NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019694

Metagenome / Metatranscriptome Family F019694

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019694
Family Type Metagenome / Metatranscriptome
Number of Sequences 228
Average Sequence Length 39 residues
Representative Sequence PTHSVSEKLSVFAFAAVVLAVIVGGAFAAGYLIGRILL
Number of Associated Samples 182
Number of Associated Scaffolds 228

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.52 %
% of genes near scaffold ends (potentially truncated) 20.61 %
% of genes from short scaffolds (< 2000 bps) 82.02 %
Associated GOLD sequencing projects 167
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.930 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(18.421 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.105 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 228 Family Scaffolds
PF12773DZR 19.30
PF08245Mur_ligase_M 8.77
PF00334NDK 5.70
PF10458Val_tRNA-synt_C 3.95
PF08241Methyltransf_11 3.51
PF02545Maf 0.88
PF02518HATPase_c 0.44
PF01957NfeD 0.44
PF14539DUF4442 0.44
PF01797Y1_Tnp 0.44
PF01168Ala_racemase_N 0.44
PF07927HicA_toxin 0.44
PF04655APH_6_hur 0.44
PF02574S-methyl_trans 0.44
PF01925TauE 0.44
PF07729FCD 0.44
PF12704MacB_PCD 0.44
PF13400Tad 0.44

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 228 Family Scaffolds
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 5.70
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 0.88
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.44
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.44
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.44
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.44
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.44
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.44
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.44
COG3570Streptomycin 6-kinaseDefense mechanisms [V] 0.44


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.93 %
UnclassifiedrootN/A3.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig92067Not Available557Open in IMG/M
2166559005|cont_contig00529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3788Open in IMG/M
2166559005|cont_contig56732All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300000955|JGI1027J12803_100677014All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300000956|JGI10216J12902_118788114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales805Open in IMG/M
3300001535|A3PFW1_10088410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1025Open in IMG/M
3300001536|A1565W1_10037358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium881Open in IMG/M
3300002568|C688J35102_119033858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300003990|Ga0055455_10210742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300004063|Ga0055483_10222418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300004479|Ga0062595_100905876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales744Open in IMG/M
3300005172|Ga0066683_10240323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1122Open in IMG/M
3300005187|Ga0066675_10278097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1205Open in IMG/M
3300005327|Ga0070658_10017461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5740Open in IMG/M
3300005327|Ga0070658_10054748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3239Open in IMG/M
3300005327|Ga0070658_10067190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2929Open in IMG/M
3300005327|Ga0070658_11491340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300005329|Ga0070683_100433583All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300005434|Ga0070709_10467255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium953Open in IMG/M
3300005435|Ga0070714_100140148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.2170Open in IMG/M
3300005436|Ga0070713_101446270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300005439|Ga0070711_101436438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300005445|Ga0070708_102074443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales526Open in IMG/M
3300005458|Ga0070681_10767501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales881Open in IMG/M
3300005467|Ga0070706_101367306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300005471|Ga0070698_100999565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales784Open in IMG/M
3300005526|Ga0073909_10089717All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300005529|Ga0070741_10149376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2352Open in IMG/M
3300005529|Ga0070741_10228497All Organisms → cellular organisms → Bacteria1789Open in IMG/M
3300005529|Ga0070741_10342004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1391Open in IMG/M
3300005530|Ga0070679_100661957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales987Open in IMG/M
3300005532|Ga0070739_10000270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria104365Open in IMG/M
3300005534|Ga0070735_10238867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1104Open in IMG/M
3300005537|Ga0070730_10006554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9944Open in IMG/M
3300005537|Ga0070730_10727542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales628Open in IMG/M
3300005538|Ga0070731_10035026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3384Open in IMG/M
3300005538|Ga0070731_10443502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales864Open in IMG/M
3300005555|Ga0066692_10469661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales802Open in IMG/M
3300005556|Ga0066707_10357260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales955Open in IMG/M
3300005556|Ga0066707_10555117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300005556|Ga0066707_10676330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300005559|Ga0066700_10348365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1046Open in IMG/M
3300005561|Ga0066699_10468679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria901Open in IMG/M
3300005563|Ga0068855_100193245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2294Open in IMG/M
3300005568|Ga0066703_10900163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300005569|Ga0066705_10126642All Organisms → cellular organisms → Bacteria1546Open in IMG/M
3300005576|Ga0066708_10182047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1309Open in IMG/M
3300005598|Ga0066706_10270499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1328Open in IMG/M
3300005614|Ga0068856_100781167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales975Open in IMG/M
3300005764|Ga0066903_100181698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3103Open in IMG/M
3300005764|Ga0066903_104951250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales707Open in IMG/M
3300005874|Ga0075288_1048451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales655Open in IMG/M
3300005900|Ga0075272_1123950Not Available505Open in IMG/M
3300006028|Ga0070717_11016362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales755Open in IMG/M
3300006032|Ga0066696_10281684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1078Open in IMG/M
3300006059|Ga0075017_100685171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales788Open in IMG/M
3300006175|Ga0070712_100978239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales732Open in IMG/M
3300006426|Ga0075037_1524735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300006794|Ga0066658_10539642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300006796|Ga0066665_11156021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales590Open in IMG/M
3300006804|Ga0079221_10649191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium723Open in IMG/M
3300006950|Ga0075524_10038813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1945Open in IMG/M
3300007775|Ga0102953_1008144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5259Open in IMG/M
3300007820|Ga0104324_105793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1098Open in IMG/M
3300009012|Ga0066710_102098969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium831Open in IMG/M
3300009038|Ga0099829_10347136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1221Open in IMG/M
3300009038|Ga0099829_11293115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300009038|Ga0099829_11522130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300009090|Ga0099827_10118046All Organisms → cellular organisms → Bacteria → Terrabacteria group2132Open in IMG/M
3300009090|Ga0099827_10604045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales946Open in IMG/M
3300009090|Ga0099827_10622642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium931Open in IMG/M
3300009090|Ga0099827_10633289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria923Open in IMG/M
3300009090|Ga0099827_12002678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300009137|Ga0066709_102457395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium705Open in IMG/M
3300009143|Ga0099792_10643979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter680Open in IMG/M
3300009143|Ga0099792_10681018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300009147|Ga0114129_13172444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300009162|Ga0075423_11206047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300009174|Ga0105241_11704197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300009518|Ga0116128_1029375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1830Open in IMG/M
3300009551|Ga0105238_11185296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300009792|Ga0126374_10395293All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300010046|Ga0126384_10996028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300010325|Ga0134064_10399411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300010337|Ga0134062_10211438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales888Open in IMG/M
3300010361|Ga0126378_11524690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300010362|Ga0126377_10113362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2493Open in IMG/M
3300010362|Ga0126377_13617520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300010371|Ga0134125_11472816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300010371|Ga0134125_11530003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300010373|Ga0134128_10169344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2466Open in IMG/M
3300010373|Ga0134128_12309343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300010396|Ga0134126_10705925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1146Open in IMG/M
3300010396|Ga0134126_10811320All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300010396|Ga0134126_10942688All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300010396|Ga0134126_10978253All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300010396|Ga0134126_11429982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300010399|Ga0134127_10658687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1082Open in IMG/M
3300010400|Ga0134122_12373714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300011270|Ga0137391_11119986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales635Open in IMG/M
3300011270|Ga0137391_11267067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300011991|Ga0120153_1019252All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300012001|Ga0120167_1028882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1330Open in IMG/M
3300012014|Ga0120159_1101081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium826Open in IMG/M
3300012189|Ga0137388_10188034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1854Open in IMG/M
3300012200|Ga0137382_10674588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales740Open in IMG/M
3300012200|Ga0137382_10722698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300012202|Ga0137363_11393423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300012203|Ga0137399_11195714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300012204|Ga0137374_10022339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales7140Open in IMG/M
3300012205|Ga0137362_11321020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300012208|Ga0137376_10333520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1317Open in IMG/M
3300012209|Ga0137379_10624098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales984Open in IMG/M
3300012212|Ga0150985_109790546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300012285|Ga0137370_10998394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300012285|Ga0137370_11020714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300012350|Ga0137372_11072330Not Available555Open in IMG/M
3300012362|Ga0137361_10760841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium883Open in IMG/M
3300012469|Ga0150984_108241787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300012469|Ga0150984_120818772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1289Open in IMG/M
3300012582|Ga0137358_10462404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300012683|Ga0137398_10171977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1417Open in IMG/M
3300012922|Ga0137394_10403314All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300012923|Ga0137359_10276707All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300012924|Ga0137413_10063348All Organisms → cellular organisms → Bacteria2188Open in IMG/M
3300012924|Ga0137413_10516898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales881Open in IMG/M
3300012925|Ga0137419_11165273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.644Open in IMG/M
3300012927|Ga0137416_11273007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300012929|Ga0137404_10616097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria977Open in IMG/M
3300012929|Ga0137404_11655978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300012931|Ga0153915_11321491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales843Open in IMG/M
3300012931|Ga0153915_11655193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300012944|Ga0137410_10857508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales766Open in IMG/M
3300012948|Ga0126375_11633916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300012957|Ga0164303_10650233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300012960|Ga0164301_10340658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1027Open in IMG/M
3300012960|Ga0164301_10967094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300012964|Ga0153916_11250994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales820Open in IMG/M
3300012972|Ga0134077_10385180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300012976|Ga0134076_10136820All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300012982|Ga0168317_1000530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria26175Open in IMG/M
3300012984|Ga0164309_10593175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium864Open in IMG/M
3300012986|Ga0164304_10542900All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300012987|Ga0164307_10798188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300013100|Ga0157373_11459168Not Available521Open in IMG/M
3300013104|Ga0157370_10813478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300013104|Ga0157370_10834608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria838Open in IMG/M
3300013105|Ga0157369_10560376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1181Open in IMG/M
3300013105|Ga0157369_11333379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300013307|Ga0157372_12090986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300013503|Ga0120127_10122817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300014157|Ga0134078_10500396Not Available565Open in IMG/M
3300014497|Ga0182008_10106723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1386Open in IMG/M
3300014497|Ga0182008_10316057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium821Open in IMG/M
3300014497|Ga0182008_10384776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300015087|Ga0167637_1028785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium778Open in IMG/M
3300015164|Ga0167652_1040311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium901Open in IMG/M
3300015195|Ga0167658_1042122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1152Open in IMG/M
3300015261|Ga0182006_1028031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2294Open in IMG/M
3300015262|Ga0182007_10142929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300015262|Ga0182007_10255935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300015264|Ga0137403_10075832All Organisms → cellular organisms → Bacteria3406Open in IMG/M
3300015264|Ga0137403_11452118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300015358|Ga0134089_10459682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300015371|Ga0132258_10246542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4364Open in IMG/M
3300015371|Ga0132258_10823490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2341Open in IMG/M
3300017654|Ga0134069_1166967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300017927|Ga0187824_10223325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales647Open in IMG/M
3300017929|Ga0187849_1000912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria36082Open in IMG/M
3300017936|Ga0187821_10136315All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300017961|Ga0187778_10365487All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300017994|Ga0187822_10003815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3262Open in IMG/M
3300018005|Ga0187878_1003446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia13063Open in IMG/M
3300018468|Ga0066662_11067866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium804Open in IMG/M
3300018482|Ga0066669_11812833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300019887|Ga0193729_1018961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3000Open in IMG/M
3300019888|Ga0193751_1125127All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300019888|Ga0193751_1186161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300020075|Ga0206349_1074255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300020081|Ga0206354_11255090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300020081|Ga0206354_11493316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300021363|Ga0193699_10016754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2650Open in IMG/M
3300021372|Ga0213877_10003597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3574Open in IMG/M
3300021478|Ga0210402_11580030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300024055|Ga0247794_10351110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300024330|Ga0137417_1509936All Organisms → cellular organisms → Bacteria3696Open in IMG/M
3300025482|Ga0208715_1093724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300025484|Ga0208587_1107931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300025588|Ga0208586_1083170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300025909|Ga0207705_10077152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2423Open in IMG/M
3300025912|Ga0207707_10072205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3008Open in IMG/M
3300025912|Ga0207707_10170249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1903Open in IMG/M
3300025912|Ga0207707_10880567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300025915|Ga0207693_10891941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300025922|Ga0207646_10658208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium938Open in IMG/M
3300025928|Ga0207700_10477134All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300025928|Ga0207700_11150966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300025929|Ga0207664_10014552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5686Open in IMG/M
3300025929|Ga0207664_11902472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300025939|Ga0207665_10464478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria973Open in IMG/M
3300025993|Ga0208415_1019789All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300026306|Ga0209468_1062906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1249Open in IMG/M
3300026335|Ga0209804_1206613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300027466|Ga0207484_105655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300027738|Ga0208989_10063980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1265Open in IMG/M
3300027773|Ga0209810_1000124All Organisms → cellular organisms → Bacteria232486Open in IMG/M
3300027815|Ga0209726_10007178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12562Open in IMG/M
3300027826|Ga0209060_10058627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1841Open in IMG/M
3300027846|Ga0209180_10566455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium631Open in IMG/M
3300027869|Ga0209579_10309948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales851Open in IMG/M
3300027903|Ga0209488_10664023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300027986|Ga0209168_10220291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales945Open in IMG/M
3300028536|Ga0137415_11083942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300028563|Ga0265319_1001966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11608Open in IMG/M
3300030006|Ga0299907_10150245All Organisms → cellular organisms → Bacteria1926Open in IMG/M
3300031229|Ga0299913_11149020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium738Open in IMG/M
3300031240|Ga0265320_10024094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3226Open in IMG/M
3300031670|Ga0307374_10101466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2492Open in IMG/M
3300031712|Ga0265342_10509467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300031716|Ga0310813_11700310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300031938|Ga0308175_100111224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2547Open in IMG/M
3300031996|Ga0308176_12744351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300032770|Ga0335085_11766993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300032892|Ga0335081_10961350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1000Open in IMG/M
3300032893|Ga0335069_10576416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1294Open in IMG/M
3300033233|Ga0334722_10040938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3727Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil6.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.70%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.63%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.19%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.75%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.32%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.32%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.32%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.32%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.32%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.88%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.44%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.44%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.44%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.44%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.44%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.44%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.44%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.44%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.44%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.44%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005900Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006426Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300007775Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MGEnvironmentalOpen in IMG/M
3300007820Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011991Permafrost microbial communities from Nunavut, Canada - A34_65cm_12MEnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012982Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfieldEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015087Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015164Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025482Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025484Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025588Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300027466Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-B (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_105931502124908045SoilVAAATTHSVGEKLGVFAFAAVVLVVIVGGAFAAGYLIGRILL
cont_0529.000000702166559005SimulatedNVREKISVFAVAIFVLVVVVGGAFAAGYLIGRILL
cont_0732.000040902166559005SimulatedVASARPHTFGEKVSVFALAAFVLLVIVGGAFAAGYFIGKMFL
JGI1027J12803_10067701423300000955SoilLSEKASVFALAAFLLVAIVGGAFAAGYLIGRMLL*
JGI10216J12902_11878811423300000956SoilVSEKLSVFALAIFVLVIIVGGAFAAGYLIGRILL*
A3PFW1_1008841033300001535PermafrostVRDKASVFALAAFVLLAIVGGAFAAGYLIGRMLLC
A1565W1_1003735823300001536PermafrostMATAPAHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL*
C688J35102_11903385823300002568SoilMAPTHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL*
Ga0055455_1021074213300003990Natural And Restored WetlandsMNAATTTTHSVGEKLSIFALAAFVLATVVGGAFAAGYLIGRMLL*
Ga0055483_1022241823300004063Natural And Restored WetlandsMNAATTTRHSVGERLSIFALAAFVLAVVVGGAFAAGYLIGRMLL*
Ga0062595_10090587623300004479SoilMHAARTHTVGERVGIFAFAALVLTLIVGGAFAAGYLIGRIFL*
Ga0066683_1024032323300005172SoilVAPTHSFSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL*
Ga0066675_1027809723300005187SoilVTRPHSVGERLSVFALAVFFLVSLVGVAFAAGYLIGRMLL*
Ga0070658_1001746193300005327Corn RhizosphereVTPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0070658_1005474833300005327Corn RhizosphereVNPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRI
Ga0070658_1006719063300005327Corn RhizospherePATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0070658_1149134013300005327Corn RhizosphereNPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0070683_10043358323300005329Corn RhizosphereMPTHTVSEKLGVFAFAALVLAVIVGGAFAAGYLIGRILL*
Ga0070709_1046725523300005434Corn, Switchgrass And Miscanthus RhizosphereVAPARPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL*
Ga0070714_10014014833300005435Agricultural SoilVNPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL
Ga0070713_10144627023300005436Corn, Switchgrass And Miscanthus RhizosphereVARGRPHTFGDKASVFALAAFVLLAIVGGAFAAGYVIGRMLL*
Ga0070711_10143643823300005439Corn, Switchgrass And Miscanthus RhizosphereMAPTHRVSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL*
Ga0070708_10207444323300005445Corn, Switchgrass And Miscanthus RhizosphereMRATTHSVSDKLGVFAFAAVVLVVIVGGAFAAGYLIGRILL*
Ga0070681_1076750123300005458Corn RhizosphereVAPARPHTFGEKVSVFALAAFVLIAIVGGAFAAGYVIGRMFL*
Ga0070706_10136730623300005467Corn, Switchgrass And Miscanthus RhizosphereVAPARTHTASEKLSVFALAIFVLLAIVGGAFAAGYLIGRMLL*
Ga0070698_10099956523300005471Corn, Switchgrass And Miscanthus RhizosphereMRGATTHSVSEKLGIFAVAGLVLVVVVGGAFLAGYLIGRILL*
Ga0073909_1008971733300005526Surface SoilVGEKVSVFALATFVLVLIVGGAFAAGYLIGRILL*
Ga0070741_1014937643300005529Surface SoilVNAATHRGSEKLGVFAFAIGVLIVIVGGAFAAGYLIGRILL*
Ga0070741_1022849723300005529Surface SoilMSEKLGVFAFATTILVVIVGGAFAAGYLIGRILL*
Ga0070741_1034200423300005529Surface SoilVHAVTHSPREKLSIFVFAAAVLVLVVGGAFAAGYLIGRMLL*
Ga0070679_10066195723300005530Corn RhizosphereVAHTHSVSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL*
Ga0070739_10000270903300005532Surface SoilVAAATHRGSEKLGVFAFAIGLLVVIVGGAFAAGYLIGRILL*
Ga0070734_1018940033300005533Surface SoilVHAAIHSPREKLSIFLFAAVVLVVVVGGAFAAGYLIGRIFL*
Ga0070735_1023886723300005534Surface SoilVAARTHTAGEKVSVFALAIFVLLAIVGGAFAAGYLIGRMLL*
Ga0070730_1000655463300005537Surface SoilVSERLGVFAFAAVVLVVIVGGAFAAGYLIGRILL*
Ga0070730_1072754223300005537Surface SoilLSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL*
Ga0070731_1003502633300005538Surface SoilVSEKLGVFAFAIAILVVIVGGAFAAGYLIGRILL*
Ga0070731_1044350223300005538Surface SoilMQAARSHTVGERVGIFAFAAFVLTVIVGGAFAAGYLIGRIFL*
Ga0066692_1046966123300005555SoilVSEKLSVFGLATVVLAVIVGGAFAAGYLIGRILL*
Ga0066707_1035726023300005556SoilVSEKLSVFAMAAVVLAVIVGGAFAAGYLIGRILL*
Ga0066707_1055511723300005556SoilVSEKLSVFALAIFVLLVIVGGAFAAGYLIGRILL*
Ga0066707_1067633023300005556SoilVAQARTHTASEKLSVFALAIFVLLTIVGGAFAAGYLIGRMFL*
Ga0066700_1034836523300005559SoilVSEKLSVFAFAAFVLAVIVGGAFAAGYLIGRILL*
Ga0066699_1046867923300005561SoilMAAFGEKLGVFAFAFFVLVAIVGGAFLAGYLIGRMLL*
Ga0068855_10019324533300005563Corn RhizosphereVSEKLSVFAFAAVVLAVIVGGAFAAGYLIGRILL*
Ga0066703_1090016323300005568SoilMAAFREKLGVFAFALFVLVAIVGGAFLAGYLIGRMLL*
Ga0066705_1012664213300005569SoilVAAAPTHTHKVSEKLGVFAFAIAILVMIVGGAFAAGYLIGRI
Ga0066708_1018204723300005576SoilVSEKLSVFAFAAFVLAVIVGGAFAAGYFIGRILL*
Ga0066706_1027049923300005598SoilVSEKLSVFALAAVVLAVIVGGAFAAGYLIGRILL*
Ga0068856_10078116723300005614Corn RhizosphereVSEKLSVFTLAAVVLAVIVGGAFAAGYLIGRILL*
Ga0066903_10018169823300005764Tropical Forest SoilVRERISVFALAAFVLVVVVGGAFAAGYLIGRILL*
Ga0066903_10495125023300005764Tropical Forest SoilVGEKISVFAVAIFVLVVVVGGAFAAGYLIGRILL*
Ga0075288_104845123300005874Rice Paddy SoilVPTHSVSEKLGVFAFAALVLAVIVGGAFAAGYLIGRILL*
Ga0075272_112395023300005900Rice Paddy SoilVSEKLSVFALATFVLVVIVGGAFAAGYLIGRILL*
Ga0070717_1101636223300006028Corn, Switchgrass And Miscanthus RhizosphereVSEKLGVFAFAAVVLVLIVGGAFAAGYLIGRVLL*
Ga0066696_1028168423300006032SoilVAAAPTHTHKVSEKLGVFAFAIAILVMIVGGAFAAGY
Ga0075017_10068517123300006059WatershedsVREKISVFAVAIFVLVLVVGGAFAAGYLIGRILL*
Ga0070712_10097823923300006175Corn, Switchgrass And Miscanthus RhizosphereVSEKVSVFALAAFVLVVIVGGAFAAGYLIGRILL*
Ga0075037_152473523300006426Permafrost SoilPHTLRDKASVFALAAFLLLAIVGGAFAAGYLIGRMLL*
Ga0066658_1053964213300006794SoilMAAATTHRVSEKLSVFAFAAALLVVIVGGAFAAGYFIGRILL*
Ga0066665_1115602123300006796SoilMSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL*
Ga0079221_1064919123300006804Agricultural SoilVGEKLGVFAFAIAILVVIVGGAFAAGYLIGRILL*
Ga0075524_1003881343300006950Arctic Peat SoilVSDKASVFALAAFVLLAIVGGAFAAGYLIGRMLL*
Ga0102953_100814433300007775SoilMREKLPIFALAAAVLVIVVGGAFAAGYLIGRMIL*
Ga0104324_10579323300007820SoilVSEKASVFALAALVLLAIVGGAFAAGYLIGRMLL*
Ga0066710_10209896923300009012Grasslands SoilVAPTHSFSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL
Ga0099829_1034713623300009038Vadose Zone SoilVAQARTHTASEKLSVFALAIFVLLAIVGGAFAAGYLIGRMFL*
Ga0099829_1129311523300009038Vadose Zone SoilVSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL*
Ga0099829_1152213023300009038Vadose Zone SoilVSERLSVFALAAVVLAVIVGGAFAAGYLIGRILL*
Ga0099827_1011804653300009090Vadose Zone SoilVARATTHSVSEKLSVFAFAAFLLLAIVGGAFAAGYFIGRMLL*
Ga0099827_1060404523300009090Vadose Zone SoilVSEKVSVFALAAVVLVVIVGGAFAAGYLIGRILL*
Ga0099827_1062264223300009090Vadose Zone SoilVSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL*
Ga0099827_1063328923300009090Vadose Zone SoilMATAPAHRLSDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL*
Ga0099827_1200267823300009090Vadose Zone SoilVSQKLGVFAFAAVVLVVIVGGAFAAGYLIGRVLL*
Ga0066709_10245739513300009137Grasslands SoilVAQVRTHSVGERLSVFALAVFVLVAIVGVAFAAGYLIGRMLL*
Ga0099792_1064397923300009143Vadose Zone SoilVATASTHTVGEKLSVFALAIFVLLAIVGGAFAAGYLIGRMLL*
Ga0099792_1068101823300009143Vadose Zone SoilMATAPVHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL*
Ga0114129_1317244413300009147Populus RhizosphereTTHSVGEKLGVFAFAAVVLVMIVGGAFAAGYLIGRILL*
Ga0075423_1120604713300009162Populus RhizosphereVAAATTHSVGEKLGVFAFAAVVLVMIVGGAFAAGYLIGR
Ga0105241_1170419723300009174Corn RhizosphereVNPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0116128_102937543300009518PeatlandVVEKLSIFAVAGLVLVVIVGGAFAAGYLIGRVLL*
Ga0105238_1118529623300009551Corn RhizosphereVSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL*
Ga0126374_1039529333300009792Tropical Forest SoilVAPTHRGEKVGVFALAACLLVVIVGGAFAAGYLIGRILL*
Ga0126384_1099602823300010046Tropical Forest SoilMTRVGERLGVFAIALLILLAIVGGAFAAGYVIGKMFL*
Ga0134064_1039941113300010325Grasslands SoilPHSVGERLSVFALAVFFLVSLVGVAFAAGYLIGRMLL*
Ga0134062_1021143823300010337Grasslands SoilVRQTHSVGERLSVFALAVFVLVTIVGVAFAAGYLIGRMLL*
Ga0126378_1152469023300010361Tropical Forest SoilVARPPTHSVGERISVFALALFVLVLVVGGAFAAGYLIGRILL*
Ga0126377_1011336233300010362Tropical Forest SoilMTRVGDRLGVFAIALLVLLAIVGGAFAAGYLIGKMFL*
Ga0126377_1361752023300010362Tropical Forest SoilVARATTHSVGERLSVFAFATFLLIAIVGGAFAAGYFIGRMLL*
Ga0134125_1147281633300010371Terrestrial SoilPTSVMTAVTHRSEKLGVFAFATLVLVVIVGGAFAAGYLIGRILL*
Ga0134125_1153000323300010371Terrestrial SoilMATAPTHKLSDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL*
Ga0134128_1016934423300010373Terrestrial SoilVTPATVHSLGDRISVFALAFFLLVVIVGGAFAAGYLIGRILL*
Ga0134128_1230934323300010373Terrestrial SoilVSEKLGVFAFAITVLVVIVGGAFAAGYLIGRILL*
Ga0134126_1070592523300010396Terrestrial SoilVSEKVSVFALAAVVLAVIVGGAFAAGYLIGRILL*
Ga0134126_1081132023300010396Terrestrial SoilMTAVTHRSEKLGVFAFATLVLVVIVGGAFAAGYLIGRILL*
Ga0134126_1094268823300010396Terrestrial SoilVNPATVHSLGDRISVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0134126_1097825313300010396Terrestrial SoilKVSEKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL*
Ga0134126_1142998213300010396Terrestrial SoilVAPASPHTLGDRISVFALAAFLLVVIVGGAFAAGYLIGRMLL*
Ga0134127_1065868723300010399Terrestrial SoilVNPATVHSLGDRVSVFALAFFVLAVIVGGAFAAGYLIGRILL*
Ga0134122_1237371423300010400Terrestrial SoilVGEKLSVFALATFVLVLIVGGAFAAGYLIGRILL*
Ga0137391_1111998623300011270Vadose Zone SoilVREKISVFAVAIFVLVVVVGGAFAAGYLIGRILL*
Ga0137391_1126706723300011270Vadose Zone SoilARTHTASEKLSVFALAIFVLLTIVGGAFAAGYLIGRMFL*
Ga0120153_101925243300011991PermafrostMATAPAHRLSDKLSVFAFALGVLAVIVGGAFAAGYLIGRILL*
Ga0120167_102888223300012001PermafrostVSEKASVFALATFVLLAIVGGAFAAGYLIGRMLL*
Ga0120159_110108123300012014PermafrostVSDKASVFALAAFVLLAIVGGAFAAGYLIGRILL*
Ga0137388_1018803443300012189Vadose Zone SoilRTSVPPARTHTANEKLSVFALAIFVLLAIVGGAFAAGYLIGRMLL*
Ga0137382_1067458823300012200Vadose Zone SoilVAAATTHSVGEKLGVFAFAAVVLVVIVGGAFAAGYLIGRILL*
Ga0137382_1072269833300012200Vadose Zone SoilSENEKLSVFGLAAVVLVVIVGGAFAPGYLLGRILL*
Ga0137363_1139342313300012202Vadose Zone SoilVATASTHTVGEKLSVFALAIFVLLAIVGGAFAAGYLI
Ga0137399_1119571413300012203Vadose Zone SoilPAHRLSDKLSVFAFALGVLAVIVGGAFAAGYLIGRILL*
Ga0137374_1002233933300012204Vadose Zone SoilVSEKLSVFALAIFVLVLIVGGAFAAGYLIGRILL*
Ga0137362_1132102023300012205Vadose Zone SoilVATASTHTVGEKLSVFALAIFVLLAIVGGAFAAGYLIGRMFL*
Ga0137376_1033352023300012208Vadose Zone SoilLSDKLSVFAFALGVLAVIVGGAFAAGYLIGRILL*
Ga0137379_1062409823300012209Vadose Zone SoilVAPTHSLSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL*
Ga0150985_10979054623300012212Avena Fatua RhizosphereVAAAQTHSVGEKLTVFAFAAVLLVVIVGGAFAAGYFIGRILL*
Ga0137370_1099839423300012285Vadose Zone SoilVNEKFSVFALAAVVLAVIVGYAFTAGYLIGRILL*
Ga0137370_1102071413300012285Vadose Zone SoilVSEKLSVFALAAIVLAVIVGGAFAAGYLIGRILL*
Ga0137372_1107233023300012350Vadose Zone SoilVSEKLSVFALAIFVLLVIVGGAFAAGYLICRILL*
Ga0137361_1076084113300012362Vadose Zone SoilVAQARTHTASEKLSVFALAIFVLLTIVGGAFAAGYLI
Ga0150984_10824178723300012469Avena Fatua RhizosphereVAAAQTHSAGEKLTVFAFAAVLLVVIVGGAFAAGYFIGRILL*
Ga0150984_12081877243300012469Avena Fatua RhizosphereSPSSVAAAQTHSAGEKLTVFAFAAVILVVIVGGAFAAGYFIGRILL*
Ga0137358_1046240413300012582Vadose Zone SoilAPSIFLRRSVATASTHTVGEKLSVFALAIFVLLAIVGGAFAAGYLIGRMLL*
Ga0137398_1017197723300012683Vadose Zone SoilVSDKLSVFAFALGVLLVIVGGAFAAGYLIGRILL*
Ga0137394_1040331423300012922Vadose Zone SoilMATAPTHRLSDKLSVFAFAFGVLVVIVGGAFAAGYLIGRILL*
Ga0137359_1027670733300012923Vadose Zone SoilMRTRTHSVSQKLGVFAFAAVVLVVIVGGAFAAGYLIGRVLL*
Ga0137413_1006334823300012924Vadose Zone SoilMAPPHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL*
Ga0137413_1051689823300012924Vadose Zone SoilVAPARPHTLGDKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL*
Ga0137419_1116527323300012925Vadose Zone SoilVREKASVFALAAFLLLAIVGGAFAAGYLIGRMLL*
Ga0137416_1127300723300012927Vadose Zone SoilFLATSVAPARRHTVTDKASVFALAAFVLLAIVGGAFAAGYLIGRMLL*
Ga0137404_1061609723300012929Vadose Zone SoilVAQARTHTASEKLSVFALASFVLLAIVGGAFAAGYLIGRMFL*
Ga0137404_1165597823300012929Vadose Zone SoilVAQATTHSVSEKLSVFAFAAFLLLAIVGGAFAAGYFIGRMLL*
Ga0153915_1132149123300012931Freshwater WetlandsVAVASTHSLGEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL*
Ga0153915_1165519323300012931Freshwater WetlandsLSEKASVFALAAFVLLAIVGGAFAAGYLIGRMLL*
Ga0137410_1085750823300012944Vadose Zone SoilVSEKLSVFAFATFLLLAIVGGAFAAGYFIGRMLL*
Ga0126375_1163391623300012948Tropical Forest SoilMTRVGERLGVFAIALLVLLGIVGGAFAAGYVIGKMFL*
Ga0164303_1065023313300012957SoilPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL*
Ga0164301_1034065823300012960SoilVTPATVHSLGDRISVFALAFFRLGVIVGGAVAAGYLSGRILL*
Ga0164301_1096709423300012960SoilVASARPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL*
Ga0153916_1125099423300012964Freshwater WetlandsLSEKASVFALAAFVLFAIVGGAFAAGYLIGRMLL*
Ga0134077_1038518023300012972Grasslands SoilVPPAPTHSLGDRVSVFALALFVLALIVGGAFAAGYLIGRILL*
Ga0134076_1013682023300012976Grasslands SoilVSEKLSVFALAIFVLLVIVAGAFAAGYLIGRILL*
Ga0168317_1000530113300012982Weathered Mine TailingsVATVRAHSATEKLSVFALAIFVLLAVVGGAFAAGYLIGRMFL*
Ga0164309_1059317523300012984SoilVAAAQTNSVGEKLTVFAFAAVLLVVIVGGAFAAGYFIGRILL*
Ga0164304_1054290013300012986SoilTVREKASVFALAAFVLLAIVGGAFAAGYLIGRMLL*
Ga0164307_1079818813300012987SoilVAPARPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIG
Ga0157373_1145916813300013100Corn RhizosphereVTPATVHSLGDRISVVALAFFLLVVIVGGAFAAGYLIGRILL*
Ga0157370_1081347823300013104Corn RhizosphereVNPATVHSLGDRLSVFALAFFLLVVIVGGAFAAGYLIGRILL*
Ga0157370_1083460833300013104Corn RhizosphereVTPATVHSLGDRFAVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0157369_1056037633300013105Corn RhizosphereVAPATVHSLGDRLSVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0157369_1133337913300013105Corn RhizosphereLGDRFAVFALAFFVLVVIVGGAFAAGYLLGRILL*
Ga0157372_1209098623300013307Corn RhizosphereVAPATVHSPGDRFAVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0120127_1012281723300013503PermafrostVSDKLSVFAFAAAVLVVIVGGAFAAGYLIGRILL*
Ga0134078_1050039623300014157Grasslands SoilVAAAPTHSVSEKLGVFAFAAIVLAVIVGSAFAAGYLIGRILL*
Ga0182008_1010672323300014497RhizosphereVNPATVHSLGDRISVFALAFFLLVVIVGGAFAAGYLIGRILL*
Ga0182008_1031605723300014497RhizosphereVTEKLGVFAFAIAILVVIVGGAFAAGYLIGRILL*
Ga0182008_1038477623300014497RhizosphereVTPATVHSRGDKLSVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0167637_102878523300015087Glacier Forefield SoilLSDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL*
Ga0167652_104031123300015164Glacier Forefield SoilMATAPAHRLSDRLSVFAFAAGVLVVIVGGAFAAGYLIGRILL*
Ga0167658_104212223300015195Glacier Forefield SoilVGEKASVFALAAFVLLAIVGGAFAAGYVIGRMLL*
Ga0182006_102803123300015261RhizosphereVARATPHSLGDRVSVFALAFFVLAVIVGGAFAAGYLIGRILL*
Ga0182007_1014292933300015262RhizosphereTPAVVHSRGDKLSVFALAFFVLVVIVGGAFAAGYLIGRILL*
Ga0182007_1025593513300015262RhizosphereVTPATVHSRGDKLSVFALAFFVLVAIVGGAFAAGYLIGRILL*
Ga0137403_1007583233300015264Vadose Zone SoilVAQARTHTASEKISVFALASFVLLTIVGGAFAAGYLIGRMFL*
Ga0137403_1145211823300015264Vadose Zone SoilMAPPHRVSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL*
Ga0134089_1045968223300015358Grasslands SoilPSSVAVAPTHSFSEKLGVFAFAAVVIAVIVGGAFAAGYLIGRILL*
Ga0132258_1024654283300015371Arabidopsis RhizosphereVEAAPTHRAEKLGIFALAACLLVLIVGGAFTAGYLIGRILL*
Ga0132258_1082349023300015371Arabidopsis RhizosphereVAAAGTHSGSEKLTVFAFAAFLLVVIVGGAFAAGYLIGRILL*
Ga0134069_116696713300017654Grasslands SoilVAAATTHSVSEKLSVFALAIFVLVLIVGGAFAAGYLI
Ga0187824_1022332523300017927Freshwater SedimentMHAARTHTVGERVGIFAFAALVLTLIVGGAFAAGYLIGRIFL
Ga0187849_1000912103300017929PeatlandMPRVTTHGVVEKLSIFAVAGLVLVVIVGGAFAAGYLIGRVLL
Ga0187821_1013631513300017936Freshwater SedimentVNAATHRGSEKLGVFAFAIGVLIVIVGGAFAAGYLIGRILL
Ga0187778_1036548723300017961Tropical PeatlandVPRVKTHSVVEKLSIFAVAGLVLVVIVGGAFAAGYLIGRILL
Ga0187822_1000381573300017994Freshwater SedimentMHAARTHTVGERVGIFALAALVLTLIVGGAFAAGYLIGRIFL
Ga0187878_1003446153300018005PeatlandMPRVTTHSVVEKLSIFAVAGLVLVVIVGGAFAAGYLIGRVLL
Ga0066662_1106786623300018468Grasslands SoilVAQARTHTASEKLSVFALAIFVLLTIVGGAFAAGYLIGRMFL
Ga0066669_1181283323300018482Grasslands SoilPSSVPVTRPHSVGERLSVFALAVFFLVSLVGVAFAAGYLIGRMLL
Ga0193729_101896143300019887SoilMAPTHKVSEKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL
Ga0193751_112512723300019888SoilMATAPAHKLSDKLSVFAFALGVLAVIVGGAFAAGYLIGRILL
Ga0193751_118616123300019888SoilMAPTHRVSDKLSVFAFAAVVLLVIVGGAFAAGYLIGRILL
Ga0206349_107425523300020075Corn, Switchgrass And Miscanthus RhizosphereSVTPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL
Ga0206354_1125509023300020081Corn, Switchgrass And Miscanthus RhizosphereVAAAPTHTHKVNEKLGVFAFAIAVLVVIVGGAFAAGYLIG
Ga0206354_1149331623300020081Corn, Switchgrass And Miscanthus RhizosphereMPTHTVSEKLGVFAFAALVLAVIVGGAFAAGYLIGRILL
Ga0193699_1001675443300021363SoilVASARPHTLGEKISVFALAAFVLLVIVGGAFAAGYLIGRMLL
Ga0213877_1000359743300021372Bulk SoilMNAVTHSPREKLSIFLFAAAVLVVVVGGAFAAGYLIGRILL
Ga0210402_1158003023300021478SoilMATAPTHKLSDKLSVFAFAAGVLLVIVGGAFAAGYLIGRILL
Ga0247794_1035111023300024055SoilVAAQTHSAGEKLTVFAFAAVLLVVIVGGAFAAGYFIGRILL
Ga0137417_150993623300024330Vadose Zone SoilMATAPTHRLSDKLSVFAFAFGVLVVIVGGAFAAGYLIGRILL
Ga0208715_109372413300025482Arctic Peat SoilIFSATSVAPTRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL
Ga0208587_110793113300025484Arctic Peat SoilVAPTRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL
Ga0208586_108317023300025588Arctic Peat SoilVPRPTAHSVTDKLGIFAVAALVLVVIVGGAFAAGYLIGKVLL
Ga0207705_1007715223300025909Corn RhizosphereVTPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIGRILL
Ga0207707_1007220523300025912Corn RhizosphereVAPARPHTFGEKVSVFALAAFVLIAIVGGAFAAGYVIGRMFL
Ga0207707_1017024943300025912Corn RhizosphereVAHTHSVSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL
Ga0207707_1088056723300025912Corn RhizosphereVTPATVHSLGDRVSVFALAFFVLVVIVGGAFAAGYLIG
Ga0207693_1089194113300025915Corn, Switchgrass And Miscanthus RhizosphereVATATTNSVSEKLSVFTLAAVVLAVIVGGAFAAGYLIGR
Ga0207646_1065820823300025922Corn, Switchgrass And Miscanthus RhizosphereVAQARTHTASEKLSVFALAIFVLVAIVGGAFAAGYLIGRMFL
Ga0207700_1047713423300025928Corn, Switchgrass And Miscanthus RhizosphereMAMAPPHRVSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL
Ga0207700_1115096623300025928Corn, Switchgrass And Miscanthus RhizosphereLPSSVATATTNSVSEKLSVFTLAAVVLAVIVGGAFAAGYLIGRILL
Ga0207664_1001455233300025929Agricultural SoilMATAPTHKLSDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL
Ga0207664_1190247213300025929Agricultural SoilMAAATTHRVSEKLSVFAFAAAVLVIIVGGAFAAGYFIGRILL
Ga0207665_1046447833300025939Corn, Switchgrass And Miscanthus RhizospherePTHSVSEKLSVFAFAAVVLAVIVGGAFAAGYLIGRILL
Ga0208415_101978923300025993Rice Paddy SoilVPTHSVSEKLGVFAFAALVLAVIVGGAFAAGYLIGRILL
Ga0209468_106290623300026306SoilVTRPHSVGERLSVFALAVFFLVSLVGVAFAAGYLIGRMLL
Ga0209804_120661333300026335SoilTSVSEKLSVFAFAAFVLAVIVGGAFAAGYLIGRILL
Ga0207484_10565523300027466SoilHRVSEKLGVFAFAIAILVVIVGGAFAAGYLIGRILL
Ga0208989_1006398023300027738Forest SoilMATAPTHRLGDKLSVFAFAAGVLVVIVGGAFAAGYLIGRILL
Ga0209810_1000124293300027773Surface SoilVAAATHRGSEKLGVFAFAIGLLVVIVGGAFAAGYLIGRILL
Ga0209726_10007178123300027815GroundwaterVAPARPHTLGEKASVFALATFVLLAIVGGAFAAGYLIGRMLL
Ga0209060_1005862723300027826Surface SoilVHAAIHSPREKLSIFLFAAVVLVVVVGGAFAAGYLIGRIFL
Ga0209180_1056645523300027846Vadose Zone SoilVAQARTHTASEKLSVFALAIFVLLAIVGGAFAAGYLIGRMFL
Ga0209579_1030994823300027869Surface SoilMQAARSHTVGERVGIFAFAAFVLTVIVGGAFAAGYLIGRIFL
Ga0209488_1066402323300027903Vadose Zone SoilMATAPVHRLSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL
Ga0209168_1022029123300027986Surface SoilVAARTHTAGEKVSVFALAIFVLLAIVGGAFAAGYLIGRMLL
Ga0137415_1108394223300028536Vadose Zone SoilMAPPHRVSDKLSVFAFALGVLVVIVGGAFAAGYLIGRILL
Ga0265319_1001966123300028563RhizosphereVAPLRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL
Ga0299907_1015024513300030006SoilMMSKLVEQLSVFAFATVVVALIVGVAFAAGYLIGKMLL
Ga0299913_1114902023300031229SoilMSKLVEQLSVFAFATVVVALIVGVAFAAGYLIGKMLL
Ga0265320_1002409463300031240RhizospherePTRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLIGRMLL
Ga0307374_1010146643300031670SoilVASARTHTATDKLSVFALAIFVLLAIVGGAFAAGYVIGRMFL
Ga0265342_1050946723300031712RhizosphereVAPTRPHTFGEKVSVFALAAFVLVAIVGGAFAAGYLI
Ga0310813_1170031013300031716SoilTHSVSEKLGVFAFAAVVLAVIVGGAFAAGYLIGRILL
Ga0308175_10011122443300031938SoilVNPATVHSLGDRISVFALAFFLLVVIVGGAFAAGYLIGRILL
Ga0308176_1274435113300031996SoilVTPATVHSLGDKLSVFALAFFVLVVIVGGAFAAGYLIGRILL
Ga0335085_1176699313300032770SoilMRTATTSNVRERISVFAVAIFVLVLVVGGAFAAGYLIGRILL
Ga0335082_1016899343300032782SoilMAQFGDKLSVFAFAAFFLAVFVGLAFAVGYLIGKLLL
Ga0335081_1096135023300032892SoilVRATTHNVGEKLGVFAVAALVLVVVVGGAFAAGYLIGRVLL
Ga0335069_1057641623300032893SoilMATTSNVREKISVFAVAIFVLVVVVGGAFAAGYLIGRILL
Ga0334722_1004093853300033233SedimentMRATTHSVSERLGVFAFAAVVLVVIVGGAFAAGYLIGRILL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.