13545	HTH_Crp_2	0.47
PF07859	Abhydrolase_3	0.47
PF01979	Amidohydro_1	0.47

COG ID	Name	Functional Category	% Frequency in 215 Family Scaffolds
COG0840	Methyl-accepting chemotaxis protein (MCP)	Signal transduction mechanisms [T]	8.37
COG0465	ATP-dependent Zn proteases	Posttranslational modification, protein turnover, chaperones [O]	2.33
COG0642	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.93
COG3946	Type IV secretory pathway, VirJ component	Intracellular trafficking, secretion, and vesicular transport [U]	0.93
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	0.47
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.47
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	0.47
COG1937	DNA-binding transcriptional regulator, FrmR family	Transcription [K]	0.47

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	84.79 %
Unclassified	root	N/A	15.21 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	84.79 %
Unclassified	root	N/A	15.21 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	84.79 %
Unclassified	root	N/A	15.21 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	54.38 %
Unclassified	root	N/A	15.21 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.38 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.92 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.46 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	54.38 %
Unclassified	root	N/A	15.21 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.38 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.92 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.46 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.46 %

Name	Rank	Taxonomy	Distribution
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	35.48 %
Unclassified	root	N/A	15.21 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	2.76 %
Opitutae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	0.92 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.46 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.46 %
Caulobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales	0.46 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.46 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.46 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples	0.46 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	35.48 %
Unclassified	root	N/A	15.21 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	2.76 %
Opitutae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	0.92 %
Alphaproteobacteria bacterium ADurb.BinA305	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.BinA305	0.46 %
Caulobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae	0.46 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.46 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.46 %
uncultured Gemmatimonadota bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium	0.46 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.46 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	35.48 %
Unclassified	root	N/A	15.21 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	2.76 %
Opitutae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	0.92 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.46 %
Caulobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter	0.46 %
Alphaproteobacteria bacterium ADurb.BinA305	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.BinA305	0.46 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.46 %
uncultured Gemmatimonadota bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium	0.46 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.46 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	35.48 %
Unclassified	root	N/A	15.21 %
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	1.84 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	0.92 %
Opitutae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	0.92 %
Micromonospora	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora	0.46 %
Caulobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter	0.46 %
Alphaproteobacteria bacterium ADurb.BinA305	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.BinA305	0.46 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.46 %
uncultured Gemmatimonadota bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium	0.46 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.46 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	35.48 %
Unclassified	root	N/A	15.21 %
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1.84 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.92 %
Opitutae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	0.92 %
Micromonospora saelicesensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora saelicesensis	0.46 %
Caulobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter	0.46 %
Alphaproteobacteria bacterium ADurb.BinA305	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.BinA305	0.46 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.46 %
uncultured Gemmatimonadota bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium	0.46 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.46 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886012\|MBSR1b_contig_13559191	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1334	Open in IMG/M
2170459014\|G1P06HT01D6BZ8	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	525	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c0656291	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1644	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100579464	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1173	Open in IMG/M
3300000789\|JGI1027J11758_12106406	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	544	Open in IMG/M
3300000890\|JGI11643J12802_12137947	Not Available	776	Open in IMG/M
3300000956\|JGI10216J12902_100970637	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	871	Open in IMG/M
3300000956\|JGI10216J12902_102227490	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1312	Open in IMG/M
3300000956\|JGI10216J12902_111109421	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	768	Open in IMG/M
3300005093\|Ga0062594_101138441	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	767	Open in IMG/M
3300005364\|Ga0070673_101439975	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	649	Open in IMG/M
3300005543\|Ga0070672_100014906	All Organisms → cellular organisms → Bacteria	5519	Open in IMG/M
3300005543\|Ga0070672_100019144	All Organisms → cellular organisms → Bacteria	4963	Open in IMG/M
3300005543\|Ga0070672_100032258	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	3951	Open in IMG/M
3300005543\|Ga0070672_100084331	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2551	Open in IMG/M
3300005543\|Ga0070672_100093881	All Organisms → cellular organisms → Bacteria	2424	Open in IMG/M
3300005543\|Ga0070672_100470270	All Organisms → cellular organisms → Bacteria	1085	Open in IMG/M
3300005543\|Ga0070672_100549621	All Organisms → cellular organisms → Bacteria	1002	Open in IMG/M
3300005543\|Ga0070672_100591709	Not Available	966	Open in IMG/M
3300005543\|Ga0070672_100904374	Not Available	780	Open in IMG/M
3300005564\|Ga0070664_100014444	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	6438	Open in IMG/M
3300005564\|Ga0070664_100019291	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	5609	Open in IMG/M
3300005564\|Ga0070664_100034967	All Organisms → cellular organisms → Bacteria	4217	Open in IMG/M
3300005564\|Ga0070664_100039541	All Organisms → cellular organisms → Bacteria	3974	Open in IMG/M
3300005564\|Ga0070664_100088547	All Organisms → cellular organisms → Bacteria	2677	Open in IMG/M
3300005564\|Ga0070664_100094362	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2594	Open in IMG/M
3300005564\|Ga0070664_100178748	All Organisms → cellular organisms → Bacteria	1885	Open in IMG/M
3300005564\|Ga0070664_100178748	All Organisms → cellular organisms → Bacteria	1885	Open in IMG/M
3300005564\|Ga0070664_100505156	Not Available	1115	Open in IMG/M
3300005564\|Ga0070664_100586780	Not Available	1033	Open in IMG/M
3300005616\|Ga0068852_100994073	All Organisms → cellular organisms → Bacteria	857	Open in IMG/M
3300005616\|Ga0068852_102064349	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	592	Open in IMG/M
3300005719\|Ga0068861_100733337	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	921	Open in IMG/M
3300005719\|Ga0068861_101654405	Not Available	632	Open in IMG/M
3300005841\|Ga0068863_100491678	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1207	Open in IMG/M
3300006031\|Ga0066651_10056753	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1850	Open in IMG/M
3300006046\|Ga0066652_100000792	All Organisms → cellular organisms → Bacteria	15657	Open in IMG/M
3300006046\|Ga0066652_100000812	All Organisms → cellular organisms → Bacteria	15462	Open in IMG/M
3300006606\|Ga0074062_12462986	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1464	Open in IMG/M
3300006755\|Ga0079222_10624236	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300006791\|Ga0066653_10050529	All Organisms → cellular organisms → Bacteria	1729	Open in IMG/M
3300006846\|Ga0075430_100167673	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1827	Open in IMG/M
3300006853\|Ga0075420_100875110	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300006876\|Ga0079217_10007110	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	3419	Open in IMG/M
3300006876\|Ga0079217_10026507	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2109	Open in IMG/M
3300006876\|Ga0079217_10307927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	882	Open in IMG/M
3300006881\|Ga0068865_100703632	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300006894\|Ga0079215_10953468	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	623	Open in IMG/M
3300006918\|Ga0079216_10116646	All Organisms → cellular organisms → Bacteria	1327	Open in IMG/M
3300006918\|Ga0079216_10783407	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300007004\|Ga0079218_10228264	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1448	Open in IMG/M
3300007004\|Ga0079218_10247464	All Organisms → cellular organisms → Bacteria	1404	Open in IMG/M
3300009148\|Ga0105243_11016307	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300009156\|Ga0111538_11989327	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	731	Open in IMG/M
3300009174\|Ga0105241_10568286	All Organisms → cellular organisms → Bacteria	1020	Open in IMG/M
3300009174\|Ga0105241_10680185	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	937	Open in IMG/M
3300009174\|Ga0105241_11455591	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	658	Open in IMG/M
3300009174\|Ga0105241_11512665	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	646	Open in IMG/M
3300009177\|Ga0105248_10457073	All Organisms → cellular organisms → Bacteria	1439	Open in IMG/M
3300009551\|Ga0105238_10314415	All Organisms → cellular organisms → Bacteria	1551	Open in IMG/M
3300009789\|Ga0126307_10032444	All Organisms → cellular organisms → Bacteria	4023	Open in IMG/M
3300009789\|Ga0126307_10060031	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2982	Open in IMG/M
3300009789\|Ga0126307_10078969	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2596	Open in IMG/M
3300009789\|Ga0126307_10675886	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	833	Open in IMG/M
3300009789\|Ga0126307_10848811	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	737	Open in IMG/M
3300009789\|Ga0126307_11595456	Not Available	530	Open in IMG/M
3300009789\|Ga0126307_11691167	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	514	Open in IMG/M
3300009840\|Ga0126313_10169527	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1661	Open in IMG/M
3300009840\|Ga0126313_10678289	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	834	Open in IMG/M
3300009840\|Ga0126313_10900542	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	722	Open in IMG/M
3300009840\|Ga0126313_11142214	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	641	Open in IMG/M
3300009840\|Ga0126313_11463212	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	567	Open in IMG/M
3300010036\|Ga0126305_10065050	All Organisms → cellular organisms → Bacteria	2110	Open in IMG/M
3300010037\|Ga0126304_11189263	Not Available	522	Open in IMG/M
3300010039\|Ga0126309_10104006	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1466	Open in IMG/M
3300010039\|Ga0126309_10185473	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1142	Open in IMG/M
3300010039\|Ga0126309_10246902	Not Available	1009	Open in IMG/M
3300010040\|Ga0126308_10016172	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	3921	Open in IMG/M
3300010041\|Ga0126312_10637764	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	767	Open in IMG/M
3300010041\|Ga0126312_11242987	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	550	Open in IMG/M
3300010042\|Ga0126314_10767133	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300010042\|Ga0126314_11117986	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	587	Open in IMG/M
3300010044\|Ga0126310_11030561	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300010166\|Ga0126306_10015608	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4919	Open in IMG/M
3300010166\|Ga0126306_10535557	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	929	Open in IMG/M
3300010166\|Ga0126306_10803616	Not Available	759	Open in IMG/M
3300010321\|Ga0134067_10288243	Not Available	630	Open in IMG/M
3300010375\|Ga0105239_10179868	All Organisms → cellular organisms → Bacteria	2366	Open in IMG/M
3300010403\|Ga0134123_10445729	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1202	Open in IMG/M
3300010403\|Ga0134123_11293436	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	764	Open in IMG/M
3300011119\|Ga0105246_11465443	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	640	Open in IMG/M
3300012212\|Ga0150985_101171846	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300012212\|Ga0150985_101607382	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	550	Open in IMG/M
3300012212\|Ga0150985_101908842	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300012212\|Ga0150985_105867981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter	683	Open in IMG/M
3300012212\|Ga0150985_110267769	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	526	Open in IMG/M
3300012212\|Ga0150985_111962272	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1708	Open in IMG/M
3300012212\|Ga0150985_122347158	Not Available	1211	Open in IMG/M
3300012469\|Ga0150984_107438826	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1134	Open in IMG/M
3300012914\|Ga0157297_10129964	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	796	Open in IMG/M
3300012951\|Ga0164300_10473881	Not Available	708	Open in IMG/M
3300012958\|Ga0164299_11241883	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	566	Open in IMG/M
3300012984\|Ga0164309_11740960	Not Available	535	Open in IMG/M
3300012986\|Ga0164304_11507853	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	556	Open in IMG/M
3300012987\|Ga0164307_11042934	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	668	Open in IMG/M
3300012989\|Ga0164305_10312079	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1167	Open in IMG/M
3300013100\|Ga0157373_10831213	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	682	Open in IMG/M
3300013102\|Ga0157371_10178322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.BinA305	1519	Open in IMG/M
3300013104\|Ga0157370_12132281	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	502	Open in IMG/M
3300013297\|Ga0157378_12427294	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	576	Open in IMG/M
3300013307\|Ga0157372_11526971	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	769	Open in IMG/M
3300014326\|Ga0157380_11070199	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	844	Open in IMG/M
3300014326\|Ga0157380_11948392	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	649	Open in IMG/M
3300014745\|Ga0157377_10958561	Not Available	644	Open in IMG/M
3300015262\|Ga0182007_10072807	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1126	Open in IMG/M
3300015262\|Ga0182007_10120987	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	876	Open in IMG/M
3300015371\|Ga0132258_10440772	All Organisms → cellular organisms → Bacteria	3245	Open in IMG/M
3300015371\|Ga0132258_10798008	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2380	Open in IMG/M
3300015371\|Ga0132258_12839020	All Organisms → cellular organisms → Bacteria	1206	Open in IMG/M
3300015373\|Ga0132257_101357948	Not Available	903	Open in IMG/M
3300017792\|Ga0163161_10680120	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	855	Open in IMG/M
3300017792\|Ga0163161_11009906	Not Available	710	Open in IMG/M
3300018433\|Ga0066667_11769054	Not Available	558	Open in IMG/M
3300018433\|Ga0066667_12014825	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	531	Open in IMG/M
3300018466\|Ga0190268_11612267	Not Available	572	Open in IMG/M
3300018476\|Ga0190274_10067765	All Organisms → cellular organisms → Bacteria	2678	Open in IMG/M
3300018476\|Ga0190274_10176779	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1843	Open in IMG/M
3300018476\|Ga0190274_11905817	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	690	Open in IMG/M
3300018920\|Ga0190273_10170167	All Organisms → cellular organisms → Bacteria	1327	Open in IMG/M
3300018920\|Ga0190273_10226720	All Organisms → cellular organisms → Bacteria	1192	Open in IMG/M
3300018920\|Ga0190273_11065171	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	674	Open in IMG/M
3300018920\|Ga0190273_11120086	Not Available	662	Open in IMG/M
3300019361\|Ga0173482_10180594	All Organisms → cellular organisms → Bacteria	848	Open in IMG/M
3300019377\|Ga0190264_11464288	Not Available	590	Open in IMG/M
3300019377\|Ga0190264_12041164	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	527	Open in IMG/M
3300021445\|Ga0182009_10004338	All Organisms → cellular organisms → Bacteria	4345	Open in IMG/M
3300021445\|Ga0182009_10160497	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1073	Open in IMG/M
3300021445\|Ga0182009_10282091	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300021445\|Ga0182009_10588277	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	595	Open in IMG/M
3300022756\|Ga0222622_10020058	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	3386	Open in IMG/M
3300022756\|Ga0222622_10091573	All Organisms → cellular organisms → Bacteria	1847	Open in IMG/M
3300022756\|Ga0222622_10091573	All Organisms → cellular organisms → Bacteria	1847	Open in IMG/M
3300022756\|Ga0222622_10319749	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1073	Open in IMG/M
3300022756\|Ga0222622_10522446	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	850	Open in IMG/M
3300022756\|Ga0222622_11323113	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	530	Open in IMG/M
3300024055\|Ga0247794_10298127	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	542	Open in IMG/M
3300025321\|Ga0207656_10015891	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	2921	Open in IMG/M
3300025321\|Ga0207656_10036520	All Organisms → cellular organisms → Bacteria	2063	Open in IMG/M
3300025552\|Ga0210142_1029455	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1041	Open in IMG/M
3300025899\|Ga0207642_10011315	All Organisms → cellular organisms → Bacteria	3178	Open in IMG/M
3300025900\|Ga0207710_10545582	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	604	Open in IMG/M
3300025903\|Ga0207680_10686651	Not Available	733	Open in IMG/M
3300025904\|Ga0207647_10079949	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1961	Open in IMG/M
3300025907\|Ga0207645_10013894	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	5401	Open in IMG/M
3300025909\|Ga0207705_10405757	All Organisms → cellular organisms → Bacteria	1054	Open in IMG/M
3300025911\|Ga0207654_10887920	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	646	Open in IMG/M
3300025919\|Ga0207657_11288457	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	552	Open in IMG/M
3300025920\|Ga0207649_11128625	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300025926\|Ga0207659_10018952	All Organisms → cellular organisms → Bacteria	4520	Open in IMG/M
3300025931\|Ga0207644_10461123	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	1045	Open in IMG/M
3300025932\|Ga0207690_10266720	All Organisms → cellular organisms → Bacteria	1328	Open in IMG/M
3300025935\|Ga0207709_11460349	Not Available	567	Open in IMG/M
3300025936\|Ga0207670_10009859	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	5470	Open in IMG/M
3300025945\|Ga0207679_10013030	All Organisms → cellular organisms → Bacteria → Acidobacteria	5441	Open in IMG/M
3300025945\|Ga0207679_10026446	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	4001	Open in IMG/M
3300025945\|Ga0207679_10866633	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	825	Open in IMG/M
3300025945\|Ga0207679_11434091	Not Available	633	Open in IMG/M
3300025945\|Ga0207679_12201052	Not Available	500	Open in IMG/M
3300025972\|Ga0207668_10533893	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1014	Open in IMG/M
3300025986\|Ga0207658_10792241	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	860	Open in IMG/M
3300026116\|Ga0207674_10441799	All Organisms → cellular organisms → Bacteria	1257	Open in IMG/M
3300026121\|Ga0207683_10582483	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1035	Open in IMG/M
3300026142\|Ga0207698_10471828	All Organisms → cellular organisms → Bacteria	1215	Open in IMG/M
3300027637\|Ga0209818_1080982	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	834	Open in IMG/M
3300027886\|Ga0209486_10164898	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	1231	Open in IMG/M
3300027886\|Ga0209486_10591723	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	702	Open in IMG/M
3300028754\|Ga0307297_10405235	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	504	Open in IMG/M
3300030336\|Ga0247826_11547045	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	539	Open in IMG/M
3300030496\|Ga0268240_10142725	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	586	Open in IMG/M
3300030905\|Ga0308200_1154545	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	533	Open in IMG/M
3300030988\|Ga0308183_1167366	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	552	Open in IMG/M
3300031058\|Ga0308189_10522375	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	514	Open in IMG/M
3300031446\|Ga0170820_16597722	Not Available	584	Open in IMG/M
3300031548\|Ga0307408_100195328	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium	1634	Open in IMG/M
3300031548\|Ga0307408_100231135	All Organisms → cellular organisms → Bacteria	1515	Open in IMG/M
3300031548\|Ga0307408_100288194	All Organisms → cellular organisms → Bacteria	1370	Open in IMG/M
3300031548\|Ga0307408_100862027	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	826	Open in IMG/M
3300031548\|Ga0307408_102375568	Not Available	514	Open in IMG/M
3300031716\|Ga0310813_10146826	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1893	Open in IMG/M
3300031731\|Ga0307405_10237125	Not Available	1349	Open in IMG/M
3300031731\|Ga0307405_10448399	All Organisms → cellular organisms → Bacteria	1022	Open in IMG/M
3300031731\|Ga0307405_11027652	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	705	Open in IMG/M
3300031824\|Ga0307413_11517930	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	593	Open in IMG/M
3300031901\|Ga0307406_11321353	Not Available	630	Open in IMG/M
3300031901\|Ga0307406_11662759	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	565	Open in IMG/M
3300031938\|Ga0308175_100003082	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	11506	Open in IMG/M
3300031938\|Ga0308175_100025278	All Organisms → cellular organisms → Bacteria	4818	Open in IMG/M
3300031938\|Ga0308175_100092429	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	2762	Open in IMG/M
3300031938\|Ga0308175_100102173	All Organisms → cellular organisms → Bacteria	2643	Open in IMG/M
3300031938\|Ga0308175_100320724	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1588	Open in IMG/M
3300031938\|Ga0308175_100349695	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1527	Open in IMG/M
3300031938\|Ga0308175_100684625	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora saelicesensis	1112	Open in IMG/M
3300031938\|Ga0308175_102069497	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	638	Open in IMG/M
3300031939\|Ga0308174_10011359	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5155	Open in IMG/M
3300031939\|Ga0308174_11684465	Not Available	545	Open in IMG/M
3300031995\|Ga0307409_102371177	Not Available	560	Open in IMG/M
3300031996\|Ga0308176_11140224	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	826	Open in IMG/M
3300031996\|Ga0308176_12061852	All Organisms → cellular organisms → Bacteria	609	Open in IMG/M
3300032074\|Ga0308173_10006094	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	7116	Open in IMG/M
3300032074\|Ga0308173_10834395	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	850	Open in IMG/M
3300032126\|Ga0307415_101292572	Not Available	691	Open in IMG/M
3300033412\|Ga0310810_10106798	All Organisms → cellular organisms → Bacteria	3330	Open in IMG/M
3300033550\|Ga0247829_10503773	All Organisms → cellular organisms → Bacteria	1003	Open in IMG/M
3300034384\|Ga0372946_0027089	All Organisms → cellular organisms → Bacteria	2532	Open in IMG/M
3300034384\|Ga0372946_0071178	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1599	Open in IMG/M
3300034384\|Ga0372946_0393740	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	673	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	52.53%
Host-Associated	Host-Associated	47.00%
Engineered	Engineered	0.46%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	49.31%
Plants	Host-Associated → Plants	47.00%
Aquatic	Environmental → Aquatic	3.23%
Solid Waste	Engineered → Solid Waste	0.46%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	49.31%
Rhizosphere	Host-Associated → Plants → Rhizosphere	34.56%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.44%
Sediment	Environmental → Aquatic → Sediment	2.77%
Marine	Environmental → Aquatic → Marine	0.46%
Grass	Engineered → Solid Waste → Grass	0.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	48.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	17.97%
Soil	Host-Associated → Plants → Rhizosphere → Soil	16.59%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	5.53%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.77%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.46%
Loam	Environmental → Terrestrial → Soil → Loam	0.46%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.46%
Composting	Engineered → Solid Waste → Grass → Composting	0.46%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	17.97%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	16.59%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	7.37%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.45%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.99%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	5.53%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.77%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.84%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.46%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.46%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.46%

Habitat	Taxonomy	Distribution
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	11.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.06%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	8.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	7.37%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	5.99%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	5.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	5.07%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	3.23%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.23%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.23%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.30%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.30%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.77%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.38%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.38%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.38%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.38%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.92%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.46%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.46%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.46%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.46%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.46%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.46%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
2170459014	Litter degradation PV2	Engineered	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012914	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300024055	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025552	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300028754	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300030496	Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)	Environmental	Open in IMG/M
3300030905	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030988	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300034384	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MBSR1b_0686.00000220	2162886012	Miscanthus Rhizosphere	MTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
2PV_03834770	2170459014	Switchgrass, Maize And Mischanthus Litter	HMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS
ICChiseqgaiiDRAFT_06562911	3300000033	Soil	MKYEKPAVQRYGSLRELTLGNGPRLGGDAVSLYHRS*
INPhiseqgaiiFebDRAFT_1005794642	3300000364	Soil	MKYEKPAVQRYGSLREMTLGNGPRLGGDAVSLYHRS*
JGI1027J11758_121064061	3300000789	Soil	MKYEKPAVQRFGSLREHTLGNGPRLGGDAVSLYHRS*
JGI11643J12802_121379472	3300000890	Soil	EAMHMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
JGI10216J12902_1009706372	3300000956	Soil	MSYQKPTVQRFGSLRELTLGGGAQLSGDATNLYHRS*
JGI10216J12902_1022274903	3300000956	Soil	MTYEKPAVQRFGSLRELTLGGGAQMQGDATNLYHRS*
JGI10216J12902_1111094211	3300000956	Soil	MKYEKPVVQRFGSLRELTLGGGATLEGDATNLYHRS*
Ga0062594_1011384411	3300005093	Soil	QTRENCMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070673_1014399752	3300005364	Switchgrass Rhizosphere	LVLQTRENCMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070672_1000149062	3300005543	Miscanthus Rhizosphere	MKYEKPAVQRFGTVREITLGGGPNLAGDATNQYHRS*
Ga0070672_1000191446	3300005543	Miscanthus Rhizosphere	MYEKPVVQRLGSLRELTLGLGPNLGGDPASVYHRS*
Ga0070672_1000322585	3300005543	Miscanthus Rhizosphere	MTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070672_1000843312	3300005543	Miscanthus Rhizosphere	MYEKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS*
Ga0070672_1000938812	3300005543	Miscanthus Rhizosphere	MKYEKPAVQRFGSLRELTLGNGPRLGGDAVSLYHRS*
Ga0070672_1004702702	3300005543	Miscanthus Rhizosphere	MKYEKPAVQRFGTVREITLGSGPNQPGDATNLYHRS*
Ga0070672_1005496211	3300005543	Miscanthus Rhizosphere	MKYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070672_1005917092	3300005543	Miscanthus Rhizosphere	MYEKPVVQRFGSLRELTLGQGANLGGDATSIYHRS*
Ga0070672_1009043741	3300005543	Miscanthus Rhizosphere	MKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHR
Ga0070664_1000144446	3300005564	Corn Rhizosphere	MTYQKPAVQRFGSLRELTLGGGAQLRGDATNLYHRS*
Ga0070664_1000192912	3300005564	Corn Rhizosphere	MYEKPTVQRLGSLRELTLGLGPNLGGDPASVYHRS*
Ga0070664_1000349672	3300005564	Corn Rhizosphere	MTYEKPMVQRFGTLRELTLGGGPQLSGDATNLYHRS*
Ga0070664_1000395413	3300005564	Corn Rhizosphere	MTYEKPTVQRFGSLRELTLGNGPRLGGDAVSLYHRS*
Ga0070664_1000885472	3300005564	Corn Rhizosphere	MYQKPEVKRFGSVRELTQGGGPAGAGDATNVYHRS*
Ga0070664_1000943623	3300005564	Corn Rhizosphere	MKYEKPVVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0070664_1001787482	3300005564	Corn Rhizosphere	MKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHRS*
Ga0070664_1001787483	3300005564	Corn Rhizosphere	MKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
Ga0070664_1005051562	3300005564	Corn Rhizosphere	MKYEKPAVQRFGTVREITLGGGPNLAGDATNTYHRS*
Ga0070664_1005867802	3300005564	Corn Rhizosphere	MKYEKPAVQRLGTLRELTLGSGPSTPGDATNLYHRS*
Ga0068852_1009940732	3300005616	Corn Rhizosphere	MKYEKPTVQRFGSLRELTLGNGPRLGGDAVSLYHRS*
Ga0068852_1020643491	3300005616	Corn Rhizosphere	MKYEKPAVQRYGSLREITLGNGPRLGGDATSLYHRS*
Ga0068861_1007333372	3300005719	Switchgrass Rhizosphere	MKYEKPAVQRFGSLREVTLGNGPRLGGDAVSLYHRS*
Ga0068861_1016544052	3300005719	Switchgrass Rhizosphere	MKYEKPAVQRWGTLRELTLGSGPNTPGDATSLYHRS*
Ga0068863_1004916783	3300005841	Switchgrass Rhizosphere	TMKYEKPAVQRYGSLRELTLGNGPRLGGDAVSLYHRS*
Ga0066651_100567532	3300006031	Soil	MTYQKPSVQRFGSLRELTLGGGSTLQGDATNLYHRS*
Ga0066652_10000079210	3300006046	Soil	MYEKPEVKRFGSLRELTKGGGPAGGGDAASVYHRS*
Ga0066652_1000008129	3300006046	Soil	MKYEKPVVQRFGSLRELTLGGGSTLQGDATNLYHRS*
Ga0074062_124629863	3300006606	Soil	MKYEKPAVQRYGSLRELTLGNGPRLGGDATSIYHRS*
Ga0079222_106242361	3300006755	Agricultural Soil	MKYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0066653_100505292	3300006791	Soil	LEMKYEKPVVQRFGSLRELTLGGGSTLQGDATNLYHRS*
Ga0075430_1001676733	3300006846	Populus Rhizosphere	MKYEKPAVLRFGSLRELTLGGGPSLEGDATNPYHRS*
Ga0075420_1008751101	3300006853	Populus Rhizosphere	MTYEKPAVQRFGSLRELTLGGGAQLTGDATNLYHRS*
Ga0079217_100071102	3300006876	Agricultural Soil	MYQKPTVQRFGSLRELTLGGGQQLEGDATNLYHRS*
Ga0079217_100265073	3300006876	Agricultural Soil	MKYEKPVVQRFGSLRELTLGGGPQEQGDATNLYHRS*
Ga0079217_103079272	3300006876	Agricultural Soil	MKYEKPVVQRFGSLRELTLGGGPQTQGDATNLYHRS*
Ga0068865_1007036321	3300006881	Miscanthus Rhizosphere	MKYEKPAVQRLGSLRELTLGSGPSTPGDATNLYHRS*
Ga0079215_109534682	3300006894	Agricultural Soil	MKYEKPVVQRFGSLRELTLGGGPQSQGDATNLYHRS*
Ga0079216_101166461	3300006918	Agricultural Soil	MYQKPTVQRFGSLRELTLGGGNQLEGDATNLYHRS*
Ga0079216_107834071	3300006918	Agricultural Soil	MTYEKPAITRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0079218_102282642	3300007004	Agricultural Soil	MYEKPEVKRFGSLRELTQGGGPGLGGDATNVYHRS*
Ga0079218_102474642	3300007004	Agricultural Soil	MSYQKPQVTRYGTLVEVTNGAGANLGGDATSVYHRS*
Ga0105243_110163072	3300009148	Miscanthus Rhizosphere	MKYEKPAVQRFGSLRELTLGGGPQSSGDATNLYHRS*
Ga0111538_119893272	3300009156	Populus Rhizosphere	MYEKPKVERFGTLRELTLGGGPQLGGDGVDPYHRS*
Ga0105241_105682861	3300009174	Corn Rhizosphere	MKYEKPSVQRFGSLRELTLGGGSQRSGDATNLYHRS*
Ga0105241_106801851	3300009174	Corn Rhizosphere	MTKYEKPMVQRFGSLRELTLGGGPELSGDATNLYHRS*
Ga0105241_114555911	3300009174	Corn Rhizosphere	MHMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
Ga0105241_115126651	3300009174	Corn Rhizosphere	MTYQKPVVQRFGSLRELTLGGGPSLSGDATNLYHRS*
Ga0105248_104570732	3300009177	Switchgrass Rhizosphere	MKYEKPAVQRFGTVRESTLGAGQNTPGDATNLYHRS*
Ga0105238_103144154	3300009551	Corn Rhizosphere	YRGESTMKYEKPAVQRYGSLREITLGNGPRLGGDATSLYHRS*
Ga0126307_100324445	3300009789	Serpentine Soil	MKYEKPAVTRFGTVRELTLGGGPQTNGDATNQFHRS*
Ga0126307_100600313	3300009789	Serpentine Soil	MYEKPAVQRFGSLRDLTMGNGPAGGGDATSIWHRS*
Ga0126307_100789691	3300009789	Serpentine Soil	MKYEKPAVQRFGSLRELTLGGGPQTSGDATNQYHRS*
Ga0126307_106758862	3300009789	Serpentine Soil	MKYEKPVVQRFGSLRELTLGGGPQESGDDTNLYHRS*
Ga0126307_108488112	3300009789	Serpentine Soil	MKYEKPVVQRFGSLRELTLGGGPQLAGDATNQFHRS*
Ga0126307_115954561	3300009789	Serpentine Soil	MYEKPAVKRYVNLRDLTTGAGPAGGGDATSIWHRS*
Ga0126307_116911672	3300009789	Serpentine Soil	MTYEKPAVQRFGSLRELTLGGGPSQGGDATNLYHRS*
Ga0126313_101695273	3300009840	Serpentine Soil	MYEKPAVQRFGNLRDLTMGNGPAGGGDATSIWHRS*
Ga0126313_106782891	3300009840	Serpentine Soil	KGVDMYEKPEVKRFGSLRELTQGGGPSGGGDATNVYHRS*
Ga0126313_109005422	3300009840	Serpentine Soil	MTYQKPVVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0126313_111422142	3300009840	Serpentine Soil	MKYEKPTIQRFGTLRELTLGGGPQTSGDATNQFHR
Ga0126313_114632121	3300009840	Serpentine Soil	MKYEKPVVQRFGSLRELTLGGGPQESGDATNLYHRS*
Ga0126305_100650502	3300010036	Serpentine Soil	MTYQKPAVQRFGSLRELTLGGGAQLSGDATNQYHRS*
Ga0126304_111892631	3300010037	Serpentine Soil	KSPGGCMKYEKPAVTRFGTVRELTLGGGPQTNGDATNQFHRS*
Ga0126309_101040062	3300010039	Serpentine Soil	MKYEKPAVQRFGSLRELTLGGGPNLAGDATNQYHRS*
Ga0126309_101854731	3300010039	Serpentine Soil	MKYEKPVVQRFGSLRELTLGGGPQMAGDATNQYHRS*
Ga0126309_102469021	3300010039	Serpentine Soil	MKNEKVKVYEKPAIQRYGTFRELTLGTGPIPSGDATNLYHRS*
Ga0126308_100161723	3300010040	Serpentine Soil	MTYQKPAVQRFGSLRELTLGGGPSLAGDATNQYHRS*
Ga0126312_106377641	3300010041	Serpentine Soil	MKYEKPVVQRFGSLRELTLGGGAQTTGDATNLYHRS*
Ga0126312_112429872	3300010041	Serpentine Soil	MYEKPAVQRFGTLRDLTMGNGPAGGGDATSIYHRS*
Ga0126314_107671332	3300010042	Serpentine Soil	MKYEKPVVQRFGTLREMTLGGGPLSGGDATNVFHRS*
Ga0126314_111179861	3300010042	Serpentine Soil	MTYQKPSVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0126310_110305612	3300010044	Serpentine Soil	STMTYEKPSVQRFGSLRELTLGNGPKLGGDATSLYHRS*
Ga0126306_100156083	3300010166	Serpentine Soil	MYEKPAVQRFGNLRDLTMGNGPSGGGDATSIWHRS*
Ga0126306_105355571	3300010166	Serpentine Soil	MKYEKPVVQRFGTLRELTLGGGPQSMGDATNLYHRS*
Ga0126306_108036162	3300010166	Serpentine Soil	MVYEKPEVKRYGSVTELTLGGGAGMGGDATNLYHRS*
Ga0134067_102882432	3300010321	Grasslands Soil	MKYEKPAVQRFGSLHELTLGAGPRLGGDATSVYHRS*
Ga0105239_101798682	3300010375	Corn Rhizosphere	MHMKYEKPAVQRFGTVREITLGAGNNTPGDATNLYHRS*
Ga0134123_104457292	3300010403	Terrestrial Soil	MYEKPEVKRFGSLRELTQGGGPAGGGDATNMYHRS*
Ga0134123_112934361	3300010403	Terrestrial Soil	MTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHR
Ga0105246_114654431	3300011119	Miscanthus Rhizosphere	IWGRRLAMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
Ga0150985_1011718462	3300012212	Avena Fatua Rhizosphere	MKYEKPVVQRFGTLREMTLGGGPQSAGDATNLFHRS*
Ga0150985_1016073822	3300012212	Avena Fatua Rhizosphere	MTYQKPVVQRFGSLRELTLGGGASLAGDATNLYHRS*
Ga0150985_1019088421	3300012212	Avena Fatua Rhizosphere	MYQKPEVERFGSLRELTKGGAQAHGGDATNVYHRS*
Ga0150985_1058679812	3300012212	Avena Fatua Rhizosphere	MYEKPVVLRLGSLRELTLGLGPNLGGDPASVYHRS*
Ga0150985_1102677691	3300012212	Avena Fatua Rhizosphere	MKYEKPAVQRFGSLREITLGGGSNSGGDATNLYHRS*
Ga0150985_1119622721	3300012212	Avena Fatua Rhizosphere	MYEKPVVKRFGSLRELTAGMGPNLGGDAQSVYHRS*
Ga0150985_1223471581	3300012212	Avena Fatua Rhizosphere	MYEKPAVQRYGTLREVTLGQGPALGGDATSVFHRS*
Ga0150984_1074388261	3300012469	Avena Fatua Rhizosphere	MYEKPEVQRFGSLRELSKGGAQALGGDATNVYHRS*
Ga0157297_101299642	3300012914	Soil	MKYEKPAVQRFGSLRELSLGGGPAETGDATNLYHRS*
Ga0164300_104738811	3300012951	Soil	MKYEKPAVQRFGTVREITLGAGPNSPGDATNMYHRS*
Ga0164299_112418831	3300012958	Soil	MKYEKPIVQRFGSLRELTLGGGPSLSGDATNLYHRS*
Ga0164309_117409601	3300012984	Soil	MKYEKPAVLRLGSLREVTLGAGPNSPGDATNMYHRS*
Ga0164304_115078531	3300012986	Soil	MHMKYEKPAVQRFGTVREITLGSGQNTPGDATNLYHRS*
Ga0164307_110429342	3300012987	Soil	MKYEKPAVQRFGTVREITLGAGQNMPGDATNLYHRS*
Ga0164305_103120792	3300012989	Soil	MKYEKPAVQRFGSLRELTLGNGPRLGGDAVSLDHRS*
Ga0157373_108312131	3300013100	Corn Rhizosphere	MKYEKPSVQRFGSLRELTLGGGSQLSGDATNLYHRS*
Ga0157371_101783222	3300013102	Corn Rhizosphere	YEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS*
Ga0157370_113264262	3300013104	Corn Rhizosphere	MYEKPTVQRLGTLRELTLGLGPNLGGDPQSVYHRS*
Ga0157370_121322811	3300013104	Corn Rhizosphere	GESTMKYEKPAVQRYGSLRELTLGNGPRLGGDATSLYHRS*
Ga0157378_124272942	3300013297	Miscanthus Rhizosphere	IISGEAIHMKYEKPAVQRFGTVREITLGSGPNTPGDATNLYHRS*
Ga0157372_115269712	3300013307	Corn Rhizosphere	MYRGESTMKYEKPAVQRYGSLRELTLGNGPRLGGDATSLYHRS*
Ga0157380_110701991	3300014326	Switchgrass Rhizosphere	MQYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0157380_119483921	3300014326	Switchgrass Rhizosphere	MKYEKPAVQRFGSLLELTLGGGAQLSGDATNLYHRS*
Ga0157377_109585611	3300014745	Miscanthus Rhizosphere	MKYEKPAVQRLGSVRELTLGSGPSTPGDATNLYHRS*
Ga0182007_100728071	3300015262	Rhizosphere	MYQKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS*
Ga0182007_101209872	3300015262	Rhizosphere	TYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS*
Ga0132258_104407722	3300015371	Arabidopsis Rhizosphere	MYEKPVVQRFGTLRELTLGQGPNLGGDAQSIYHRS*
Ga0132258_107980083	3300015371	Arabidopsis Rhizosphere	MYEKPAVQRFGSLRELTQGLGPNLGGDPASIYHRS*
Ga0132258_128390202	3300015371	Arabidopsis Rhizosphere	MYEKPVVQRLGSLRELTLGLGPNLGGDAASIYHRS*
Ga0132257_1013579481	3300015373	Arabidopsis Rhizosphere	PAASEQEERMTYQKPAVQRLGSLRELTLGAGQNTPGDATNLYHRS*
Ga0163161_106801201	3300017792	Switchgrass Rhizosphere	MKYEKPAVQRFGSLREVTLGNGPRLGGDAVSLYHRS
Ga0163161_110099062	3300017792	Switchgrass Rhizosphere	MKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHRS
Ga0066667_117690542	3300018433	Grasslands Soil	MKYEKPAVQRLGSLRELTLGAGNNTPGDATNLYHRS
Ga0066667_120148252	3300018433	Grasslands Soil	MKYEKPAVQRYGSLRELTLGNGPRLGGDAVSVYHRS
Ga0190268_116122672	3300018466	Soil	MYEKPAVKRFGTLHELTLGGGSQEQGDATNLYHRS
Ga0190274_100677652	3300018476	Soil	MYEKPEVKRFGSLRELTQGGGPGMGGDATNVYHRS
Ga0190274_101767792	3300018476	Soil	MKYEKPVVQRFGSLRELTLGGGPQESGDATNLYHRS
Ga0190274_119058172	3300018476	Soil	MKYEKPVVQRFGSLRELTLGGGPQEAGDATNLYHRS
Ga0190273_101701671	3300018920	Soil	MKYEKPSVQRFGSLRELTLGGGQILGGDATNLYHRS
Ga0190273_102267202	3300018920	Soil	MKYEKPVVQRFGTLRELTLGGGPNEAGDATNLFHRS
Ga0190273_110651711	3300018920	Soil	MKYEKPSVQRFGSLRELTLGGGPAEAGDATNLYHRS
Ga0190273_111200862	3300018920	Soil	MKYEKPAVQRLGTLRELTLGGGPQSTGDATNLYHRS
Ga0173482_101805942	3300019361	Soil	MYEKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS
Ga0190264_114642881	3300019377	Soil	MYQKPAVTRFGTLHELTLGGGPQDQGDATNLYHRS
Ga0190264_120411642	3300019377	Soil	RSHRRTMYEKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS
Ga0182009_100043383	3300021445	Soil	MYEKPRVERLGSLRELTLGLGPNLGGDPQSVYHRS
Ga0182009_101604971	3300021445	Soil	MKYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0182009_102820912	3300021445	Soil	MYQKPEVKRFGSFRELTQGGGPAGGGDPTNVFHRS
Ga0182009_105882772	3300021445	Soil	MYEKPEVQRFGSLRELTKGGAQALGGDATNVYHRS
Ga0222622_100200582	3300022756	Groundwater Sediment	MYQKPEVKRFGSLRELTQGGGPAGGGDATNVYHRS
Ga0222622_100915731	3300022756	Groundwater Sediment	MKYEKPAVQRFGTVREITLGSGPNTPGDATNLYHRS
Ga0222622_100915732	3300022756	Groundwater Sediment	MKYEKPAVQRLGSLRELTLGSGPSTPGDATNLYHRS
Ga0222622_103197492	3300022756	Groundwater Sediment	MKYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0222622_105224462	3300022756	Groundwater Sediment	MYEKPEVKRFGSLRELTQGGGPSGGGDATNVYHRS
Ga0222622_113231132	3300022756	Groundwater Sediment	MKYEKPVVQRFGSLRELTLGGGPQLAGDATNQFHRS
Ga0247794_102981271	3300024055	Soil	MKYEKPAVQRFGSLRELTLGNGPRLGGDAVSLYHRS
Ga0207656_100158913	3300025321	Corn Rhizosphere	MYEKPTVQRLGSLRELTLGLGPNLGGDPASVYHRS
Ga0207656_100365202	3300025321	Corn Rhizosphere	MHMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS
Ga0210142_10294552	3300025552	Natural And Restored Wetlands	MTYVKPAVQRFGSLRELTLGNGPRLGGDATSLYHRS
Ga0207642_100113152	3300025899	Miscanthus Rhizosphere	MKYEKPAVQRFGTVREITLGGGPNLAGDATNQYHRS
Ga0207710_105455821	3300025900	Switchgrass Rhizosphere	MYEKPVVQRFGSLRELTLGQGANLGGDATSIYHRS
Ga0207680_106866512	3300025903	Switchgrass Rhizosphere	MKYEKPAVQRWGTLRELTLGSGPNTPGDATSLYHRS
Ga0207647_100799492	3300025904	Corn Rhizosphere	MKYEKPAVQRYGSLRELTLGNGPRLGGDAVSLYHRS
Ga0207645_100138942	3300025907	Miscanthus Rhizosphere	MKYEKPAVQRFGTVREITLGSGPNQPGDATNLYHRS
Ga0207705_104057572	3300025909	Corn Rhizosphere	MTYEKPTVQRFGSLRELTLGNGPRLGGDAVSLYHRS
Ga0207654_108879201	3300025911	Corn Rhizosphere	MTYQKPVVQRFGSLRELTLGGGPSLSGDATNLYHRS
Ga0207657_112884572	3300025919	Corn Rhizosphere	LPWRDGMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207649_111286252	3300025920	Corn Rhizosphere	MTYEKPMVQRFGTLRELTLGGGPQLSGDATNLYHRS
Ga0207659_100189523	3300025926	Miscanthus Rhizosphere	MQYEKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207644_104611232	3300025931	Switchgrass Rhizosphere	MYEKPVVQRFGSLRELTLGQGASLGGDATSIYHRS
Ga0207690_102667202	3300025932	Corn Rhizosphere	AKESLMYEKPTVQRLGSLRELTLGLGPNLGGDPASVYHRS
Ga0207709_114603491	3300025935	Miscanthus Rhizosphere	GEDSMKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHRS
Ga0207670_100098595	3300025936	Switchgrass Rhizosphere	MYEKPEVKRFGSLRELTQGGGRAGGGDATNVYHRS
Ga0207679_100130306	3300025945	Corn Rhizosphere	MKYEKPVVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207679_100264461	3300025945	Corn Rhizosphere	HRRKVMTYQKPAVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207679_108666331	3300025945	Corn Rhizosphere	MYQKPEVKRFGSVRELTQGGGPAGAGDATNVYHRS
Ga0207679_114340912	3300025945	Corn Rhizosphere	MKYEKPAVQRFGTVREITLGGGPNLAGDATNTYHRS
Ga0207679_122010521	3300025945	Corn Rhizosphere	MKYEKPAVQRLGTLRELTLGSGPSTPGDATNLYHRS
Ga0207668_105338932	3300025972	Switchgrass Rhizosphere	MKYEKPAVQRFGSLRGVTLGNGPRLGGDAVSLYHRS
Ga0207658_107922411	3300025986	Switchgrass Rhizosphere	MTYEKPTVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207674_104417992	3300026116	Corn Rhizosphere	VYDKPKVERFGTLRELTLGGGPEMGGDGLNPYHRS
Ga0207683_105824832	3300026121	Miscanthus Rhizosphere	MTYQKPVVQRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0207698_104718283	3300026142	Corn Rhizosphere	GTGEDRMKYEKPAVQRLGSLREVTLGAGQNTPGDATNLYHRS
Ga0209818_10809822	3300027637	Agricultural Soil	MYQKPTVQRFGSLRELTLGGGQQLEGDATNLYHRS
Ga0209486_101648983	3300027886	Agricultural Soil	MTYEKPAITRFGSLRELTLGGGAQLSGDATNLYHRS
Ga0209486_105917231	3300027886	Agricultural Soil	MYEKPEVKRFGSLRELTQGGGPGLGGDATNVYHRS
Ga0307297_104052351	3300028754	Soil	DCMTYQKPAVQRFGSLRELTLGGGAQESGDATNLYHRS
Ga0247826_115470451	3300030336	Soil	MKYEKPAVQRFGSLRELTLGGGPQSQGDATNLYHRS
Ga0268240_101427251	3300030496	Soil	MKYEKPAVQRFGSLRELTLGGGPNLAGDATNQYHRS
Ga0308200_11545451	3300030905	Soil	MKYEKPVVQRFGSLRELTLGGGPQTAGDATNQFHRS
Ga0308183_11673662	3300030988	Soil	MKYEKPVVQRFGSLRELTLGGGPQMAGDATNQYHRS
Ga0308189_105223751	3300031058	Soil	MKYEKPVVQRFGSLRELTLGGGPQSSGDATNQFHR
Ga0170820_165977221	3300031446	Forest Soil	IRMKYEKPAVQRFGTVREITLGAGQNTPGDATNLYHRS
Ga0307408_1001953283	3300031548	Rhizosphere	MKYEKPAVQRFGSLRELTLGGGAELSGDATNLYHRS
Ga0307408_1002311352	3300031548	Rhizosphere	MYEKPIVTRFGSLRELTLGGGQQMSGDATNMYHRS
Ga0307408_1002881942	3300031548	Rhizosphere	MYEKPMVQRFGSLRELTLGGGPNEAGDATNMYHRS
Ga0307408_1008620272	3300031548	Rhizosphere	MYEKPEVKRFGSIRELTQGGGPAGGGDATNVYHRS
Ga0307408_1023755682	3300031548	Rhizosphere	MPYQKPEVVRYGTFVELTNGNGANLGGDATSVYHRS
Ga0310813_101468264	3300031716	Soil	MYEKPAVQRFGTLRDITQGLGPALGGDPQSVYHRS
Ga0307405_102371252	3300031731	Rhizosphere	MTYDKPAVQRFGSLRELTLGGGNQTQGDATNLYHRS
Ga0307405_104483992	3300031731	Rhizosphere	MKYEKPVVQRFGSLRELTLGGGPNESGDATNMYHRS
Ga0307405_110276522	3300031731	Rhizosphere	MYEKPEVTRFGSLRELTQGGGNSNGGDATNNYHRS
Ga0307413_115179302	3300031824	Rhizosphere	MTYQKPAVQRFGSLRELTLGGGAQMTGDATNLYHRS
Ga0307406_113213532	3300031901	Rhizosphere	MTYDKPAVQRFGSLRELTLGGGSQTQGDATNLYHRS
Ga0307406_116627591	3300031901	Rhizosphere	MYEKPEVTRFGSLRELTQGGGNSNGGDATNIYHRS
Ga0308175_1000030826	3300031938	Soil	MKYEKPAVQRFGTVREITLGAGQNTPGDAANLYHRS
Ga0308175_1000252783	3300031938	Soil	MKYEKPVVQRFGSLRELTLGGGPQLAGDATNLYHRS
Ga0308175_1000924295	3300031938	Soil	MTYQKPAVQRFGSLRELTLGGGAQLAGDATNLYHRS
Ga0308175_1001021733	3300031938	Soil	MYEKPRVQRLGTLRELTLGMGPSLGGDPQSVYHRS
Ga0308175_1003207242	3300031938	Soil	MTYEKPAVQRYGSLRELTLGNGPRLGGDAASLYHRS
Ga0308175_1003496952	3300031938	Soil	MTKYEKPMVQRFGSLRELTLGGGPELSGDATNLYHRS
Ga0308175_1006846251	3300031938	Soil	MYEKPTVQRLGTLRELTLGLGPNLGGDPQSVYHRS
Ga0308175_1020694971	3300031938	Soil	MYRGESTMKYEKPAVQRYGSLRELTLGNGPRLGGDAVSLYHRS
Ga0308174_100113596	3300031939	Soil	MKYEKPVVQRFGSLRELTLGGGAQLAGDATNLYHRS
Ga0308174_116844652	3300031939	Soil	VSMYEKPTVQRYGTLRELTFGQGPSTGGDATTVYHRS
Ga0307409_1023711771	3300031995	Rhizosphere	MYEKPKVQRYGSLRELTLGGGPAAQGDQTNLYHRS
Ga0308176_111402241	3300031996	Soil	MKYEKPAVQRFGSLRELTLGGGPSNGGDATNIYHRS
Ga0308176_120618521	3300031996	Soil	MKYEKPVVQRFGTLREITLGGGPLNGGDATNVYHRS
Ga0308173_100060949	3300032074	Soil	MTYQKPAVQRFGSLRELTLGGGANLAGDATNLYHRS
Ga0308173_108343952	3300032074	Soil	MTYEKPVVQRFGSLRELTLGGGAQLAGDATNLYHRS
Ga0307415_1012925721	3300032126	Rhizosphere	MYEKPKVQRYGSLRELTLGGGPSTQGDQTNLYHRS
Ga0310810_101067982	3300033412	Soil	MKYEKPAVQRFGSLRELTLGNGPQLGGDATSLYHRS
Ga0247829_105037732	3300033550	Soil	MKYEKPAVQRFGSLRELTLGGGPQSSGDATNLYHRS
Ga0372946_0027089_1467_1577	3300034384	Soil	MKYEKPAVQRYGTLRELTLGGGPALGGDATNLYHRS
Ga0372946_0071178_1301_1411	3300034384	Soil	MTYQKPAVQRFGTLRELTLGGGPSLGGDATNLYHRS
Ga0372946_0393740_3_110	3300034384	Soil	TYTKPAVQRFGTMTELTLGGGPSLGGDATNLYHRS

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F021762

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences