Basic Information | |
---|---|
Family ID | F020594 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 223 |
Average Sequence Length | 43 residues |
Representative Sequence | RQHINMAEILNEKNEVLARSRGIFIAIDPEKMFGKFVER |
Number of Associated Samples | 186 |
Number of Associated Scaffolds | 223 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.45 % |
% of genes near scaffold ends (potentially truncated) | 97.76 % |
% of genes from short scaffolds (< 2000 bps) | 90.13 % |
Associated GOLD sequencing projects | 175 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.919 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.659 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.112 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.915 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.46% β-sheet: 25.37% Coil/Unstructured: 67.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 223 Family Scaffolds |
---|---|---|
PF01680 | SOR_SNZ | 47.53 |
PF00155 | Aminotran_1_2 | 2.69 |
PF04237 | YjbR | 2.24 |
PF00392 | GntR | 1.35 |
PF14235 | DUF4337 | 1.35 |
PF00144 | Beta-lactamase | 1.35 |
PF04366 | Ysc84 | 1.35 |
PF01797 | Y1_Tnp | 1.35 |
PF03061 | 4HBT | 1.35 |
PF12681 | Glyoxalase_2 | 0.90 |
PF08543 | Phos_pyr_kin | 0.90 |
PF01174 | SNO | 0.90 |
PF00117 | GATase | 0.90 |
PF03551 | PadR | 0.90 |
PF02577 | BFN_dom | 0.45 |
PF04073 | tRNA_edit | 0.45 |
PF07690 | MFS_1 | 0.45 |
PF07883 | Cupin_2 | 0.45 |
PF00069 | Pkinase | 0.45 |
PF13683 | rve_3 | 0.45 |
PF14329 | DUF4386 | 0.45 |
PF00691 | OmpA | 0.45 |
PF01885 | PTS_2-RNA | 0.45 |
PF01381 | HTH_3 | 0.45 |
PF07110 | EthD | 0.45 |
PF02129 | Peptidase_S15 | 0.45 |
PF00378 | ECH_1 | 0.45 |
PF08308 | PEGA | 0.45 |
PF03544 | TonB_C | 0.45 |
PF06445 | GyrI-like | 0.45 |
PF14659 | Phage_int_SAM_3 | 0.45 |
PF06983 | 3-dmu-9_3-mt | 0.45 |
PF00903 | Glyoxalase | 0.45 |
PF03099 | BPL_LplA_LipB | 0.45 |
PF06764 | DUF1223 | 0.45 |
PF00912 | Transgly | 0.45 |
PF01541 | GIY-YIG | 0.45 |
COG ID | Name | Functional Category | % Frequency in 223 Family Scaffolds |
---|---|---|---|
COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 47.53 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 2.24 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.79 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.35 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.35 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.35 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.35 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.35 |
COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.90 |
COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.90 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.90 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.90 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.90 |
COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.90 |
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.90 |
COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.90 |
COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.45 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG1859 | RNA:NAD 2'-phosphotransferase, TPT1/KptA family | Translation, ribosomal structure and biogenesis [J] | 0.45 |
COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.45 |
COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.45 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.45 |
COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.45 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.45 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.45 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.37 % |
Unclassified | root | N/A | 33.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573002|GZIGXIF02HV8OF | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300000955|JGI1027J12803_107883711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1227 | Open in IMG/M |
3300000955|JGI1027J12803_108320380 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300001166|JGI12694J13545_1027913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 509 | Open in IMG/M |
3300001174|JGI12679J13547_1009615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 594 | Open in IMG/M |
3300001431|F14TB_100042728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 911 | Open in IMG/M |
3300001471|JGI12712J15308_10009142 | Not Available | 2698 | Open in IMG/M |
3300001867|JGI12627J18819_10442530 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300003219|JGI26341J46601_10171587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 598 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10355600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 595 | Open in IMG/M |
3300004092|Ga0062389_100870065 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300004152|Ga0062386_101001937 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300005330|Ga0070690_101679663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300005434|Ga0070709_10518063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 908 | Open in IMG/M |
3300005437|Ga0070710_11031140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 601 | Open in IMG/M |
3300005468|Ga0070707_100743953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 944 | Open in IMG/M |
3300005471|Ga0070698_101078443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 751 | Open in IMG/M |
3300005526|Ga0073909_10222581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 826 | Open in IMG/M |
3300005534|Ga0070735_10446813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 772 | Open in IMG/M |
3300005534|Ga0070735_10820348 | Not Available | 547 | Open in IMG/M |
3300005542|Ga0070732_10575609 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300005576|Ga0066708_10180379 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300005602|Ga0070762_10452343 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300005610|Ga0070763_10163414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1170 | Open in IMG/M |
3300005617|Ga0068859_101407766 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300005764|Ga0066903_107481002 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300005921|Ga0070766_10510624 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006028|Ga0070717_10116798 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
3300006028|Ga0070717_11290294 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300006028|Ga0070717_11297642 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300006059|Ga0075017_101441890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300006086|Ga0075019_10440795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300006086|Ga0075019_10893430 | Not Available | 570 | Open in IMG/M |
3300006162|Ga0075030_100394646 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300006172|Ga0075018_10456127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300006172|Ga0075018_10476450 | Not Available | 647 | Open in IMG/M |
3300006173|Ga0070716_100912968 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300006176|Ga0070765_101571689 | Not Available | 619 | Open in IMG/M |
3300006796|Ga0066665_10772146 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300006797|Ga0066659_10819998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
3300006871|Ga0075434_101266381 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300009038|Ga0099829_11806825 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300009090|Ga0099827_10186092 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
3300009093|Ga0105240_11277035 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300009101|Ga0105247_11748051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300009520|Ga0116214_1018643 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
3300009523|Ga0116221_1088597 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300009638|Ga0116113_1175378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300009643|Ga0116110_1053511 | Not Available | 1444 | Open in IMG/M |
3300009698|Ga0116216_10023042 | All Organisms → cellular organisms → Bacteria | 3898 | Open in IMG/M |
3300009824|Ga0116219_10629587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300010046|Ga0126384_11382657 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300010336|Ga0134071_10294269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300010343|Ga0074044_10332864 | Not Available | 997 | Open in IMG/M |
3300010359|Ga0126376_11723416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300010366|Ga0126379_10298334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
3300010376|Ga0126381_101048676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
3300010376|Ga0126381_102254411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300010376|Ga0126381_103509413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300010379|Ga0136449_101049646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter | 1304 | Open in IMG/M |
3300010398|Ga0126383_10787947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
3300010866|Ga0126344_1002566 | Not Available | 1761 | Open in IMG/M |
3300010877|Ga0126356_10756902 | Not Available | 599 | Open in IMG/M |
3300011120|Ga0150983_12318529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300011120|Ga0150983_15164127 | Not Available | 611 | Open in IMG/M |
3300011269|Ga0137392_10234356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
3300012096|Ga0137389_10060020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2906 | Open in IMG/M |
3300012096|Ga0137389_10104283 | All Organisms → cellular organisms → Eukaryota | 2259 | Open in IMG/M |
3300012189|Ga0137388_11715801 | Not Available | 562 | Open in IMG/M |
3300012203|Ga0137399_10094919 | Not Available | 2294 | Open in IMG/M |
3300012356|Ga0137371_10849010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300012363|Ga0137390_10885400 | Not Available | 848 | Open in IMG/M |
3300012363|Ga0137390_11453456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300012927|Ga0137416_12155223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300012929|Ga0137404_10548139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
3300014162|Ga0181538_10135561 | Not Available | 1422 | Open in IMG/M |
3300014167|Ga0181528_10854450 | Not Available | 513 | Open in IMG/M |
3300014325|Ga0163163_10040586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4545 | Open in IMG/M |
3300014501|Ga0182024_10303632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2108 | Open in IMG/M |
3300014501|Ga0182024_10335348 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
3300014501|Ga0182024_12179393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300014654|Ga0181525_10152921 | Not Available | 1265 | Open in IMG/M |
3300014654|Ga0181525_10889868 | Not Available | 505 | Open in IMG/M |
3300014657|Ga0181522_10669429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300014658|Ga0181519_10001579 | All Organisms → cellular organisms → Bacteria | 20035 | Open in IMG/M |
3300015357|Ga0134072_10146015 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300015374|Ga0132255_103744985 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300017930|Ga0187825_10346059 | Not Available | 562 | Open in IMG/M |
3300017933|Ga0187801_10177197 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300017936|Ga0187821_10207283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300017943|Ga0187819_10261908 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300017943|Ga0187819_10339815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300017946|Ga0187879_10002720 | All Organisms → cellular organisms → Bacteria | 11923 | Open in IMG/M |
3300017948|Ga0187847_10250627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
3300017948|Ga0187847_10768156 | Not Available | 544 | Open in IMG/M |
3300017955|Ga0187817_10242338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
3300017961|Ga0187778_10001700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15098 | Open in IMG/M |
3300017974|Ga0187777_10753797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300017975|Ga0187782_10060375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2761 | Open in IMG/M |
3300017995|Ga0187816_10155637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 989 | Open in IMG/M |
3300018007|Ga0187805_10491388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300018017|Ga0187872_10156009 | Not Available | 1087 | Open in IMG/M |
3300018022|Ga0187864_10208277 | Not Available | 922 | Open in IMG/M |
3300018038|Ga0187855_10390482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
3300018040|Ga0187862_10327533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 959 | Open in IMG/M |
3300018042|Ga0187871_10092409 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
3300018085|Ga0187772_11089274 | Not Available | 586 | Open in IMG/M |
3300018088|Ga0187771_10291675 | Not Available | 1366 | Open in IMG/M |
3300018088|Ga0187771_11140066 | Not Available | 661 | Open in IMG/M |
3300018088|Ga0187771_11344738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300018433|Ga0066667_12052238 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300020579|Ga0210407_10462362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 992 | Open in IMG/M |
3300020580|Ga0210403_11054774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300020581|Ga0210399_10644476 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300020581|Ga0210399_10997318 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300020582|Ga0210395_10150801 | Not Available | 1735 | Open in IMG/M |
3300020582|Ga0210395_10647717 | Not Available | 792 | Open in IMG/M |
3300020583|Ga0210401_11248649 | Not Available | 601 | Open in IMG/M |
3300021170|Ga0210400_10049922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3257 | Open in IMG/M |
3300021170|Ga0210400_10875930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300021402|Ga0210385_10014892 | All Organisms → cellular organisms → Bacteria | 4818 | Open in IMG/M |
3300021402|Ga0210385_10201870 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300021403|Ga0210397_11463498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300021405|Ga0210387_11205369 | Not Available | 657 | Open in IMG/M |
3300021407|Ga0210383_11153442 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300021420|Ga0210394_10502111 | Not Available | 1067 | Open in IMG/M |
3300021420|Ga0210394_11743785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300021432|Ga0210384_10419164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1206 | Open in IMG/M |
3300021433|Ga0210391_11538190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300021475|Ga0210392_10881336 | Not Available | 669 | Open in IMG/M |
3300021475|Ga0210392_10933935 | Not Available | 649 | Open in IMG/M |
3300021477|Ga0210398_11111139 | Not Available | 627 | Open in IMG/M |
3300021479|Ga0210410_10708894 | Not Available | 888 | Open in IMG/M |
3300021479|Ga0210410_11261023 | Not Available | 631 | Open in IMG/M |
3300021560|Ga0126371_12176098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300022730|Ga0224570_105886 | Not Available | 748 | Open in IMG/M |
3300022881|Ga0224545_1058807 | Not Available | 542 | Open in IMG/M |
3300024271|Ga0224564_1110202 | Not Available | 561 | Open in IMG/M |
3300025414|Ga0208935_1006172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1695 | Open in IMG/M |
3300025459|Ga0208689_1006527 | Not Available | 4364 | Open in IMG/M |
3300025500|Ga0208686_1116215 | Not Available | 558 | Open in IMG/M |
3300025612|Ga0208691_1025863 | Not Available | 1372 | Open in IMG/M |
3300025910|Ga0207684_10775131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 812 | Open in IMG/M |
3300025929|Ga0207664_10915818 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300025931|Ga0207644_10784519 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300025939|Ga0207665_11027983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
3300025949|Ga0207667_11520622 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300026011|Ga0208532_1005974 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300026324|Ga0209470_1215036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
3300026343|Ga0209159_1280792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300026514|Ga0257168_1083834 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300026551|Ga0209648_10454850 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300027512|Ga0209179_1088340 | Not Available | 686 | Open in IMG/M |
3300027559|Ga0209222_1012865 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
3300027570|Ga0208043_1131303 | Not Available | 662 | Open in IMG/M |
3300027575|Ga0209525_1085421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
3300027641|Ga0208827_1062938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1199 | Open in IMG/M |
3300027643|Ga0209076_1133244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
3300027748|Ga0209689_1167588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
3300027767|Ga0209655_10110748 | Not Available | 913 | Open in IMG/M |
3300027821|Ga0209811_10165281 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300027842|Ga0209580_10326066 | Not Available | 765 | Open in IMG/M |
3300027879|Ga0209169_10385766 | Not Available | 737 | Open in IMG/M |
3300027882|Ga0209590_10748045 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300027884|Ga0209275_10347496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 830 | Open in IMG/M |
3300027884|Ga0209275_10461630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
3300027889|Ga0209380_10044345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2520 | Open in IMG/M |
3300027889|Ga0209380_10158726 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300027905|Ga0209415_10789925 | Not Available | 663 | Open in IMG/M |
3300028047|Ga0209526_10556516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300028574|Ga0302153_10269239 | Not Available | 583 | Open in IMG/M |
3300028775|Ga0302231_10251889 | Not Available | 739 | Open in IMG/M |
3300028828|Ga0307312_10104134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762 | Open in IMG/M |
3300028906|Ga0308309_10415344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
3300028906|Ga0308309_10628854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
3300028906|Ga0308309_10795807 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300028906|Ga0308309_11188374 | Not Available | 658 | Open in IMG/M |
3300028906|Ga0308309_11847915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300029636|Ga0222749_10519605 | Not Available | 646 | Open in IMG/M |
3300029907|Ga0311329_10457227 | Not Available | 878 | Open in IMG/M |
3300029913|Ga0311362_10197909 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
3300029915|Ga0311358_10219214 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
3300029951|Ga0311371_11156891 | Not Available | 899 | Open in IMG/M |
3300029952|Ga0311346_10370484 | Not Available | 1412 | Open in IMG/M |
3300029955|Ga0311342_10274319 | Not Available | 1554 | Open in IMG/M |
3300029956|Ga0302150_10211125 | Not Available | 733 | Open in IMG/M |
3300029999|Ga0311339_10644433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
3300030007|Ga0311338_10429885 | Not Available | 1407 | Open in IMG/M |
3300030057|Ga0302176_10265957 | Not Available | 687 | Open in IMG/M |
3300030294|Ga0311349_11959839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300030503|Ga0311370_12131034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300030509|Ga0302183_10203977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300030518|Ga0302275_10190526 | Not Available | 1229 | Open in IMG/M |
3300030520|Ga0311372_10845813 | Not Available | 1241 | Open in IMG/M |
3300030618|Ga0311354_11482087 | Not Available | 601 | Open in IMG/M |
3300030659|Ga0316363_10061664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1750 | Open in IMG/M |
3300030737|Ga0302310_10645750 | Not Available | 555 | Open in IMG/M |
3300030813|Ga0265750_1067170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300031232|Ga0302323_103309704 | Not Available | 513 | Open in IMG/M |
3300031241|Ga0265325_10035204 | Not Available | 2661 | Open in IMG/M |
3300031258|Ga0302318_10650874 | Not Available | 531 | Open in IMG/M |
3300031524|Ga0302320_10943258 | Not Available | 926 | Open in IMG/M |
3300031715|Ga0307476_10156448 | Not Available | 1640 | Open in IMG/M |
3300031715|Ga0307476_10186236 | Not Available | 1503 | Open in IMG/M |
3300031715|Ga0307476_11163207 | Not Available | 565 | Open in IMG/M |
3300031718|Ga0307474_11310232 | Not Available | 572 | Open in IMG/M |
3300031753|Ga0307477_10256587 | Not Available | 1211 | Open in IMG/M |
3300031754|Ga0307475_11578268 | Not Available | 502 | Open in IMG/M |
3300031821|Ga0318567_10587236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300031823|Ga0307478_10839067 | Not Available | 769 | Open in IMG/M |
3300032160|Ga0311301_11908845 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300032205|Ga0307472_100288171 | Not Available | 1312 | Open in IMG/M |
3300032782|Ga0335082_10092368 | All Organisms → cellular organisms → Bacteria | 3015 | Open in IMG/M |
3300032782|Ga0335082_10681691 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300032782|Ga0335082_11679490 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300032783|Ga0335079_10144936 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
3300032783|Ga0335079_10692883 | Not Available | 1065 | Open in IMG/M |
3300032805|Ga0335078_12025357 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300032892|Ga0335081_10373552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1846 | Open in IMG/M |
3300032892|Ga0335081_11124037 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300032955|Ga0335076_10076367 | All Organisms → cellular organisms → Bacteria | 3292 | Open in IMG/M |
3300033004|Ga0335084_10292854 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300033402|Ga0326728_10359673 | Not Available | 1275 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.66% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.28% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.48% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.48% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.48% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.59% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.14% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.69% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.69% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.69% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.35% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.35% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.90% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.90% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.45% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.45% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.45% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.45% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.45% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.45% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.45% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.45% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.45% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.45% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.45% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026011 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FE1_00472120 | 2189573002 | Grass Soil | LRLEILNQKGEVLARSRGLFVAIDPHRMFAKFVDR |
JGI1027J12803_1078837113 | 3300000955 | Soil | HINAAEILNAEGEVLARGRGVFVAIDPEKMFGKFVER* |
JGI1027J12803_1083203802 | 3300000955 | Soil | VNMAEIVNERDEVLARSRGVFIAIDPEKMFRKFAER* |
JGI12694J13545_10279131 | 3300001166 | Forest Soil | EGREVEVRGRIHINTAQILNEKDEVLARSRGIFITIDPEKMFKKYVKR* |
JGI12679J13547_10096151 | 3300001174 | Forest Soil | AGRIHINAAEILNEKDEVLARSKGTFIAIDPEKMFAKFVER* |
F14TB_1000427281 | 3300001431 | Soil | VRGRKHINTAEILNQKGDVLARGRGLFIAIDPHRMFAKFVEK* |
JGI12712J15308_100091425 | 3300001471 | Forest Soil | RVEGREVEVEGRKHINSAEILNEKNEVLARSRGTFIAIDPEKMFAKYVQK* |
JGI12627J18819_104425301 | 3300001867 | Forest Soil | VPLHKPLRVEGREVSVQGRIHINTAEILNEKDEVLARSKGTFIAIDPEKMFAKFVER* |
JGI26341J46601_101715872 | 3300003219 | Bog Forest Soil | LHKPLRVEGREIKVEGRTHINAAEILNDKNEVLARSRGTFIAIDPAKMFAKYVER* |
JGIcombinedJ51221_103556001 | 3300003505 | Forest Soil | RVEGREVKVEGRTHINAAQILNEKNEVLARSRGTFIAIDPAKMFAKYVER* |
Ga0062389_1008700652 | 3300004092 | Bog Forest Soil | RTHINTAEILNDQNEVLARSRGVFIAIDPEKMFRKYVKR* |
Ga0062386_1010019372 | 3300004152 | Bog Forest Soil | LRVEGHEIEVRGTKHINAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER* |
Ga0070690_1016796631 | 3300005330 | Switchgrass Rhizosphere | VRGREHINMAEIVNQKGEVLARGQGLFIAIDPHKMFAKFVDR* |
Ga0070709_105180632 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GRKHINMAEILNQKGEPLARSKGLFIAIDPKKMFAKYVDK* |
Ga0070710_110311402 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VHGRQHVNMAEIVNKEGEVLARGKGTFIAIDPEKMFGKFVER* |
Ga0070707_1007439531 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VKGRRHINMAEILNQKREVLARGRGLFIAIDAHKMFQKFVER* |
Ga0070698_1010784431 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LNKPLRVVGSETKVRGRTHVNTAEILNDKNEVLARSTGIFIAIDPAQMFAKYVDR* |
Ga0073909_102225812 | 3300005526 | Surface Soil | LRVEGREISVRGTQHINEAWIMNEKEEVLARSRGVFIAIDPEKMFGKFVER* |
Ga0070735_104468131 | 3300005534 | Surface Soil | NAAEILNRRGEVLARSRGTFVAIDPHRMFAKFVER* |
Ga0070735_108203481 | 3300005534 | Surface Soil | RHLNAAAILTSKGEVLASSEGVFIAIDPEKMFKKHLKK* |
Ga0070732_105756092 | 3300005542 | Surface Soil | LRVEGKEVSVEGRIHINAAEILNEENEVLARSKGTFIAIDPEKMFAKFVER* |
Ga0066708_101803792 | 3300005576 | Soil | VRGKRHVNVAEICNQKNEVLARGRGVFIAIDPLKMFAKHIR* |
Ga0070762_104523431 | 3300005602 | Soil | QKKGRTHVNAAEILNDKDEVLARSRGIFIAIDPAKMFAKFAER* |
Ga0070763_101634143 | 3300005610 | Soil | RQHINMAEILNPTGEVLARSRGLFIAIDPHKMFAKFVDR* |
Ga0068859_1014077662 | 3300005617 | Switchgrass Rhizosphere | MAEIVNQKGEVLARGQGLFIAIDPHKMFAKFVDR* |
Ga0066903_1074810022 | 3300005764 | Tropical Forest Soil | REISVRGTQHINEACILNEKNEILARSRGVFIAIDPEKMFGKFVER* |
Ga0070766_105106241 | 3300005921 | Soil | RAEGREIEKRGRTHVNSAEILNEHNEVLARSRGIFIAIDPEKMFAKYVER* |
Ga0070717_101167981 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GRETKVRGRTHVNTAEILNDKNEVLARSTGIFIAIDPAQMFAKYVDR* |
Ga0070717_112902941 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PLRVEGREIEVRGNKHINAAEILNEKDEVLARSRGIFIAIDPEQMFAKYVER* |
Ga0070717_112976421 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LYKPLHVEGREVSVHGRQHINVAEILNEKNEVLARSKGIFIAIDPEKMFAKFVER* |
Ga0075017_1014418902 | 3300006059 | Watersheds | RVEGRRHTNRGEILNAKGEVLAHSEGIFIAIDPHKMFAKQIES* |
Ga0075019_104407952 | 3300006086 | Watersheds | GRRHTNRGEILNAKGEVLARSEGIFIAIDPHKMFAKQIES* |
Ga0075019_108934302 | 3300006086 | Watersheds | INMAEILDEKDEVLARSRGTFIAIDPEKMFGKFVER* |
Ga0075030_1003946463 | 3300006162 | Watersheds | LRVEGREVSVHGRQHINMAEILNENNEVLARSRGTFIAIDPEKMFGKFVER* |
Ga0075018_104561271 | 3300006172 | Watersheds | HGRQHINMAEILNENNEVLARSRGTFIAIDPEKMFAKFVIR* |
Ga0075018_104764501 | 3300006172 | Watersheds | VEGRKHTNRGEILNAKGEVLASAEALFIAIDPDRMFAKTK* |
Ga0070716_1009129681 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EGREVSVEGRQHINAAEILNEKCEILARSRGVFIAIDPEKMFGKFVERG* |
Ga0070765_1015716891 | 3300006176 | Soil | AAEILNENNEVLARSRGTFIAIDPEKMFAKFVER* |
Ga0066665_107721461 | 3300006796 | Soil | INMAEILNEKGEVLARSEGLFIAIDPHRMFAKFVDR* |
Ga0066659_108199981 | 3300006797 | Soil | REIEVRGTQHINSAEILNEKGEILARSRGVFIAIDPERMFAKYAER* |
Ga0075434_1012663811 | 3300006871 | Populus Rhizosphere | LRVRGREHINMAEILNQKDEVLASGEGLFIAIDPHKMFAKHIGK* |
Ga0099829_118068251 | 3300009038 | Vadose Zone Soil | EILNQKDEVLARSRGLFIAIDPKKMFAKFVNRKKKEIT* |
Ga0099827_101860923 | 3300009090 | Vadose Zone Soil | PVPLNKPLRVEGREMKVRGRTHVNSAEILNDKNEILARSRGIFIAIDPEKMFAKYVER* |
Ga0105240_112770352 | 3300009093 | Corn Rhizosphere | RRHVNMGEILNQKGEVLARGRALFIAIDPRRFAKFMK* |
Ga0105247_117480511 | 3300009101 | Switchgrass Rhizosphere | SVRGRKHVNQGEILNQKGEVLARSRALFIAIDPRRFAKFVK* |
Ga0116214_10186434 | 3300009520 | Peatlands Soil | VHGRQHVNMAEILNDKNEVLARSKGVFIAIDPEKMFGKFVER* |
Ga0116221_10885972 | 3300009523 | Peatlands Soil | QHTNMAEILNPKGEVLARGRGLFIAIDPQKMFAKFVDR* |
Ga0116113_11753781 | 3300009638 | Peatland | VEGREVSVDGRIHINAAEIMNEKNEVLARSRGTFIAIDPEKMFGKFVER* |
Ga0116110_10535111 | 3300009643 | Peatland | GREVSLHGRQHVNMAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER* |
Ga0116216_100230421 | 3300009698 | Peatlands Soil | GRQHVNMAEILNDKNEVLARSKGVFIAIDPEKMFGKFVER* |
Ga0116219_106295871 | 3300009824 | Peatlands Soil | QPLHVEGREVSVHGRQHINQAEIRNQKNEVLARSKGIFIAIDPEKMFAKFVER* |
Ga0126384_113826571 | 3300010046 | Tropical Forest Soil | INMAEILNKKDEVLASGEGLFIAIDPHKMFAKFVDK* |
Ga0134071_102942692 | 3300010336 | Grasslands Soil | AEILNDKNEVLASSRGTFIAIDPHRMFSRFVKRG* |
Ga0074044_103328642 | 3300010343 | Bog Forest Soil | MAEILNEKGEVLARSQGLFIAIDPHKMFARFVDR* |
Ga0126376_117234161 | 3300010359 | Tropical Forest Soil | RRHINVAEILNQKGDVLARSRGTFVAIDAHKMFSRFVER* |
Ga0126379_102983341 | 3300010366 | Tropical Forest Soil | EAWILNEKNEILARSRGVFIAIDPEKMFGKFVER* |
Ga0126381_1010486762 | 3300010376 | Tropical Forest Soil | AAEILNAEGEVLARSRGVFVAIDPEKMFGKFVER* |
Ga0126381_1022544113 | 3300010376 | Tropical Forest Soil | HINMAEIMNEKREVLARSKGTFIAIDPEKMFGKFVER* |
Ga0126381_1035094131 | 3300010376 | Tropical Forest Soil | MAEILNGRDEVLARSQGTFIAIDPDRMFAKFVDR* |
Ga0136449_1010496461 | 3300010379 | Peatlands Soil | HVNQAEIKNEKGEILARSRGLFIAIDPEKMFGKFVER* |
Ga0126383_107879472 | 3300010398 | Tropical Forest Soil | HGRQHINMAEIMNEEGEVLARGRGVFIAIDPEKMFGKFVER* |
Ga0126344_10025661 | 3300010866 | Boreal Forest Soil | VEGRELSVQGRQHINTAEILNDKNAVLARSRGIFIAIDPEKMFAKYVDR* |
Ga0126356_107569021 | 3300010877 | Boreal Forest Soil | YEVEAQGRQHVNMAEISNEKNEVLARGQGIFIAIDPEKMFAKYAKK* |
Ga0150983_123185291 | 3300011120 | Forest Soil | QHINAAEIRNQKNEVLARSRGTFIAIDPERMFGKFVER* |
Ga0150983_151641271 | 3300011120 | Forest Soil | EITNEQGEILARSYGVFIAIDPMKMFAKFAKNGK* |
Ga0137392_102343562 | 3300011269 | Vadose Zone Soil | ETKVRGRTHVNTAEILNNKNDVLARSTGIFIAIDPEQMFAKYVDS* |
Ga0137389_100600201 | 3300012096 | Vadose Zone Soil | VKVKGRKHINMAEILNDKGDVLARSQGLFSAIDPHRMFARFVER* |
Ga0137389_101042831 | 3300012096 | Vadose Zone Soil | IEVRGTQHLNSAEILNEKGEILARSRGVFIAIDPETMFAKYAER* |
Ga0137388_117158012 | 3300012189 | Vadose Zone Soil | RGKKHINIAEIRNQKGEVLARGRAVFIAIDPLKMFAKHIKKL* |
Ga0137399_100949191 | 3300012203 | Vadose Zone Soil | NSAEILNEKSAVLARSRGVFIAIDPERMFAKYAKR* |
Ga0137371_108490101 | 3300012356 | Vadose Zone Soil | INMAEILNQKGEVLARSRGLFIAIDPYKMFGKFVER* |
Ga0137390_108854002 | 3300012363 | Vadose Zone Soil | ERAVRGKRHVNVAEIRNQKKEVLARGRGVFIAIDPLKMFAKHIR* |
Ga0137390_114534561 | 3300012363 | Vadose Zone Soil | REIEVRGAKHINAAEILNENNEVLARSRGIFIAIDPERMFAKYVER* |
Ga0137416_121552232 | 3300012927 | Vadose Zone Soil | RKHINMAEILNQKGEPLARSKGLFIAIDPKKMFAKYVDK* |
Ga0137404_105481391 | 3300012929 | Vadose Zone Soil | INTAEILNQKGETLARGKGLFIAIDPHRMFAKYVDK* |
Ga0181538_101355611 | 3300014162 | Bog | INMAEILNEKGEVLARSQGLFIAIDPHRMFARFVER* |
Ga0181528_108544501 | 3300014167 | Bog | GRKHINMAEILNDKNEVLARSQGVFIAIDPHRMFARFVER* |
Ga0163163_100405866 | 3300014325 | Switchgrass Rhizosphere | RKHVNQGEILNQKGEVLARSRALFIAIDPRRFAKFVK* |
Ga0182024_103036321 | 3300014501 | Permafrost | REEKVQGRTHVNTAEILNDKDEVLARSRGIFIAIDPEKMFAKFVER* |
Ga0182024_103353481 | 3300014501 | Permafrost | REEKVQGRTHVNTAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER* |
Ga0182024_121793931 | 3300014501 | Permafrost | LRVEGREEKVHGRTHINTAEILNEKNEVLARSRGIFIAIDPEKMFAKFVER* |
Ga0181525_101529212 | 3300014654 | Bog | DILGRVHTNAAEILNAKGEVLARSRGTFVAIDPARMFAKYLNK* |
Ga0181525_108898682 | 3300014654 | Bog | EIEVRGPKHINAAEILNEKNEVLARSRGIFIAIDPEKMFAKHIKR* |
Ga0181522_106694291 | 3300014657 | Bog | QPLRVEGREIEKRGRTHVNAAEILNENNEVLARSRGIFIAIDPEKMFAKFVNK* |
Ga0181519_100015791 | 3300014658 | Bog | TAEILNEKNEVLARSRGTFIAIDPQKMFAKYVER* |
Ga0134072_101460151 | 3300015357 | Grasslands Soil | RVESREVAVHGRQHVNMAEIMNKEGEVLARGKGIFIAIDPEKMFGNFVER* |
Ga0132255_1037449851 | 3300015374 | Arabidopsis Rhizosphere | NMAEILNQKGEPLARSKGLFIAIDPKKMFAKYVDK* |
Ga0187825_103460592 | 3300017930 | Freshwater Sediment | RHINTAEILNQRNEVLARGRGTFIAIDHQRMFATHLGK |
Ga0187801_101771972 | 3300017933 | Freshwater Sediment | EGREVSVHGRQHINMAEILSENNEVLARSRGTFIAIDPEKLFGKFVER |
Ga0187821_102072831 | 3300017936 | Freshwater Sediment | RQHINQAEILNEKGEILARSRGTFIAIDPEKMFGKFVDR |
Ga0187819_102619081 | 3300017943 | Freshwater Sediment | EGREVSVHGRQHINMAEILSENNEVLARSRGTFIAIDPEKMFGKFVER |
Ga0187819_103398152 | 3300017943 | Freshwater Sediment | SGRRHINQAEILNRKKEVLARSRGTFIAIDPHRMFGKFVDK |
Ga0187879_100027201 | 3300017946 | Peatland | NTAEILNEKNEVLARSRGTFIAIDPEKMFAKYAER |
Ga0187847_102506271 | 3300017948 | Peatland | HVNAAEILNEQNEVLARSRGIFIAIDPEKMFAKFVER |
Ga0187847_107681561 | 3300017948 | Peatland | PLHVEGCEIKVEGRTHINAAEILNEKNEVLARSRGTFIAIDPEKMLAKHVKS |
Ga0187817_102423381 | 3300017955 | Freshwater Sediment | RYHTNEAEILNQKGEVLARSKGVFIAVDPHKMFAKFVQR |
Ga0187778_1000170016 | 3300017961 | Tropical Peatland | GRYHTNAAEILDAKGQILAHSEGVFVAIDPERRFQKFVNR |
Ga0187777_107537972 | 3300017974 | Tropical Peatland | NMAEILNESGEVLARSKGIFIAIDPEKMFGKFVER |
Ga0187782_100603754 | 3300017975 | Tropical Peatland | NMAEILNAKGEVLARSRGVFIAIDAHKMFAKFVER |
Ga0187816_101556371 | 3300017995 | Freshwater Sediment | VRVHGRQHINMAEILNPKGEVLARGRGLFIAIDPHKMFAKFVDR |
Ga0187805_104913881 | 3300018007 | Freshwater Sediment | VSVHGRQHINAAEILNDNNEVLARSRGTFIAIDPEKMFGKFVER |
Ga0187872_101560091 | 3300018017 | Peatland | NMAEILNEKGEVLARSQGLFIAIDPHKMFARFVDR |
Ga0187864_102082771 | 3300018022 | Peatland | PLRVEGREVSVYGRQHVNTAEILNEKNEVLARSRGTFIAIDPEKMFAKYAER |
Ga0187855_103904821 | 3300018038 | Peatland | EVAGRRHINVAEILNQKGEILARGRGLFIAIDPHKMFARFVDR |
Ga0187862_103275331 | 3300018040 | Peatland | HKPLRVEGREIEKRGRTHINAAEILNEKDEVLARSRGIFIAIDPEKMFAKFVER |
Ga0187871_100924092 | 3300018042 | Peatland | RQHINKAEILNEKNEVLARSQGLFIAIDPQKMFAKFVER |
Ga0187772_110892741 | 3300018085 | Tropical Peatland | NMAEIFNQKGEVLARSRGTFIAIDPEKMFGRFVER |
Ga0187771_102916751 | 3300018088 | Tropical Peatland | KVKGRQHINVAQILNQKGEVLARGRALFIAIDPHKMFGKFVER |
Ga0187771_111400661 | 3300018088 | Tropical Peatland | RQHINMAEILNEKNEVLARSRGIFIAIDPEKMFGKFVER |
Ga0187771_113447381 | 3300018088 | Tropical Peatland | MTSINMAGILSEQGEVLARSRGTFIAIDPEKMSKKFVEK |
Ga0066667_120522381 | 3300018433 | Grasslands Soil | INMAEIFDQKGEVLARSRGTFIAVDAERMFAKYADK |
Ga0210407_104623621 | 3300020579 | Soil | VNMAEILNSDGEVLARGRGLFIAIDPQKMFAKFVER |
Ga0210403_110547741 | 3300020580 | Soil | REIEVRGKTHVNAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0210399_106444762 | 3300020581 | Soil | EGREIQKKGRTHVNAAEILNDKDEVLARSRGIFIAIDPAKMFAKFAER |
Ga0210399_109973181 | 3300020581 | Soil | NAAEILNDKGEVLARSRGTFIAIDPAKMFAKYVES |
Ga0210395_101508013 | 3300020582 | Soil | HKPLRVEGREVSVHGRQHINMAEILNDKNEVLARSQATFIAIDPEKMFAKFVER |
Ga0210395_106477171 | 3300020582 | Soil | REIKVEGRTHTNAAEILNEKNEVLARSRATFIAIDPAKMFAKFVER |
Ga0210401_112486491 | 3300020583 | Soil | HVNMAEILNEKNEVLARSRGIFIAIDPEKMFTKFVER |
Ga0210400_100499223 | 3300021170 | Soil | NSAEILNDKNEVLARSRGIFIAVDPAKMFAKYVDK |
Ga0210400_108759301 | 3300021170 | Soil | EVSVSGRQHINTAEILNEKNEVLARSRGLFIAIDPEKMFAKFVKK |
Ga0210385_100148921 | 3300021402 | Soil | AEGRTHINAAEILNDKGEVLARSRGTFIAIDPAKMFAKYVES |
Ga0210385_102018704 | 3300021402 | Soil | RTHVNSAQILNEKGEILARSRGIFIAIDPEKMFAKYVER |
Ga0210397_114634982 | 3300021403 | Soil | KKKGRTHVNAAEILNDKNEILARSRGIFIAIDPEKMFAKYVER |
Ga0210387_112053692 | 3300021405 | Soil | NAAEILNEKNEVLARSRATFIAIDPAKMFAKFVER |
Ga0210383_111534421 | 3300021407 | Soil | HVNMAEILNENGEVLARGEGTFIAIDPERMFGRFAKP |
Ga0210394_105021112 | 3300021420 | Soil | THINAAEILNEKDEVLARSRGTFIAINPEKMFAKFVER |
Ga0210394_117437851 | 3300021420 | Soil | NEAEIFNENNEVLARSRGTFIAIDPEKMFAKFVER |
Ga0210384_104191641 | 3300021432 | Soil | GRKHVNMAEILNQKGEVLAQGQGLFIAIDPRKMFAKYVDK |
Ga0210391_115381902 | 3300021433 | Soil | AEGRTHINAAEILNDKGEVLARSRGTFIAIDPAKMFAKFVER |
Ga0210392_108813362 | 3300021475 | Soil | KRGRTHVNMAEILNEKNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0210392_109339351 | 3300021475 | Soil | THINTAEILNEDNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0210398_111111391 | 3300021477 | Soil | VRVQGRMHINTAKILNDKNEVLARSQGTFIAIDPEKMFAKFVAR |
Ga0210410_107088942 | 3300021479 | Soil | VPLHKPLRVEGREVSVHGRQHINMAEILNEKNEVLARSQATFIAIDPEKMFAKFVER |
Ga0210410_112610231 | 3300021479 | Soil | VQGRQHINAAEIRNQKNEILARSRGTFIAIDPEKMFGKFVER |
Ga0126371_121760982 | 3300021560 | Tropical Forest Soil | EIAVHGRQHINIAEILDQKGKVLARSKGIFIAIDPEKMFEKFVER |
Ga0224570_1058862 | 3300022730 | Rhizosphere | VEGRELSVQGRQHINTAEILNDKNEVLARSRGIFIAIDPEKMFAKYVDR |
Ga0224545_10588072 | 3300022881 | Soil | IHINAAEILNDKNEVLARSKGTFIAIDPEKMFAKFVER |
Ga0224564_11102022 | 3300024271 | Soil | HKALRVEGREIEVRGNKHINAAEIFNENNEVLARSRGIFIAIDPEQMFKKYAER |
Ga0208935_10061722 | 3300025414 | Peatland | HRPLKVEGKEVKVQGRTHINTAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER |
Ga0208689_10065277 | 3300025459 | Peatland | INMAEILNEKGEVLARSEGVFIAIDPHRMFTRFADR |
Ga0208686_11162151 | 3300025500 | Peatland | INMAEILNEKGEVLARSQGLFIAIDPHKMFARFVER |
Ga0208691_10258632 | 3300025612 | Peatland | NTAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER |
Ga0207684_107751311 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDVPLRVVGRETKVRGRTHVNTAEILNDKNEVLARSTGIFIAIDPAQMFAKYVDR |
Ga0207664_109158183 | 3300025929 | Agricultural Soil | NMAEIMNQEGEVLARGKGIFIAIDPEKMFGKFVER |
Ga0207644_107845191 | 3300025931 | Switchgrass Rhizosphere | NMAEIVNQKGEVLARGQGLFIAIDPHKMFAKFVDR |
Ga0207665_110279832 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VHRVRGRRHINTAEILNQRNEVLARGRGTFIAIDPQRMFAKHIQK |
Ga0207667_115206222 | 3300025949 | Corn Rhizosphere | RVESREVAVHGRQHVNMAEIMNTEGEVLARGKGIFIAIDPEKMFGKFVER |
Ga0208532_10059742 | 3300026011 | Rice Paddy Soil | QHVNMAEIMNKEGEVLARGKGIFIAIDPEKMFGKFVER |
Ga0209470_12150362 | 3300026324 | Soil | SVRERRHIHRAEILNDKNEVLASSRGTFIAIDPHRMFSRFVKRG |
Ga0209159_12807921 | 3300026343 | Soil | HRAEILNDKNEVLASSRGTFIAIDPHRMFSRFVKRG |
Ga0257168_10838342 | 3300026514 | Soil | GRTHVNSAEILNDQNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0209648_104548501 | 3300026551 | Grasslands Soil | HGNSAEILNDQNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0209179_10883402 | 3300027512 | Vadose Zone Soil | VEGREIKVRGRTHVNSAEILNEKNEVLARSRAIFIAIDPEKMFAKYVER |
Ga0209222_10128651 | 3300027559 | Forest Soil | LRKPLRVEGREVEVRGRIHINTAQILNEKDEVLARSRGIFIAIDPEKMFKKYVKR |
Ga0208043_11313031 | 3300027570 | Peatlands Soil | RQHINAAEILNEKNEVLARSKGIFIAIDPEKMFGKFVER |
Ga0209525_10854213 | 3300027575 | Forest Soil | HVNAAEITNEKGEVLARSRGVFIVIDPEKMFAKYVKKQGKK |
Ga0208827_10629381 | 3300027641 | Peatlands Soil | HTNMAEILNPKGEVLARGRGLFIAIDPQKMFAKFVDR |
Ga0209076_11332441 | 3300027643 | Vadose Zone Soil | NMAEILNQKGEVLARSKGLFIAIDPRRMFAKFVDK |
Ga0209689_11675881 | 3300027748 | Soil | VRVRGRKHVNMAEILNQKGEVLAQGQGLFIAIDPKKMFAKYVDK |
Ga0209655_101107482 | 3300027767 | Bog Forest Soil | EVEVEGRTHINTAQILNEKDEVLARSRGTFIAIDPAKMFAKYVKR |
Ga0209811_101652812 | 3300027821 | Surface Soil | LRVEGREISVRGTQHINEAWIMNEKEEVLARSRGVFIAIDPEKMFGKFVER |
Ga0209580_103260662 | 3300027842 | Surface Soil | RTSLLRVRGRRHINTAEILNRRNEVLARGKGTFIAIDPARMFAKHLGKSR |
Ga0209169_103857661 | 3300027879 | Soil | SVHGRQHINTAEILNDKNEVLARSRGIFIAIDPEKMFAKYVDR |
Ga0209590_107480451 | 3300027882 | Vadose Zone Soil | PVPLNKPLRVEGREMKVRGRTHVNSAEILNDKNEILARSRGIFIAIDPEKMFAKYVER |
Ga0209275_103474962 | 3300027884 | Soil | INMAEILNPKGEVLARGRGLFIAIDPQKMFAKFVDR |
Ga0209275_104616301 | 3300027884 | Soil | VPLHKPLRVEGRELTVKGRTHINAAEILNEKDEVLARSKGIFIAIDPEKMFAKFVER |
Ga0209380_100443451 | 3300027889 | Soil | INTAEILNDKNEVLARSRGIFIAIDPEKMFAKYVDR |
Ga0209380_101587264 | 3300027889 | Soil | INMAEILNEQNEVLARSRGIFIAIDPEKMFAKFVDRPVDR |
Ga0209415_107899252 | 3300027905 | Peatlands Soil | VSVHGRQHVNMAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER |
Ga0209526_105565161 | 3300028047 | Forest Soil | GNKHINTAEIVNEKGEILARSKGVFIAIDPDKMFAKFVGR |
Ga0302153_102692391 | 3300028574 | Bog | RTHVNAAEILNDKDEVLARSRGIFIAIDPEKMFAKYAER |
Ga0302231_102518891 | 3300028775 | Palsa | GRKHINMAEILNEKGEVLAHSQGLFIAIDPRRIFAGFVER |
Ga0307312_101041341 | 3300028828 | Soil | KRHVNSAEILNQKGEVLARSRGTFLAIDPRRMFAKFVESSR |
Ga0308309_104153441 | 3300028906 | Soil | HVEGREVSVQGRVHINEAEIMDENSEVLARSRGTFIAIDPEKMFAKYVGR |
Ga0308309_106288543 | 3300028906 | Soil | RHINMAEILNEKDEVLARSKGLFIAIDPKKMFAKFVEK |
Ga0308309_107958073 | 3300028906 | Soil | INAAEILNEKDEVLARSRGTFIAIDPAKMFAKYVER |
Ga0308309_111883741 | 3300028906 | Soil | THINAAEILNENNEVLARSRGTFIAIDPEKMFAKFVER |
Ga0308309_118479151 | 3300028906 | Soil | KGVSVNGRQHINMAEISNEKGEILARSRGTFIAIDPEKMFGRYAGR |
Ga0222749_105196051 | 3300029636 | Soil | RGRTHVNAAEILNDKDEVLARSRGIFIAIDPEQMFAKYVER |
Ga0311329_104572272 | 3300029907 | Bog | HINAAEILNEKNEVLARSRGIFIEIDPEKMFAKHIER |
Ga0311362_101979095 | 3300029913 | Bog | VEGHGVEIQGRVHTNAAEILNAKGEVLARSRGTFIAIDPARMFAKYLNK |
Ga0311358_102192143 | 3300029915 | Bog | LRVEGREIEKRGRTHVNAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0311371_111568912 | 3300029951 | Palsa | LRVEGREIKVEGRTHVNAAEILNEKDEVLARSRGIFIAIDPEKMFAKHVER |
Ga0311346_103704841 | 3300029952 | Bog | QHKPLRVEGREIEVRGRTHVNAAEILNDKDEVLARSRGIFIAIDPEKMFAKYAER |
Ga0311342_102743193 | 3300029955 | Bog | LSVEGRKHINIAEILNGKNEVLARSQGVFIAIDPHKMFGKFVER |
Ga0302150_102111251 | 3300029956 | Bog | EVRGAKHINAAEILNEKNEVLARSRGIFVAIDPEKMFAKYVER |
Ga0311339_106444332 | 3300029999 | Palsa | PLHVEGREVTVQGRVHINEAEIMDEKNEVLARSRGTFIAIDPEKMFAKYVGR |
Ga0311338_104298852 | 3300030007 | Palsa | LRVEGRELEVKGRTHVNVAEILNEKNEVLARSRGIFIAIDPERMFAKYVGP |
Ga0302176_102659572 | 3300030057 | Palsa | EIKVEGRTHVNAAEILNEKDEVLARSRGIFIAIDPEKMFANHVER |
Ga0311349_119598392 | 3300030294 | Fen | RRHINMAEILNQKDEVLARGQGLFIAIDPKKMFAKFVDR |
Ga0311370_121310342 | 3300030503 | Palsa | QPLRVEGHELEVHGRRHVNAAEIFNEQNEVLARSRGVFVAIDPEKMFAKFVER |
Ga0302183_102039771 | 3300030509 | Palsa | REVTVQGRVHINEAEIMDEKNEVLARSRGTFIAIDPEKMFAKYVGR |
Ga0302275_101905262 | 3300030518 | Bog | REIEKRGRTHVNAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0311372_108458131 | 3300030520 | Palsa | LRVEGRELEVKGRTHVNVAEILNEKNEVLARSRGIFIAIDPAKMFAKYVER |
Ga0311354_114820872 | 3300030618 | Palsa | PLRVEGRELEVKGRTHVNVAEILNEKNEVLARSRGIFIAIDPERMFAKYVGP |
Ga0316363_100616643 | 3300030659 | Peatlands Soil | VEGREVSVHGRQHVNMAEILNDKDEVLARSRGIFIAIDPEKMFAKYVER |
Ga0302310_106457501 | 3300030737 | Palsa | VNAAEILNEKDEVLARSRGIFIAIDPEKMFAKHVER |
Ga0265750_10671701 | 3300030813 | Soil | LHVEGREVSVQGRVHINEAEIMDENSEVLARSRGTFIAIDPEKMFAKYVGR |
Ga0302323_1033097041 | 3300031232 | Fen | HGRQHVNMAEILNEKDEVLARSKGIFIAIDPEKMFGKFVER |
Ga0265325_100352043 | 3300031241 | Rhizosphere | EVRGNKHINTAEILNEKNEVLARSRGTFIAIDPEKMFGKFVER |
Ga0302318_106508742 | 3300031258 | Bog | GREIEKRGRTHVNAAEILNDKNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0302320_109432582 | 3300031524 | Bog | AKHINAAEILNEKNEVLARSRGIFVAIDPEKMFAKYVER |
Ga0307476_101564481 | 3300031715 | Hardwood Forest Soil | KKGRTHVNSAEILNDKNEVLARSRGIFIAVDPAKMFAKYVDK |
Ga0307476_101862363 | 3300031715 | Hardwood Forest Soil | VEVRGRTHINAAEILNEKNEVLARSRGTFIAIDPEKMFAKYVER |
Ga0307476_111632072 | 3300031715 | Hardwood Forest Soil | PLRVEGKEVSVEGRIHINAAEILNEKDEVLARSKGTFIAIDPEKMFAKFVER |
Ga0307474_113102321 | 3300031718 | Hardwood Forest Soil | INSAEILNEQGEVLARSRGIFIAIDPEKMFGKFVER |
Ga0307477_102565871 | 3300031753 | Hardwood Forest Soil | THVNAAEILNDKNEVLARSKGIFIAIDPAKMFAKYAER |
Ga0307475_115782681 | 3300031754 | Hardwood Forest Soil | IEVRGTKHINAAEILNENNEVLARSRGIFIAIDPEKMFAKYVER |
Ga0318567_105872362 | 3300031821 | Soil | HVNMAEILNQKDEVLASSEGLFIAIDPKKMFAKFVEK |
Ga0307478_108390671 | 3300031823 | Hardwood Forest Soil | EIKKRGRTHVNMAEILNEKNEVLARSRGIFIAIDPEKMFAKFVER |
Ga0311301_119088451 | 3300032160 | Peatlands Soil | HGRQHVNMAEILNDKNEVLARSKGVFIAIDPEKMFGKFVER |
Ga0307472_1002881711 | 3300032205 | Hardwood Forest Soil | RRHVNMAEIVNAKGEVLARSRGLFIAIDPKRMFAKFVER |
Ga0335082_100923681 | 3300032782 | Soil | NEAWISNEKNEVLARSRGVFIAIDPERMFGKFVER |
Ga0335082_106816911 | 3300032782 | Soil | GREVSVRGTQHINEAWILNDKDEVLARSRGVFIAIDPERMFGKFVER |
Ga0335082_116794902 | 3300032782 | Soil | QGRKHTNVAAILDQKGEVMARGRGLFIAIDAAKMFGKFVER |
Ga0335079_101449361 | 3300032783 | Soil | RHINVAEILNQKGEVLARGRGIFIAIDPHKLFAKFVER |
Ga0335079_106928832 | 3300032783 | Soil | PVPLHKPLRVEGKEVSVHGRQHINMAEIFNDKGEILAHSRGTFIAIDPEKMFGKFVER |
Ga0335078_120253572 | 3300032805 | Soil | GRRHINVAEILNRKGEVLARGRGTFIAVDPYKMFARFVER |
Ga0335081_103735523 | 3300032892 | Soil | NMAEILNQKNEVLARGQGVFIAIDPHKMFGKFVEK |
Ga0335081_111240371 | 3300032892 | Soil | RYHTNEAEILNSKGEVLARSKGLFIAIDPHKMFAKFVDR |
Ga0335076_100763671 | 3300032955 | Soil | RGRYHTNMAEILNAKGEVLARSRGLFIAIDPHKLFAKFVDR |
Ga0335084_102928542 | 3300033004 | Soil | GRKHTNVAAILDQKGEVMARGRGLFIAIDAAKMFGKCVER |
Ga0326728_103596731 | 3300033402 | Peat Soil | NMAEILNEKGEVLANSEGVFVAIDPHRMFARFVDR |
⦗Top⦘ |