Metagenome / Metatranscriptome Family F019322

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F019322
Family Type	Metagenome / Metatranscriptome
Number of Sequences	230
Average Sequence Length	39 residues
Representative Sequence	VIIRYADSFAAATSTTGSPTITVAGGYRVYQWTSSGSITF
Number of Associated Samples	156
Number of Associated Scaffolds	230

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	9.72 %
% of genes near scaffold ends (potentially truncated)	83.48 %
% of genes from short scaffolds (< 2000 bps)	76.96 %
Associated GOLD sequencing projects	143
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.72

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (46.087 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (22.174 % of family members)
Environment Ontology (ENVO)	Unclassified (70.870 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (63.043 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 27.94% Coil/Unstructured: 72.06%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.72
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.72
Powered by PDBe Molstar

SCOP family	SCOP domain	Representative PDB	TM-score
b.30.5.11: Galactose mutarotase-like	d2g3ma1	2g3m	0.65
b.30.5.11: Galactose mutarotase-like	d2g3ma1	2g3m	0.65
d.144.1.6: Protein kinase-like (PK-like)	d3tm0a_	3tm0	0.64
d.144.1.0: Protein kinase-like (PK-like)	d6vxua_	6vxu	0.64
d.144.1.6: Protein kinase-like (PK-like)	d3tm0a_	3tm0	0.64
d.144.1.0: Protein kinase-like (PK-like)	d6vxua_	6vxu	0.64
d.95.2.1: Homing endonucleases	d3eh8a1	3eh8	0.63
d.95.2.1: Homing endonucleases	d3eh8a1	3eh8	0.63
d.68.2.0: EPT/RTPC-like	d5u4ha1	5u4h	0.62
d.68.2.0: EPT/RTPC-like	d5u4ha1	5u4h	0.62

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 230 Family Scaffolds
PF00041	fn3	3.48
PF01833	TIG	1.74
PF00768	Peptidase_S11	1.74
PF13385	Laminin_G_3	1.30
PF01391	Collagen	1.30
PF00415	RCC1	1.30
PF01171	ATP_bind_3	0.87
PF00004	AAA	0.43
PF11651	P22_CoatProtein	0.43
PF13884	Peptidase_S74	0.43
PF07719	TPR_2	0.43
PF00454	PI3_PI4_kinase	0.43
PF12236	Head-tail_con	0.43
PF13649	Methyltransf_25	0.43
PF13539	Peptidase_M15_4	0.43
PF04550	Phage_holin_3_2	0.43
PF12708	Pectate_lyase_3	0.43
PF01370	Epimerase	0.43
PF12224	Amidoligase_2	0.43
PF13692	Glyco_trans_1_4	0.43
PF06048	DUF927	0.43
PF11351	GTA_holin_3TM	0.43
PF09374	PG_binding_3	0.43
PF03819	MazG	0.43
PF13759	2OG-FeII_Oxy_5	0.43
PF00383	dCMP_cyt_deam_1	0.43
PF05226	CHASE2	0.43
PF13489	Methyltransf_23	0.43
PF13481	AAA_25	0.43

COG ID	Name	Functional Category	% Frequency in 230 Family Scaffolds
COG5184	Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins	Cell cycle control, cell division, chromosome partitioning [D]	2.61
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	1.74
COG0037	tRNA(Ile)-lysidine synthase TilS/MesJ	Translation, ribosomal structure and biogenesis [J]	0.87
COG0301	Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.87
COG0482	tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain	Translation, ribosomal structure and biogenesis [J]	0.87
COG0519	GMP synthase, PP-ATPase domain/subunit	Nucleotide transport and metabolism [F]	0.87
COG0603	7-cyano-7-deazaguanine synthase (queuosine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.87
COG1606	ATP-utilizing enzyme, PP-loop superfamily	General function prediction only [R]	0.87
COG4252	Extracytoplasmic sensor domain CHASE2 (specificity unknown)	Signal transduction mechanisms [T]	0.43
COG5519	Predicted ATPase domain of Cch-like helicases, DUF927 family	General function prediction only [R]	0.43

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	53.91 %
Unclassified	root	N/A	46.09 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	47.39 %
Unclassified	root	N/A	46.09 %
cellular organisms	root	All Organisms → cellular organisms	6.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.09 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	40.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	7.39 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	6.09 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.43 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.09 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	40.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	7.39 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.04 %
DPANN group	clade	All Organisms → cellular organisms → Archaea → DPANN group	0.43 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.43 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.43 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.09 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	40.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	7.39 %
Candidatus Pacearchaeota	clade	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota	0.43 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.43 %
unclassified Spirochaetota	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota	0.43 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.43 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.43 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.43 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.09 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	40.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	7.39 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.43 %
Candidatus Pacearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon	0.43 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.43 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.43 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.43 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.43 %
Dehalococcoidia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia	0.43 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.09 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	38.26 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	7.39 %
unclassified Dehalococcoidia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia	0.43 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.43 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.43 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.43 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.43 %
Candidatus Pacearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon	0.43 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.43 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.43 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.09 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.26 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	7.39 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.43 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.43 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.43 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	0.43 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.43 %
Candidatus Pacearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon	0.43 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.43 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.43 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.09 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.26 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	7.39 %
Microvirga alba	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga alba	0.43 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.43 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.43 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.43 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.43 %
Candidatus Pacearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon	0.43 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.43 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.43 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001282\|B570J14230_10067942	All Organisms → Viruses → Predicted Viral	1133	Open in IMG/M
3300001842\|RCM30_1099968	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	865	Open in IMG/M
3300001843\|RCM34_1049539	All Organisms → cellular organisms → Bacteria → Proteobacteria	1226	Open in IMG/M
3300002363\|B570J29624_104807	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	835	Open in IMG/M
3300002835\|B570J40625_100974377	Not Available	727	Open in IMG/M
3300003394\|JGI25907J50239_1045416	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	904	Open in IMG/M
3300004763\|Ga0007746_1369574	Not Available	769	Open in IMG/M
3300005528\|Ga0068872_10159911	Not Available	1307	Open in IMG/M
3300005528\|Ga0068872_10630371	Not Available	567	Open in IMG/M
3300005581\|Ga0049081_10010369	All Organisms → Viruses → Predicted Viral	3529	Open in IMG/M
3300005581\|Ga0049081_10235282	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	647	Open in IMG/M
3300005581\|Ga0049081_10273961	Not Available	587	Open in IMG/M
3300005581\|Ga0049081_10349628	Not Available	501	Open in IMG/M
3300005583\|Ga0049085_10043806	All Organisms → Viruses → Predicted Viral	1627	Open in IMG/M
3300005758\|Ga0078117_1110419	Not Available	2242	Open in IMG/M
3300006484\|Ga0070744_10014004	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2378	Open in IMG/M
3300006484\|Ga0070744_10017153	Not Available	2149	Open in IMG/M
3300006484\|Ga0070744_10135148	Not Available	709	Open in IMG/M
3300006802\|Ga0070749_10225252	Not Available	1068	Open in IMG/M
3300006805\|Ga0075464_10432592	Not Available	802	Open in IMG/M
3300007538\|Ga0099851_1226889	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300007541\|Ga0099848_1036714	Not Available	2021	Open in IMG/M
3300007559\|Ga0102828_1087756	Not Available	750	Open in IMG/M
3300007559\|Ga0102828_1176663	Not Available	542	Open in IMG/M
3300007559\|Ga0102828_1184395	Not Available	531	Open in IMG/M
3300007973\|Ga0105746_1095536	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	972	Open in IMG/M
3300008266\|Ga0114363_1210504	Not Available	587	Open in IMG/M
3300008448\|Ga0114876_1209764	Not Available	648	Open in IMG/M
3300008448\|Ga0114876_1238421	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	576	Open in IMG/M
3300008450\|Ga0114880_1084714	All Organisms → Viruses → Predicted Viral	1257	Open in IMG/M
3300008450\|Ga0114880_1132862	Not Available	919	Open in IMG/M
3300009026\|Ga0102829_1037763	Not Available	1426	Open in IMG/M
3300009151\|Ga0114962_10478778	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	661	Open in IMG/M
3300009152\|Ga0114980_10202504	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1167	Open in IMG/M
3300009152\|Ga0114980_10486995	Not Available	703	Open in IMG/M
3300009158\|Ga0114977_10245616	Not Available	1035	Open in IMG/M
3300009158\|Ga0114977_10492105	Not Available	672	Open in IMG/M
3300009159\|Ga0114978_10384803	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	843	Open in IMG/M
3300009159\|Ga0114978_10410624	Not Available	809	Open in IMG/M
3300009160\|Ga0114981_10202644	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1088	Open in IMG/M
3300009161\|Ga0114966_10097648	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1980	Open in IMG/M
3300009161\|Ga0114966_10132303	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1641	Open in IMG/M
3300009161\|Ga0114966_10238307	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1130	Open in IMG/M
3300009163\|Ga0114970_10338063	Not Available	849	Open in IMG/M
3300009164\|Ga0114975_10096290	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1714	Open in IMG/M
3300009164\|Ga0114975_10100570	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1672	Open in IMG/M
3300009164\|Ga0114975_10197294	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1138	Open in IMG/M
3300009180\|Ga0114979_10093266	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1864	Open in IMG/M
3300009180\|Ga0114979_10172660	Not Available	1318	Open in IMG/M
3300009180\|Ga0114979_10241768	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1083	Open in IMG/M
3300009180\|Ga0114979_10323448	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	913	Open in IMG/M
3300009180\|Ga0114979_10764864	Not Available	543	Open in IMG/M
3300009181\|Ga0114969_10161248	All Organisms → Viruses → Predicted Viral	1401	Open in IMG/M
3300009184\|Ga0114976_10452787	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	666	Open in IMG/M
3300009185\|Ga0114971_10025780	Not Available	3783	Open in IMG/M
3300009185\|Ga0114971_10790526	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514	Open in IMG/M
3300010157\|Ga0114964_10183233	Not Available	1010	Open in IMG/M
3300010160\|Ga0114967_10064931	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2231	Open in IMG/M
3300010160\|Ga0114967_10157735	Not Available	1254	Open in IMG/M
3300010318\|Ga0136656_1154028	Not Available	785	Open in IMG/M
3300010334\|Ga0136644_10611657	Not Available	598	Open in IMG/M
3300010354\|Ga0129333_10106705	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2586	Open in IMG/M
3300010354\|Ga0129333_10129694	All Organisms → Viruses → Predicted Viral	2319	Open in IMG/M
3300010370\|Ga0129336_10266113	Not Available	960	Open in IMG/M
3300010885\|Ga0133913_10775184	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2502	Open in IMG/M
3300010885\|Ga0133913_10822458	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2419	Open in IMG/M
3300010885\|Ga0133913_10866722	Not Available	2348	Open in IMG/M
3300010885\|Ga0133913_11810164	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1528	Open in IMG/M
3300010885\|Ga0133913_12303373	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1322	Open in IMG/M
3300010885\|Ga0133913_12449014	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1274	Open in IMG/M
3300012012\|Ga0153799_1069583	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	636	Open in IMG/M
3300012013\|Ga0153805_1025295	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1010	Open in IMG/M
3300012013\|Ga0153805_1088350	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	526	Open in IMG/M
3300012663\|Ga0157203_1017452	All Organisms → cellular organisms → Bacteria	1079	Open in IMG/M
3300012665\|Ga0157210_1020496	Not Available	1072	Open in IMG/M
3300012920\|Ga0160423_10524309	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	805	Open in IMG/M
3300013004\|Ga0164293_11064357	Not Available	501	Open in IMG/M
3300013005\|Ga0164292_10655124	Not Available	674	Open in IMG/M
3300013006\|Ga0164294_10333583	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1047	Open in IMG/M
3300013372\|Ga0177922_10521961	Not Available	725	Open in IMG/M
3300013372\|Ga0177922_10771407	Not Available	510	Open in IMG/M
3300015050\|Ga0181338_1004757	All Organisms → Viruses → Predicted Viral	2314	Open in IMG/M
3300017700\|Ga0181339_1012295	Not Available	992	Open in IMG/M
3300017700\|Ga0181339_1013903	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	926	Open in IMG/M
3300017700\|Ga0181339_1032013	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	576	Open in IMG/M
3300017701\|Ga0181364_1016947	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1210	Open in IMG/M
3300017716\|Ga0181350_1003034	All Organisms → cellular organisms → Bacteria → Proteobacteria	4875	Open in IMG/M
3300017716\|Ga0181350_1141195	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	567	Open in IMG/M
3300017716\|Ga0181350_1150679	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	543	Open in IMG/M
3300017747\|Ga0181352_1106485	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	766	Open in IMG/M
3300017761\|Ga0181356_1117911	Not Available	850	Open in IMG/M
3300017766\|Ga0181343_1046205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1288	Open in IMG/M
3300017766\|Ga0181343_1111547	Not Available	772	Open in IMG/M
3300017774\|Ga0181358_1235517	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	582	Open in IMG/M
3300017777\|Ga0181357_1000677	Not Available	13040	Open in IMG/M
3300017777\|Ga0181357_1014654	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3123	Open in IMG/M
3300017780\|Ga0181346_1283688	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	567	Open in IMG/M
3300017784\|Ga0181348_1086838	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1235	Open in IMG/M
3300017785\|Ga0181355_1031365	All Organisms → Viruses → Predicted Viral	2293	Open in IMG/M
3300017785\|Ga0181355_1247326	Not Available	685	Open in IMG/M
3300017785\|Ga0181355_1319885	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	577	Open in IMG/M
3300017785\|Ga0181355_1361048	Not Available	532	Open in IMG/M
3300017785\|Ga0181355_1367927	Not Available	525	Open in IMG/M
3300018036\|Ga0181600_10209899	Not Available	1032	Open in IMG/M
3300018424\|Ga0181591_11053849	Not Available	550	Open in IMG/M
3300020141\|Ga0211732_1509202	All Organisms → Viruses → Predicted Viral	1378	Open in IMG/M
3300020151\|Ga0211736_10523735	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	764	Open in IMG/M
3300020151\|Ga0211736_10610375	Not Available	525	Open in IMG/M
3300020159\|Ga0211734_11286458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga alba	751	Open in IMG/M
3300020161\|Ga0211726_10360064	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1089	Open in IMG/M
3300020162\|Ga0211735_10066365	Not Available	932	Open in IMG/M
3300020196\|Ga0194124_10124250	Not Available	1426	Open in IMG/M
3300020205\|Ga0211731_10154055	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon	783	Open in IMG/M
3300020533\|Ga0208364_1056875	Not Available	504	Open in IMG/M
3300021519\|Ga0194048_10146090	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	890	Open in IMG/M
3300021962\|Ga0222713_10691110	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	583	Open in IMG/M
3300022179\|Ga0181353_1098402	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	721	Open in IMG/M
3300022198\|Ga0196905_1133234	Not Available	646	Open in IMG/M
3300022407\|Ga0181351_1086521	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1238	Open in IMG/M
3300022752\|Ga0214917_10424751	Not Available	539	Open in IMG/M
3300022927\|Ga0255769_10270574	Not Available	705	Open in IMG/M
3300023179\|Ga0214923_10137547	Not Available	1556	Open in IMG/M
3300023184\|Ga0214919_10231096	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1348	Open in IMG/M
3300024346\|Ga0244775_10182953	Not Available	1762	Open in IMG/M
3300024346\|Ga0244775_11534825	Not Available	508	Open in IMG/M
3300024348\|Ga0244776_10364533	Not Available	968	Open in IMG/M
3300024495\|Ga0255164_1032423	Not Available	856	Open in IMG/M
3300025416\|Ga0208877_1046297	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	707	Open in IMG/M
3300025595\|Ga0208248_1013969	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1947	Open in IMG/M
3300025616\|Ga0208613_1134857	Not Available	554	Open in IMG/M
3300025687\|Ga0208019_1186212	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	554	Open in IMG/M
3300025715\|Ga0209310_1048513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1452	Open in IMG/M
3300027621\|Ga0208951_1093001	Not Available	829	Open in IMG/M
3300027631\|Ga0208133_1007206	All Organisms → cellular organisms → Bacteria → Proteobacteria	3175	Open in IMG/M
3300027631\|Ga0208133_1011870	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2365	Open in IMG/M
3300027631\|Ga0208133_1075965	Not Available	794	Open in IMG/M
3300027649\|Ga0208960_1116266	Not Available	703	Open in IMG/M
3300027659\|Ga0208975_1000533	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	18103	Open in IMG/M
3300027679\|Ga0209769_1017393	All Organisms → Viruses → Predicted Viral	2554	Open in IMG/M
3300027697\|Ga0209033_1059294	All Organisms → Viruses → Predicted Viral	1348	Open in IMG/M
3300027712\|Ga0209499_1170375	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	785	Open in IMG/M
3300027712\|Ga0209499_1319261	Not Available	521	Open in IMG/M
3300027732\|Ga0209442_1053519	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1732	Open in IMG/M
3300027746\|Ga0209597_1385586	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	514	Open in IMG/M
3300027747\|Ga0209189_1411611	Not Available	500	Open in IMG/M
3300027759\|Ga0209296_1151201	All Organisms → Viruses → Predicted Viral	1044	Open in IMG/M
3300027759\|Ga0209296_1397099	Not Available	517	Open in IMG/M
3300027763\|Ga0209088_10177732	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	923	Open in IMG/M
3300027763\|Ga0209088_10332257	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	606	Open in IMG/M
3300027770\|Ga0209086_10054355	Not Available	2229	Open in IMG/M
3300027772\|Ga0209768_10085530	Not Available	1578	Open in IMG/M
3300027782\|Ga0209500_10197235	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	911	Open in IMG/M
3300027785\|Ga0209246_10305308	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	610	Open in IMG/M
3300027793\|Ga0209972_10246640	Not Available	807	Open in IMG/M
3300027797\|Ga0209107_10238299	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	880	Open in IMG/M
3300027798\|Ga0209353_10362218	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	603	Open in IMG/M
3300027805\|Ga0209229_10013392	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3488	Open in IMG/M
3300027808\|Ga0209354_10220653	Not Available	766	Open in IMG/M
3300027808\|Ga0209354_10267029	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	685	Open in IMG/M
3300027808\|Ga0209354_10444187	Not Available	500	Open in IMG/M
3300027896\|Ga0209777_10491519	Not Available	906	Open in IMG/M
3300027899\|Ga0209668_10496596	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	809	Open in IMG/M
3300027899\|Ga0209668_11021186	Not Available	557	Open in IMG/M
3300027963\|Ga0209400_1028113	Not Available	3170	Open in IMG/M
3300027963\|Ga0209400_1160507	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	969	Open in IMG/M
3300028025\|Ga0247723_1166198	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	507	Open in IMG/M
3300028394\|Ga0304730_1160302	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	893	Open in IMG/M
3300028394\|Ga0304730_1226290	Not Available	689	Open in IMG/M
3300028394\|Ga0304730_1330780	Not Available	513	Open in IMG/M
3300031857\|Ga0315909_10541119	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	793	Open in IMG/M
3300031999\|Ga0315274_11944959	Not Available	531	Open in IMG/M
3300032050\|Ga0315906_10497507	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1032	Open in IMG/M
3300032116\|Ga0315903_10737499	Not Available	730	Open in IMG/M
3300032118\|Ga0315277_11677779	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	534	Open in IMG/M
3300032164\|Ga0315283_12290167	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	529	Open in IMG/M
3300033981\|Ga0334982_0000093	Not Available	48844	Open in IMG/M
3300033981\|Ga0334982_0000880	Not Available	18883	Open in IMG/M
3300033981\|Ga0334982_0013593	All Organisms → Viruses → Predicted Viral	4800	Open in IMG/M
3300033992\|Ga0334992_0000029	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	144450	Open in IMG/M
3300033992\|Ga0334992_0333570	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	700	Open in IMG/M
3300033993\|Ga0334994_0031472	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3434	Open in IMG/M
3300033994\|Ga0334996_0265361	Not Available	874	Open in IMG/M
3300033996\|Ga0334979_0002114	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14507	Open in IMG/M
3300034012\|Ga0334986_0000667	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30168	Open in IMG/M
3300034013\|Ga0334991_0139074	All Organisms → Viruses → Predicted Viral	1119	Open in IMG/M
3300034019\|Ga0334998_0182792	All Organisms → Viruses → Predicted Viral	1316	Open in IMG/M
3300034022\|Ga0335005_0022229	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	4436	Open in IMG/M
3300034022\|Ga0335005_0203811	All Organisms → cellular organisms → Bacteria → Proteobacteria	1225	Open in IMG/M
3300034023\|Ga0335021_0408995	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	706	Open in IMG/M
3300034062\|Ga0334995_0003523	Not Available	16002	Open in IMG/M
3300034062\|Ga0334995_0025474	All Organisms → cellular organisms → Bacteria	5182	Open in IMG/M
3300034062\|Ga0334995_0030478	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4642	Open in IMG/M
3300034062\|Ga0334995_0186066	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	1460	Open in IMG/M
3300034062\|Ga0334995_0632618	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	615	Open in IMG/M
3300034073\|Ga0310130_0006583	All Organisms → Viruses → Predicted Viral	4400	Open in IMG/M
3300034082\|Ga0335020_0067796	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1848	Open in IMG/M
3300034082\|Ga0335020_0103096	Not Available	1454	Open in IMG/M
3300034092\|Ga0335010_0442904	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	698	Open in IMG/M
3300034093\|Ga0335012_0403258	Not Available	668	Open in IMG/M
3300034106\|Ga0335036_0005173	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	11057	Open in IMG/M
3300034106\|Ga0335036_0012902	Not Available	6830	Open in IMG/M
3300034106\|Ga0335036_0148360	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1672	Open in IMG/M
3300034106\|Ga0335036_0306159	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1054	Open in IMG/M
3300034106\|Ga0335036_0465291	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	796	Open in IMG/M
3300034106\|Ga0335036_0581960	Not Available	683	Open in IMG/M
3300034108\|Ga0335050_0078444	All Organisms → Viruses → Predicted Viral	1970	Open in IMG/M
3300034108\|Ga0335050_0078807	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1964	Open in IMG/M
3300034108\|Ga0335050_0414168	Not Available	601	Open in IMG/M
3300034111\|Ga0335063_0368923	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	736	Open in IMG/M
3300034117\|Ga0335033_0605652	Not Available	509	Open in IMG/M
3300034118\|Ga0335053_0533983	Not Available	686	Open in IMG/M
3300034121\|Ga0335058_0206805	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1146	Open in IMG/M
3300034122\|Ga0335060_0026858	Not Available	3767	Open in IMG/M
3300034200\|Ga0335065_0455447	Not Available	774	Open in IMG/M
3300034284\|Ga0335013_0682281	Not Available	589	Open in IMG/M
3300034355\|Ga0335039_0455353	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	648	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.57%
Engineered	Engineered	0.43%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.70%
Terrestrial	Environmental → Terrestrial	0.87%
Wastewater	Engineered → Wastewater	0.43%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	85.65%
Marine	Environmental → Aquatic → Marine	13.04%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.87%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.43%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	53.91%
Lentic	Environmental → Aquatic → Freshwater → Lentic	26.09%
Coastal	Environmental → Aquatic → Marine → Coastal	4.78%
Unclassified	Environmental → Aquatic → Marine → Unclassified	4.35%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.48%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.74%
River	Environmental → Aquatic → Freshwater → River	1.74%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.30%
Ice	Environmental → Aquatic → Freshwater → Ice	0.87%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.87%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.43%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.43%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	52.61%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	22.61%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	4.78%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	4.35%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.17%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.74%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.74%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.74%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.30%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.30%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.30%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	1.30%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.87%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.87%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.43%
Photic Zone	Environmental → Aquatic → Marine → Oceanic → Photic Zone	0.43%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.43%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	22.17%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	21.74%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	16.96%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	4.35%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.48%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	3.91%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	2.61%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.17%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	2.17%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.74%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.74%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.74%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	1.74%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.30%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.30%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.30%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.30%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	1.30%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.87%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.87%
Surface Ice	Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice	0.87%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.43%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.43%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.43%
Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water	0.43%
Surface Seawater	Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater	0.43%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.43%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.43%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.43%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.43%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.43%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001842	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b	Environmental	Open in IMG/M
3300001843	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b	Environmental	Open in IMG/M
3300002363	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003394	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN	Environmental	Open in IMG/M
3300004763	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005758	Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental	Open in IMG/M
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009026	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009185	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010318	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012013	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300012920	Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017700	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300018036	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)	Environmental	Open in IMG/M
3300018424	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020196	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020533	Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022198	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300022927	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300024495	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d	Environmental	Open in IMG/M
3300024507	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d	Environmental	Open in IMG/M
3300025416	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes)	Environmental	Open in IMG/M
3300025595	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes)	Environmental	Open in IMG/M
3300025616	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes)	Environmental	Open in IMG/M
3300025687	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)	Environmental	Open in IMG/M
3300025715	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes)	Engineered	Open in IMG/M
3300027135	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h	Environmental	Open in IMG/M
3300027621	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)	Environmental	Open in IMG/M
3300027631	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)	Environmental	Open in IMG/M
3300027649	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027679	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)	Environmental	Open in IMG/M
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental	Open in IMG/M
3300027712	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027746	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027747	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027974	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028286	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034013	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034	Environmental	Open in IMG/M
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034023	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034108	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157	Environmental	Open in IMG/M
3300034111	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186	Environmental	Open in IMG/M
3300034117	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034120	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172	Environmental	Open in IMG/M
3300034121	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174	Environmental	Open in IMG/M
3300034122	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental	Open in IMG/M
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental	Open in IMG/M
3300034355	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J14230_100679421	3300001282	Freshwater	VIRYSDSFPLASSTTGSPTITTAGGFRTYKFTGSGSITF*
RCM30_10999681	3300001842	Marine Plankton	VVIRYADTSPAATSTTGSPTDTVTGGYRIYKWTSSGSITF*
RCM34_10495393	3300001843	Marine Plankton	RYADSFAAAASTTGSPTVTVAGGYRVYSFTASGSITF*
B570J29624_1048073	3300002363	Freshwater	VILRYPDTNAAATSITGSPTVTVAGGYRVYKWTSSGSITF*
B570J29032_1092741701	3300002408	Freshwater	IVIVRYSDSYAAAVSTTGSPSVSVSGGFRTYTFTGSGSITW*
B570J40625_1009743773	3300002835	Freshwater	IVRYSDSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF*
JGI25907J50239_10454163	3300003394	Freshwater Lake	GIVILRYPDTFIAATSTTGSPTITVAGGFRVYKWTSSGSITF*
Ga0007746_13695741	3300004763	Freshwater Lake	LLSYPSAYPAATSTTGSPSVLVSGGLRVYKFTSSGSITF*
Ga0068872_101599114	3300005528	Freshwater Lake	VIVRYSDSYAAAVSTTGSPTYTVSGGYRVYKFTGSGSITW*
Ga0068872_106303712	3300005528	Freshwater Lake	VILRYPDTFRAATSTTGSPTIAVAGGFRVYQFTANGSITF*
Ga0049081_100103693	3300005581	Freshwater Lentic	RYADSYAAATSTTGSPTITVSGGYRTYKFTASGSITF*
Ga0049081_102352821	3300005581	Freshwater Lentic	VIIRYADTYIAATSTTGSPTITVAGGYRVYKWTASGSITF*
Ga0049081_102739611	3300005581	Freshwater Lentic	RYPSNQPAVTSTTGSPTVTVAGGYRHYIFTSSGTLTW*
Ga0049081_103496282	3300005581	Freshwater Lentic	GIVIIRYADTYAAATTTTGSPTITVAGGYRVYKWTGSGTITF*
Ga0049085_100438061	3300005583	Freshwater Lentic	YPDTFIAATSTTGSPTITVAGGFRVYQYTANGSITF*
Ga0078117_11104191	3300005758	Lake Water	IVAIRYPSTYPAATSTTGTVNVYVSGGYRTYVWTSSGTITF*
Ga0070744_100140041	3300006484	Estuarine	VVIIRYPDSYPLATSAPGAGVSTTGGYRIYQWTSSGSITF*
Ga0070744_100171531	3300006484	Estuarine	EIRYSDSFGPAVSTTGSPTTSTNGGYRYYIFTSSGSIRF*
Ga0070744_101351482	3300006484	Estuarine	IRYPDSYSAASSTTGSPTITVAGGYRTYKFTTSGSITF*
Ga0070749_102252521	3300006802	Aqueous	NGGSGVVIIRYPDTYAIAYTTGSPSYTVSGGYRIYRYTSSGSIIF*
Ga0075464_104325924	3300006805	Aqueous	RYPDTFIAATSTTGSPTITVAGGFRVYKFTANGSITF*
Ga0099851_12268891	3300007538	Aqueous	DTFDAAAATTGSPTITVSGGYRIYTFTASGSITF*
Ga0099848_10367141	3300007541	Aqueous	YADTFAAAASTTGSPTVTVAGGYRVYKFTGSGSITW*
Ga0102828_10877561	3300007559	Estuarine	QGVVAIQYPDTYPLATSTTGSPTITNPTGYRVYTWTSSGSITF*
Ga0102828_11766631	3300007559	Estuarine	IIRYADSYAAAASTTGSPTVTVAGGYRVYSWTGSGTITF*
Ga0102828_11843953	3300007559	Estuarine	IKYADTYPAATSTTGSPTISVSDGFRTYTFTSSGSITF*
Ga0105746_10955363	3300007973	Estuary Water	IVIIRYADTFAAATATTGSPTITVAGGYRVYKWTTVGSGSITF*
Ga0114340_10301641	3300008107	Freshwater, Plankton	VIIRYSDAFAAAASTTGSPTVTVSGGFRTYTFNGSGSITW*
Ga0114346_11935851	3300008113	Freshwater, Plankton	YSDAFAAAASTTGSPTVTVSGGFRTYTFNGSGSITW*
Ga0114363_12105043	3300008266	Freshwater, Plankton	IRYPDTFIAAASTTGSPTITVAGGFRVYRFTASGSITF*
Ga0114876_12097641	3300008448	Freshwater Lake	SDTYAAATSTTGSPTITTAGGYRVYKYTSSGSITF*
Ga0114876_12384212	3300008448	Freshwater Lake	ADSFAAATATTGSPTITVAGGYRIYKWTSSGSITF*
Ga0114880_10847141	3300008450	Freshwater Lake	GSNGIAGIVAIKYADSFAPATATTGSPTITVANGFRVYEWTSSGSITF*
Ga0114880_11328623	3300008450	Freshwater Lake	RYADTFPAATSTTGSPATVTSGGYRYYTWTGSGSVTF*
Ga0102829_10377632	3300009026	Estuarine	GGSGVVIIRYPDTYPAATSTSGSPTVTVTGGYRIYRFTATGTITL*
Ga0114962_104787782	3300009151	Freshwater Lake	GGSGIVIIRYEDSYAAATTTGSPNVTVAGGYRVYKFTNSGSIIF*
Ga0114980_102025043	3300009152	Freshwater Lake	GGSGIVIIRYADSYAAATTTGSPNVTVAGGYRVYKFTNSGSIIF*
Ga0114980_104869952	3300009152	Freshwater Lake	VIIRYADVYTAASNTTGSPNVTVTGGYRVYQFNSSGSITF*
Ga0114977_102456162	3300009158	Freshwater Lake	VIFRYADTYPAAVSTTGSPTITVAGGYRVYKYTSSGSITF*
Ga0114977_104921051	3300009158	Freshwater Lake	DTYAAATTTTGSPTITTAGGYIIYKWTSSGSITF*
Ga0114978_103848031	3300009159	Freshwater Lake	SGIVIIRYADTYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF*
Ga0114978_104106243	3300009159	Freshwater Lake	VVVIRYADTFAAAITTGSPTVTVSGGYRTYRFTGSGSIEF*
Ga0114981_102026444	3300009160	Freshwater Lake	VVIRYVDSFDAATATTGSPTITVAGGYRVYKFTGSGSITF*
Ga0114966_100976483	3300009161	Freshwater Lake	ILRYPDTFRAATSTTGSPTITVAGGFRVYQFTASGSITF*
Ga0114966_101323031	3300009161	Freshwater Lake	IRYADTSAAATATTGSPTITVAGGYRVYQWTSSGSITF*
Ga0114966_102383071	3300009161	Freshwater Lake	TNQGGSGVVIIRYADSFAVASATGSPTITVAGGYRYYKFTTSGTITF*
Ga0114970_103380634	3300009163	Freshwater Lake	VIIRYVNTYDAATGTTGSPTITNTGGYRYYTFNDTGTITF*
Ga0114975_100962902	3300009164	Freshwater Lake	IVIIRYSDAYVAATSTTGSPTITTAGGYRVYQWTSSGSITF*
Ga0114975_101005701	3300009164	Freshwater Lake	IVIIRYPDSYLAATSTTGSPTITVTGGYRIYTWTGSGSITI*
Ga0114975_101972941	3300009164	Freshwater Lake	YADSYAAATSTTGSPTITVTGGYRIYKWTSSGSITF*
Ga0114979_100932662	3300009180	Freshwater Lake	YADTYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF*
Ga0114979_101726603	3300009180	Freshwater Lake	SGIVIIRYADTYPAATSTTGSPTITTAGGYRVYQWTTSGSITF*
Ga0114979_102417681	3300009180	Freshwater Lake	GIVIIRYADSYTAASNTTGSPNVTVSGGYRVYQFTSSGSITF*
Ga0114979_103234481	3300009180	Freshwater Lake	VVVIRYADSTPAATVVTGSPTVTVSGGYRIYTWTSSGSITI*
Ga0114979_107648641	3300009180	Freshwater Lake	RYADTYAAATATTGSPTITVAGGYRTYKFTGDGSITF*
Ga0114969_101612484	3300009181	Freshwater Lake	GIVIIRYADTFPAATANTGSPTITVAGGYRVYKWTTVGNGSITF*
Ga0114969_103734284	3300009181	Freshwater Lake	GIVIIRYANTFTKTPTTTGSPSTVNTGGYIYYTWTGNGSIVF*
Ga0114976_104527871	3300009184	Freshwater Lake	IIRYADTYPAATSTTGSPTITTGGGYRVYQWTSSGSITF*
Ga0114971_100257807	3300009185	Freshwater Lake	GGSGIVIIRYADTYAAATSTTGSPDITVAGGYRVYKWTTVGTWSITF*
Ga0114971_107905261	3300009185	Freshwater Lake	DTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF*
Ga0114964_101832333	3300010157	Freshwater Lake	IRYSDSYAAASATTGSPTITITNGYRYYAFTSSGSITF*
Ga0114967_100649311	3300010160	Freshwater Lake	GGSGIVIIRYADTYPAATATTGSPTITVAGGYRVYSWASSGSLTL*
Ga0114967_101577353	3300010160	Freshwater Lake	VILRYPDTFRAATSTTGSPTITVAGGFRVYQFTASGSITF*
Ga0136656_11540283	3300010318	Freshwater To Marine Saline Gradient	SSKPEATSTTGSPTVSVANGYRVYKWTGSGSITF*
Ga0136644_106116571	3300010334	Freshwater Lake	YADSYAAATSTTGSPTITVAGGYRVYKFTDNGTITF*
Ga0129333_101067051	3300010354	Freshwater To Marine Saline Gradient	DTYDAAVSTTGSPTITVAGGYRVYKWTGSGSITF*
Ga0129333_101296941	3300010354	Freshwater To Marine Saline Gradient	DTFTAAASTTGSPTITVSGGYRIYKWTGSGSITF*
Ga0129336_102661131	3300010370	Freshwater To Marine Saline Gradient	IIRYADSYAAATSTTGSPTITVSGGYRIYQWTGNGSITF*
Ga0133913_107751843	3300010885	Freshwater Lake	VIIRYSNIYPEAASATGTYTITIKDGYRIYRWTSSGSITF*
Ga0133913_108224586	3300010885	Freshwater Lake	GIVIIRYPDTFALATSSTGSPTITTANGWRLYVWTASGTITI*
Ga0133913_108667221	3300010885	Freshwater Lake	DSYAAATSTTGSPTITVAGGYRVYKFTDNGTITF*
Ga0133913_118101641	3300010885	Freshwater Lake	GIVIIRYPDTYDAASATTGSPTVTVTGGYRIYKWTSSGSITF*
Ga0133913_123033733	3300010885	Freshwater Lake	IIRYADTFTAATSTTGSPTTIVTGGYRYYKFTSSGSITF*
Ga0133913_124490143	3300010885	Freshwater Lake	IVIIRYADTYDAATSTTGSPSIVVSGGYRTYTFTSSGSITF*
Ga0153799_10695831	3300012012	Freshwater	VIIRYADSFAAATSTTGSPTITVAGGYRVYQWTSSGSITF*
Ga0153805_10252952	3300012013	Surface Ice	IVIIRYSDAYALATSTTGSPLITTTGGYNIYKFTTSGSITF*
Ga0153805_10883502	3300012013	Surface Ice	DTSAAATATTGSPTITVAGGYRVYKFTSSGSITF*
Ga0157203_10174521	3300012663	Freshwater	IRYPDSNPAATATTGSPTITVSGGYRIYQWTASGSITF*
Ga0157210_10204964	3300012665	Freshwater	IILRHLDSLPAASATTGSPTITVAGGYRIYQFTASGSITF*
Ga0160423_105243091	3300012920	Surface Seawater	VVIFRYNDAFGTLTSTTGSPTITTSGGYRYYKYTGSGGVTI*
Ga0164293_110643571	3300013004	Freshwater	ILQYPDSYAAATTSGSPNVTVSGGYRTYRFWQSGTITF*
Ga0164292_106551241	3300013005	Freshwater	YPDTFAAATSTTGSPTITVTGGYRIYKYTGSGTFTF*
Ga0164294_103335832	3300013006	Freshwater	IRYPDSYAAATATTGSPTITVAGGYRIYAWTSSGSITF*
Ga0177922_105219613	3300013372	Freshwater	VIIRYADTFSAASSTTGSPTITVTGGYRYYTWTGSGSITF*
Ga0177922_107714071	3300013372	Freshwater	ADTYSAATATTGSPTITVTGGYRVYKWTGNGTITF*
Ga0181338_10047575	3300015050	Freshwater Lake	RYADTFAAATSTTGSPTITVAGGYRVYQWTSSGSITF*
Ga0181339_10122951	3300017700	Freshwater Lake	YSDAYDAATSTTGSPTITTSGGFRYYTFTATGTITF
Ga0181339_10139032	3300017700	Freshwater Lake	IVIIRYADTYGAATSTTGSPTITVAGGYRVYQWTSSGSITF
Ga0181339_10320133	3300017700	Freshwater Lake	IVILRYPDTFRAATSTTGSPTITVAGGFRVYQFTANGSITF
Ga0181364_10169471	3300017701	Freshwater Lake	IVVIRYADSFPAASATTGSPTITVAGGYRVYKWTSSGSVTF
Ga0181350_10030348	3300017716	Freshwater Lake	IIRYADTYNAASSTTGSPTIAVTGGYRIYTFTGTGSITF
Ga0181350_11411951	3300017716	Freshwater Lake	YPDTFIAATSTTGSPTITVAGGFRVYQFTANGSITF
Ga0181350_11506791	3300017716	Freshwater Lake	SGIVIIRYADSFAAASATTGSPTITVAGGYRIYQWTSSGSITF
Ga0181352_11064852	3300017747	Freshwater Lake	VIIRYADSFAAAVSTTGSPTITVAGGYRVYQWTSSGSITF
Ga0181356_11179113	3300017761	Freshwater Lake	YADTYAAANATTGTPTITVAGGYRKYTWTGNGSITF
Ga0181343_10462053	3300017766	Freshwater Lake	RYPDSYVAATSTTGSPTITVAGGYRVYNFASSGSITF
Ga0181343_11115471	3300017766	Freshwater Lake	IVIIRYADTYPAATSTTGSPTITVSGGYRVYKFTGSGSITF
Ga0181358_12355172	3300017774	Freshwater Lake	VVIRYADTFAAATATTGSPTITVAGGYRVYQWTSSGSITF
Ga0181357_100067715	3300017777	Freshwater Lake	VIIRYADTYGAATTTTGSPTITVAGGYRVYKWTGSGTITF
Ga0181357_10146541	3300017777	Freshwater Lake	GSGIVIIRYADTYDAATSTTGSPTITVAGGYRVYSWAGSGSITI
Ga0181346_12836882	3300017780	Freshwater Lake	GSGIVIIRYADTFAAAASSTGSPKITVSGGYRIHTWTSSGSITI
Ga0181348_10868383	3300017784	Freshwater Lake	RYADTFAAATSTTGSPTITVAGGYRVYQWTSSGSITF
Ga0181355_10313651	3300017785	Freshwater Lake	YPDTFIAATSTTGSPTITVAGGFRVYKWTSSGSITF
Ga0181355_12473261	3300017785	Freshwater Lake	RYADTFTAAASTTGSPTITVSGGFRTYSWTGSGSITF
Ga0181355_13198851	3300017785	Freshwater Lake	IRYADTYNAATSTTGSPTITVAGGYRVYKWTASGSITF
Ga0181355_13610481	3300017785	Freshwater Lake	LIIRYGANYAAAQSTTGSPTITVAGGYRVYEWTGSGSITF
Ga0181355_13679273	3300017785	Freshwater Lake	GVVIIRYPDSFKLATSSTGSPTITTANGFRVYQWTSSGSITF
Ga0181600_102098992	3300018036	Salt Marsh	PEGLVAATSTTGSPDIFTAGGYKYYIFKQNGSITW
Ga0181591_110538493	3300018424	Salt Marsh	ILRYPSSMGEVTSTVGSPTTTTSGGYIYYTFTGSGSITF
Ga0211732_15092021	3300020141	Freshwater	IIRYADTYAAASSTTGSPTITVAGGYRVYQWTSSGSITF
Ga0211736_105237351	3300020151	Freshwater	PVVDVAATSTTGSPTITVAGGYRVYKFTASGSITF
Ga0211736_106103752	3300020151	Freshwater	SGLVQIRYPDSYAAPNATTGSPSATTNTEYRTYTWTGNGSITF
Ga0211734_112864582	3300020159	Freshwater	RYADTFPAATSTTGNPVITVSGGYRIYKWISSGTITF
Ga0211726_103600641	3300020161	Freshwater	VILRYADTYPPLLGTTGSPTITVSGGYRIYKWTSTGSATI
Ga0211735_100663651	3300020162	Freshwater	YADSYSAASNTTGSPNVIIDGGYRIYVWTTSGTITF
Ga0194124_101242506	3300020196	Freshwater Lake	GIVIIAYPDSYAAATSTTGSPTVVVSGGYRRYTFTGNGSITF
Ga0211731_101540551	3300020205	Freshwater	VIIRYADTYPVATSTTGSPTITTAGGYRVYQWTTSGSITF
Ga0208364_10568751	3300020533	Freshwater	YPDTFAAATSTTGSPTVATSGGYRKYTFTGDGSITF
Ga0194048_101460901	3300021519	Anoxic Zone Freshwater	IRYADTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF
Ga0222713_106911101	3300021962	Estuarine Water	SGIVIIRYADTFAAATATTGSPTITVAGGYRVYQWTSSGSITF
Ga0181353_10984021	3300022179	Freshwater Lake	VVIIRYSSIYAPAASTSGSPTVTISGGYRIYQWTGNGSIKF
Ga0196905_11332341	3300022198	Aqueous	SDTYPAATSTTGSPTITNTGGYRIYKFTGSGSITF
Ga0181351_10865211	3300022407	Freshwater Lake	YADSFAAATSTTGSPTITVTGGYRIYQWTSSGSITF
Ga0214917_104247512	3300022752	Freshwater	VIIRYSDTYAAATSTTGSPTITVSGGYRTYKFTDNGSITF
Ga0255769_102705744	3300022927	Salt Marsh	ADSYAAATATTGSPTITVAGGYRVYSWAGSGTITF
Ga0214923_101375473	3300023179	Freshwater	GSGIVLIRYSDTYPAATSTTGSPSTITSGGYRYYKFTGDGSITF
Ga0214919_102310963	3300023184	Freshwater	IRYAVDYKAATATTGSPTVTVADGYRVYKWTSSGSITF
Ga0244775_101829534	3300024346	Estuarine	LRYADTYSAAIATTGSPTYTTSGGYRVYTFTSSGSITF
Ga0244775_112192831	3300024346	Estuarine	GIVSIRYSDSFTAAAATSGSPTYVVSGGFRTYTWTGDGSITF
Ga0244775_115348252	3300024346	Estuarine	YPDAFPLATSTTGSPTVTNPTGYRVYTFTASGSITF
Ga0244776_103645331	3300024348	Estuarine	YPDSWLAAASTTGSPTVTVSGGYRIYKFTASGSITF
Ga0255164_10324231	3300024495	Freshwater	IRYPSSYDAASSTTGSPTYTVSGGYRIYQWTGSGSITF
Ga0255176_10858622	3300024507	Freshwater	YPSSFPAATSTTGSPTVSTSSRPGYRVYTFTGSGSITF
Ga0208877_10462971	3300025416	Freshwater	ISYPNTYPAASSTTGSPSIVNTGGNRIYTWTSSGSITF
Ga0208248_10139691	3300025595	Freshwater	VILSYPSLYPAATSTTGSPTITTASGYRIYTWTGNGSITF
Ga0208613_11348572	3300025616	Freshwater	VIIRYPSGYAAASATTGSPTINVSGGYRTYIWTSSGSITF
Ga0208019_11862122	3300025687	Aqueous	VVRYSDDYAAATTTGSPTYTVSGGFRIYKFTGSGSIRWG
Ga0209310_10485135	3300025715	Anaerobic Digestor Sludge	VVIIRYPDTYDAAIATTGSPTVTVTGGYRIYQWTASGSITF
Ga0255073_10817231	3300027135	Freshwater	GRVILRYPDSFPAASATTGSPGVSVSGGYRIYNFSGTGSITL
Ga0208951_10930011	3300027621	Freshwater Lentic	GIVIIRYLSGYDAAASTTGATVTVAGGYRIYQWANSGSITF
Ga0208133_10072061	3300027631	Estuarine	VIIRYADTYAAASSTTGSPTITTAGGYRVYQWTSSGSITF
Ga0208133_10118705	3300027631	Estuarine	IIRYPDSYPLATSAPGASVSTTGGYRIYQWTSSGSITF
Ga0208133_10759651	3300027631	Estuarine	IIRYLDTYLPASSTTGSPTYTVVNGYRVYKFTASGSITF
Ga0208960_11162661	3300027649	Freshwater Lentic	VIIIRYPDTYLAATSTTGSPTVTVTGGYRIYKWTGSGSITI
Ga0208975_10005331	3300027659	Freshwater Lentic	GIVIIRYADTYAAATTTTGSPTITVAGGYRVYKWTGSGTITF
Ga0209769_10173931	3300027679	Freshwater Lake	RYADTFPAATSTTGSPTITVSGGYRIYKWTSSGSITL
Ga0209033_10592941	3300027697	Freshwater Lake	RYPSTGNTNAASTTGSPSFVESGGYKYYKFTGTGSITF
Ga0209499_11703753	3300027712	Freshwater Lake	IRYSDSFSAASSTTGSPTITVAGGYRVYKFTDNGTITF
Ga0209499_13192612	3300027712	Freshwater Lake	IRYPDSYSAAASTTGSPTVTVTGGYRIYKWTGNGSITF
Ga0209442_10535191	3300027732	Freshwater Lake	GIVIVRYADTYPAATATTGSPTITTSGGFRIYVWTSSGSITI
Ga0209597_13855862	3300027746	Freshwater Lake	DTFPAATATTGSPTITVAGGYRVYKWTTVGNGSITF
Ga0209189_14116111	3300027747	Freshwater Lake	SDSYAAASATTGSPTITITNGYRYYAFTSSGSITF
Ga0209296_11512011	3300027759	Freshwater Lake	TYAAATATTGSPTITTAGGYRVYKWTTVGTWSITF
Ga0209296_13970991	3300027759	Freshwater Lake	AGIVIVTYPDSYPAAASTTGSPTITVTNGFRYYAFTSSGSITF
Ga0209088_101777322	3300027763	Freshwater Lake	VVIRYADSTPAATVVTGSPTVTVSGGYRIYTWTSSGSITI
Ga0209088_103322571	3300027763	Freshwater Lake	LDTYAVASSTTGSPTITVAGGYRIYKFTSSGSITF
Ga0209086_100543551	3300027770	Freshwater Lake	LDGYKAATSTTGSPNVIVSGGYRTYIWTSSGSITF
Ga0209768_100855301	3300027772	Freshwater Lake	DTFDAALSTTGSPTITQTGGYRIYKWLSGTGSVTF
Ga0209500_101972351	3300027782	Freshwater Lake	RYADTYPAATSTTGSPTITTGGGYRVYQWTSSGSITF
Ga0209246_103053082	3300027785	Freshwater Lake	IVILRYADTFDAATATTGSPTITVAGGYRVYKFTSSGSITF
Ga0209972_100217684	3300027793	Freshwater Lake	YADSYPAATTTGSPTVTVSGGFRVYVFNASGSITF
Ga0209972_102466403	3300027793	Freshwater Lake	IRYADSFPAATSTTGSPTTVTSGGYRYYKWTGSGSITF
Ga0209107_102382991	3300027797	Freshwater And Sediment	YADTYPAATATTGSPDITVAGGYRVYKWTTVGSWSVTF
Ga0209353_103622181	3300027798	Freshwater Lake	VIIRYADSYPAATSTTGSPTITVSGGYRIYQWTSSGSITF
Ga0209229_100133921	3300027805	Freshwater And Sediment	IVVIRYADTYGVATSTTGSPTVTTAGGYRVYKWTSSGSITF
Ga0209354_102206533	3300027808	Freshwater Lake	YLATYNAATATTGSPTVTIINGYRIYTWSTTGSGSITF
Ga0209354_102670291	3300027808	Freshwater Lake	YADTYDAAASTTGSPTITVAGGYRVYKFTSSGTITF
Ga0209354_104441871	3300027808	Freshwater Lake	YADTYSAATATTGSPAITVSGGYRVYMFTSSGTITF
Ga0209777_104915191	3300027896	Freshwater Lake Sediment	GVVIISYPDSYPAASATTGSPTITVAGGYRVYIWTSSGSITF
Ga0209668_104965961	3300027899	Freshwater Lake Sediment	SGNGGSGGSGIVIIRYADTFAAATTTVGSPTITVAGGYRVYKFTGTGSITF
Ga0209668_110211861	3300027899	Freshwater Lake Sediment	VRIQYSDTFSAAASTTGSPTYSVSGGLRIYTWYNNGSITW
Ga0209400_10281132	3300027963	Freshwater Lake	IKVPVTAVSTTGSPTVVNSGGFNYYKFTASGSITF
Ga0209400_11605071	3300027963	Freshwater Lake	VIIRYSDAYAAATATTGSPTITVAGGYRVYKWTTVGTWSITF
Ga0209299_10486254	3300027974	Freshwater Lake	GGSGIVIIRYASTYPAATSTTGSPATVVTGGYRYYTWTGSGSITL
Ga0247723_11661981	3300028025	Deep Subsurface Sediment	SGVVIIRYADSFAAATATTGSPTITVTGGYRIYQWNSSGSITF
Ga0256331_11339982	3300028286	Freshwater	VIAYPSSFPAATSTTGSPTVSTSSRPGYRVYTFTGSGSITF
Ga0304730_11603022	3300028394	Freshwater Lake	IRYSDAYAAATATTGSPTITVAGGYRVYKWTTVGTWSITF
Ga0304730_12262901	3300028394	Freshwater Lake	IRYADTSAAATATTGSPTITVAGGYRVYQWTSSGSITF
Ga0304730_13307801	3300028394	Freshwater Lake	YPDAYSLATSTTGSPTVTTEGGYRIYTFTATGSIGW
Ga0315909_105411191	3300031857	Freshwater	SGTVIIRTANTDPVGTATGSPTITTAGGYRLYQWTAVGTWSITF
Ga0315274_119449592	3300031999	Sediment	IRYADTFAAAASTTGSPTITVAGGYRVYNWTGSGSITF
Ga0315906_104975072	3300032050	Freshwater	GASGFVAIRYSDTYELARSTTGSPTITTSGGYRIYQWTGSGTIRF
Ga0315903_107374992	3300032116	Freshwater	LRYPDTFRAATSTTGSPTITVAGGFRVYQFTANGSITF
Ga0315277_116777792	3300032118	Sediment	GSGIVIIRYADTYNAATSTTGSPTITVAGGYRVYKWTASGTITF
Ga0315283_122901671	3300032164	Sediment	IRYADTYQAATSTTGSPTVTVAGGYRVYQWTASGTITF
Ga0334982_0000093_42806_42928	3300033981	Freshwater	MIIRYLESYQAAVSTTGSPTVTTSGGYRIYTWTASGSITF
Ga0334982_0000880_2828_2947	3300033981	Freshwater	MLIRYPDAYRPATTTGSPTITVSGGYRIYKFTGNGSITF
Ga0334982_0013593_2219_2344	3300033981	Freshwater	VVIIRYPDSYAAATSTTGSPTITVSGGYRTYTFTGNGTITF
Ga0334992_0000029_135676_135792	3300033992	Freshwater	MRYPDAYLAATSTTGSPTITNPTGYRVYTFTASGSITF
Ga0334992_0333570_593_700	3300033992	Freshwater	ADSYASATATTGSPNVTIAGGYRIYKWTSSGSITF
Ga0334994_0031472_2330_2452	3300033993	Freshwater	MIIRYADTFTAAASTTGSPTITVSGGYRIYKWTGSGSITF
Ga0334996_0265361_357_479	3300033994	Freshwater	MIIRYPDSFSEAVATTGSPSVTVSGGYRIYQWTGSGSITF
Ga0334979_0002114_11783_11908	3300033996	Freshwater	MVVIRYLDTYPAATSTTGSPSITTSGGYRIYQWTGSGSITI
Ga0334986_0000667_15485_15607	3300034012	Freshwater	MIIRYEDIYPAAASTTGSPSVSVTGGYRIYTWTGSGSITF
Ga0334986_0078983_1111_1233	3300034012	Freshwater	MIIRYSDAFAPATSTTGSPTYTVSGGNNIYVFNASGSITF
Ga0334991_0139074_994_1119	3300034013	Freshwater	IVIIRYADSYPAATSTTGSPTITTAGGYRVYKWTSSGSITF
Ga0334998_0182792_3_110	3300034019	Freshwater	ADTFAAATATTGSPTYTVAGGYRIYKFTGSGSITW
Ga0335005_0022229_2546_2671	3300034022	Freshwater	MVIIRCSSSLPVLAGTTGSPTITVSGGYRIYKFTTSGSITF
Ga0335005_0203811_1_114	3300034022	Freshwater	RYADSTAEASSTTGSPTITVAGGYRVYKWTSSGSITF
Ga0335021_0408995_224_346	3300034023	Freshwater	MVIRYPDSIAAATSTTGSPTITVSGGYRIYSYTSTGTFVL
Ga0334995_0003523_11648_11764	3300034062	Freshwater	MRYSDSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF
Ga0334995_0025474_588_710	3300034062	Freshwater	MIIRYPDSFSAAVATTGSPSVTVSGGYRIYQWTGSGSITF
Ga0334995_0030478_3276_3398	3300034062	Freshwater	MIVRYADTYPAATATTGSPTITTSGGFRIYVWTSSGSITI
Ga0334995_0186066_1340_1459	3300034062	Freshwater	MVRYSDAFAAAASTTGSPTVTVSGGYRVYTWTASGSITW
Ga0334995_0632618_399_521	3300034062	Freshwater	MIIRYSDAFEAASSTTGSPTITVSGGYRIYQWTSSGSITF
Ga0310130_0006583_2624_2749	3300034073	Fracking Water	MVVIRYPSTLPLATSTTGSPTVTTSGGYRIYQWTSNGSITF
Ga0335020_0067796_444_551	3300034082	Freshwater	MDSYPAATSTTGSPTITVSGGYRIYKWITSGSITF
Ga0335020_0103096_511_633	3300034082	Freshwater	MIIRYADTFAAATSTTGSPTITTAGGYRVYQWTSSGSITF
Ga0335010_0442904_579_698	3300034092	Freshwater	ILRYPDTNAAATSITGSPTVTVAGGYRVYKWTSSGSITF
Ga0335012_0403258_535_666	3300034093	Freshwater	SGFVAIRYSDTFPLATSTTGSPSITTAGGYRIYQWTSSGTITF
Ga0335029_0239554_370_498	3300034102	Freshwater	VIIAYPDSFPAAVSTTGSPTVSLVSRAGYRVYTFTGSGSITF
Ga0335036_0005173_10608_10730	3300034106	Freshwater	MIIRYPDTYAAATSTTGSPTITTTGGYRIYKWTGNGSITF
Ga0335036_0012902_5080_5202	3300034106	Freshwater	MIIRYADSFAAAASTTGSPTITVSGGFRTYLWTGNGSITF
Ga0335036_0148360_517_639	3300034106	Freshwater	MVIRYASSFAAALSTTGSPTVTVAGGYRVYTWTGSGSITF
Ga0335036_0306159_3_131	3300034106	Freshwater	GVVIIRYADTFPAATTTTGSPEVTTAGGFRIYRWTSSGSITF
Ga0335036_0465291_2_109	3300034106	Freshwater	PDTFSLAISTTGSPTVTNPTGYRVYTFTASGSITF
Ga0335036_0581960_107_229	3300034106	Freshwater	MIIRYADSAPAAASTTGSPTVTVAGGYRVYKWTGSGSITF
Ga0335050_0078444_2_121	3300034108	Freshwater	IIRYLDSYPAATSTTGSPTITVSGGYRIYQWTTSGSITF
Ga0335050_0078807_1837_1962	3300034108	Freshwater	IVIIRYADTYPAATSTTGSPTITVAGGYRVYKWTSSGSITF
Ga0335050_0414168_2_145	3300034108	Freshwater	AGGGSGVVILRYPDSYALASSTTGTISTVQSGGYRYYTFTSSGSITF
Ga0335063_0368923_180_302	3300034111	Freshwater	MIIRYADTYAAATSTTGSPTITVAGGYRVYSWTGSGSITF
Ga0335033_0605652_395_508	3300034117	Freshwater	RYPDAYSLATSTTGSPTVTTAGGYRIYTFTSTGSIGW
Ga0335053_0533983_561_686	3300034118	Freshwater	IVIIRYPDTYPAAASYTGSPTITNPTGYRVYKFTGDGTITF
Ga0335056_0015577_3552_3677	3300034120	Freshwater	MVIIRYPDNFVLASATTGSPTVSNPTGYRVYTFTSSGSITF
Ga0335058_0206805_1038_1145	3300034121	Freshwater	VDSYPAATSTTGSPTITVSGGYRVYKYTSSGSITF
Ga0335060_0026858_3651_3767	3300034122	Freshwater	VRYADSFPAAASTTGSPTVTVAGGFRIYKWTGSGSITF
Ga0335065_0455447_3_116	3300034200	Freshwater	IRYADKYLAAKSTTGATITVAGGYRVYTWTSSGTITF
Ga0335049_0009481_2603_2725	3300034272	Freshwater	MIVRYPDTFPLASATTGSPTITNPTGYRVYTFTASGSITF
Ga0335013_0682281_3_137	3300034284	Freshwater	GGSGIVIIRHVDTFPLATTTGSVAVTSSGGYRTYKFTGNGSITF
Ga0335039_0455353_240_365	3300034355	Freshwater	MVIIRYADTFAAATSTTGSPTLTVTGGYRIYQWASSGSITF

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F019322

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Structural matches with SCOPe domains

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences