NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019022

Metagenome / Metatranscriptome Family F019022

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019022
Family Type Metagenome / Metatranscriptome
Number of Sequences 232
Average Sequence Length 91 residues
Representative Sequence MVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Number of Associated Samples 179
Number of Associated Scaffolds 232

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.45 %
% of genes near scaffold ends (potentially truncated) 54.31 %
% of genes from short scaffolds (< 2000 bps) 83.62 %
Associated GOLD sequencing projects 164
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (86.638 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(21.552 % of family members)
Environment Ontology (ENVO) Unclassified
(54.741 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(54.310 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.59%    β-sheet: 3.31%    Coil/Unstructured: 47.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 232 Family Scaffolds
PF03372Exo_endo_phos 0.43



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.07 %
UnclassifiedrootN/A12.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002305|B570J29619_1002588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1533Open in IMG/M
3300002835|B570J40625_100134868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2878Open in IMG/M
3300004241|Ga0066604_10227123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii745Open in IMG/M
3300004794|Ga0007751_11347836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii534Open in IMG/M
3300004795|Ga0007756_10889564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii528Open in IMG/M
3300005662|Ga0078894_11607804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii536Open in IMG/M
3300005662|Ga0078894_11651454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii527Open in IMG/M
3300005758|Ga0078117_1139797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1158Open in IMG/M
3300006037|Ga0075465_10124966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii579Open in IMG/M
3300006165|Ga0075443_10034684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1685Open in IMG/M
3300006357|Ga0075502_1508809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii841Open in IMG/M
3300006400|Ga0075503_1426419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii636Open in IMG/M
3300006875|Ga0075473_10459642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii513Open in IMG/M
3300007513|Ga0105019_1233612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea866Open in IMG/M
3300007513|Ga0105019_1271031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea737Open in IMG/M
3300007516|Ga0105050_10406861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii815Open in IMG/M
3300007516|Ga0105050_10510268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii709Open in IMG/M
3300007552|Ga0102818_1085711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii623Open in IMG/M
3300009002|Ga0102810_1262061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea533Open in IMG/M
3300009071|Ga0115566_10407769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea782Open in IMG/M
3300009071|Ga0115566_10512422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea679Open in IMG/M
3300009071|Ga0115566_10565624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300009077|Ga0115552_1247286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300009432|Ga0115005_10823697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea748Open in IMG/M
3300009436|Ga0115008_10049023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii3280Open in IMG/M
3300009436|Ga0115008_10585749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii802Open in IMG/M
3300009436|Ga0115008_10993441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii626Open in IMG/M
3300009496|Ga0115570_10294142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea705Open in IMG/M
3300009497|Ga0115569_10244949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea808Open in IMG/M
3300009507|Ga0115572_10440778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea726Open in IMG/M
3300009543|Ga0115099_10178683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii639Open in IMG/M
3300009544|Ga0115006_10408293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1189Open in IMG/M
3300009592|Ga0115101_1096749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea673Open in IMG/M
3300009592|Ga0115101_1152756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea618Open in IMG/M
3300009592|Ga0115101_1705519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii640Open in IMG/M
3300009599|Ga0115103_1472951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea630Open in IMG/M
3300009599|Ga0115103_1556872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300009606|Ga0115102_10052620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300009606|Ga0115102_10359431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii807Open in IMG/M
3300009608|Ga0115100_10485502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea587Open in IMG/M
3300009608|Ga0115100_10948907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea724Open in IMG/M
3300009608|Ga0115100_11242999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii533Open in IMG/M
3300009785|Ga0115001_10534692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea721Open in IMG/M
3300010885|Ga0133913_11140186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2004Open in IMG/M
3300012408|Ga0138265_1248477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea645Open in IMG/M
3300012412|Ga0138266_1444162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300012413|Ga0138258_1052628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea578Open in IMG/M
3300012416|Ga0138259_1344442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300012472|Ga0129328_1137818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300012504|Ga0129347_1248158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii730Open in IMG/M
3300012522|Ga0129326_1247743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea611Open in IMG/M
3300012523|Ga0129350_1041616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii514Open in IMG/M
3300012935|Ga0138257_1197970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea522Open in IMG/M
3300012953|Ga0163179_11906626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii545Open in IMG/M
3300012963|Ga0129340_1187601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii617Open in IMG/M
3300012965|Ga0129346_1010953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii636Open in IMG/M
3300012965|Ga0129346_1147958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii554Open in IMG/M
3300012966|Ga0129341_1287599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii672Open in IMG/M
3300016703|Ga0182088_1156479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300016882|Ga0186577_108287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
3300017166|Ga0186523_112594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii713Open in IMG/M
3300017210|Ga0186339_113755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii718Open in IMG/M
3300017238|Ga0186197_117573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea585Open in IMG/M
3300017782|Ga0181380_1263834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii569Open in IMG/M
3300017949|Ga0181584_10622356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii652Open in IMG/M
3300017952|Ga0181583_10096146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2031Open in IMG/M
3300018426|Ga0181566_10805465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea641Open in IMG/M
3300018622|Ga0188862_1030046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii513Open in IMG/M
3300018628|Ga0193355_1021108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii615Open in IMG/M
3300018657|Ga0192889_1053167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii560Open in IMG/M
3300018692|Ga0192944_1035375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea724Open in IMG/M
3300018759|Ga0192883_1061856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii537Open in IMG/M
3300018831|Ga0192949_1107457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300018846|Ga0193253_1110003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii632Open in IMG/M
3300018874|Ga0192977_1088015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea623Open in IMG/M
3300018874|Ga0192977_1095970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300018926|Ga0192989_10140262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii590Open in IMG/M
3300018980|Ga0192961_10210303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea581Open in IMG/M
3300018982|Ga0192947_10175008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea712Open in IMG/M
3300018982|Ga0192947_10252956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300018983|Ga0193017_10185814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea666Open in IMG/M
3300019007|Ga0193196_10286043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii710Open in IMG/M
3300019009|Ga0192880_10165202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii551Open in IMG/M
3300019017|Ga0193569_10290621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii681Open in IMG/M
3300019017|Ga0193569_10314094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii642Open in IMG/M
3300019017|Ga0193569_10356240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii582Open in IMG/M
3300019019|Ga0193555_10251705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii568Open in IMG/M
3300019021|Ga0192982_10225733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea670Open in IMG/M
3300019035|Ga0192875_10154800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii581Open in IMG/M
3300019036|Ga0192945_10133693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea795Open in IMG/M
3300019036|Ga0192945_10189764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea661Open in IMG/M
3300019036|Ga0192945_10268859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300019039|Ga0193123_10205959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea773Open in IMG/M
3300019048|Ga0192981_10192447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea798Open in IMG/M
3300019048|Ga0192981_10236558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea703Open in IMG/M
3300019048|Ga0192981_10237103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii702Open in IMG/M
3300019048|Ga0192981_10248544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300019048|Ga0192981_10263428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea655Open in IMG/M
3300019050|Ga0192966_10175148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea766Open in IMG/M
3300019095|Ga0188866_1028741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300019103|Ga0192946_1039679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea707Open in IMG/M
3300019123|Ga0192980_1067849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea666Open in IMG/M
3300019123|Ga0192980_1070027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea653Open in IMG/M
3300019131|Ga0193249_1127337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300019151|Ga0192888_10207996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii589Open in IMG/M
3300019261|Ga0182097_1227802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300019274|Ga0182073_1054111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii620Open in IMG/M
3300019276|Ga0182067_1401629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea530Open in IMG/M
3300019459|Ga0181562_10393793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea670Open in IMG/M
3300020074|Ga0194113_11113650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii521Open in IMG/M
3300020159|Ga0211734_10239817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii548Open in IMG/M
3300020189|Ga0181578_10468291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii531Open in IMG/M
3300020197|Ga0194128_10149882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1331Open in IMG/M
3300020546|Ga0208853_1005625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2889Open in IMG/M
3300020603|Ga0194126_10370948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii924Open in IMG/M
3300021108|Ga0214162_1063729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii604Open in IMG/M
3300021169|Ga0206687_1994735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300021350|Ga0206692_1098476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii559Open in IMG/M
3300021355|Ga0206690_10463909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300021365|Ga0206123_10244193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea782Open in IMG/M
3300021890|Ga0063090_1072163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii515Open in IMG/M
3300021925|Ga0063096_1064845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii571Open in IMG/M
3300021927|Ga0063103_1030719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300021941|Ga0063102_1009469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300021950|Ga0063101_1056086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300021962|Ga0222713_10521978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
3300025680|Ga0209306_1131308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea723Open in IMG/M
3300025704|Ga0209602_1152513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea740Open in IMG/M
3300025869|Ga0209308_10294586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea679Open in IMG/M
3300026136|Ga0208763_1009529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1538Open in IMG/M
3300027719|Ga0209467_1180420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii745Open in IMG/M
3300027771|Ga0209279_10272886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii518Open in IMG/M
3300027791|Ga0209830_10231767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea846Open in IMG/M
3300027810|Ga0209302_10280131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii776Open in IMG/M
3300027810|Ga0209302_10563075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii500Open in IMG/M
3300027833|Ga0209092_10085902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1886Open in IMG/M
3300027849|Ga0209712_10442805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea730Open in IMG/M
3300027899|Ga0209668_10061622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2061Open in IMG/M
3300027899|Ga0209668_11216725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300027983|Ga0209284_10297359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii818Open in IMG/M
3300028137|Ga0256412_1253451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
3300028137|Ga0256412_1405614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300028233|Ga0256417_1179400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300028282|Ga0256413_1298587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea568Open in IMG/M
3300028290|Ga0247572_1183244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M
3300028335|Ga0247566_1083189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300030625|Ga0210259_10580094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae520Open in IMG/M
3300030699|Ga0307398_10572754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii624Open in IMG/M
3300030709|Ga0307400_10878458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii551Open in IMG/M
3300030709|Ga0307400_10952068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea523Open in IMG/M
3300030738|Ga0265462_11736376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae595Open in IMG/M
3300030741|Ga0265459_13323953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300031522|Ga0307388_11109236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300031522|Ga0307388_11196174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii517Open in IMG/M
3300031569|Ga0307489_10039005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2612Open in IMG/M
3300031569|Ga0307489_10590158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea765Open in IMG/M
3300031602|Ga0307993_1039331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1187Open in IMG/M
3300031638|Ga0302125_10167804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii691Open in IMG/M
3300031710|Ga0307386_10574664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300031710|Ga0307386_10590637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii587Open in IMG/M
3300031717|Ga0307396_10425888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea636Open in IMG/M
3300031725|Ga0307381_10317796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii563Open in IMG/M
3300031729|Ga0307391_10658719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300031734|Ga0307397_10340652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300031734|Ga0307397_10372345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300031734|Ga0307397_10518963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea557Open in IMG/M
3300031734|Ga0307397_10524958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea554Open in IMG/M
3300031735|Ga0307394_10406511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea545Open in IMG/M
3300031735|Ga0307394_10407954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300031737|Ga0307387_11046735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300031738|Ga0307384_10477462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea588Open in IMG/M
3300031739|Ga0307383_10537934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii585Open in IMG/M
3300031739|Ga0307383_10586967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea561Open in IMG/M
3300031742|Ga0307395_10510039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M
3300031743|Ga0307382_10608227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea505Open in IMG/M
3300032462|Ga0335396_10507757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii764Open in IMG/M
3300032470|Ga0314670_10533500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea611Open in IMG/M
3300032470|Ga0314670_10574572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300032491|Ga0314675_10566648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea558Open in IMG/M
3300032517|Ga0314688_10524956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea642Open in IMG/M
3300032518|Ga0314689_10606072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300032520|Ga0314667_10794201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea511Open in IMG/M
3300032540|Ga0314682_10587958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea609Open in IMG/M
3300032616|Ga0314671_10517403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
3300032616|Ga0314671_10605715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300032616|Ga0314671_10705839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300032651|Ga0314685_10641257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea576Open in IMG/M
3300032666|Ga0314678_10383662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300032708|Ga0314669_10517897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea657Open in IMG/M
3300032727|Ga0314693_10565775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea618Open in IMG/M
3300032728|Ga0314696_10477905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea642Open in IMG/M
3300032752|Ga0314700_10765635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea505Open in IMG/M
3300032754|Ga0314692_10500407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea653Open in IMG/M
3300033572|Ga0307390_10775024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300033572|Ga0307390_10898652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea560Open in IMG/M
3300033572|Ga0307390_10965345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea540Open in IMG/M
3300033978|Ga0334977_0049841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2333Open in IMG/M
3300033984|Ga0334989_0085057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1750Open in IMG/M
3300033984|Ga0334989_0425151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii677Open in IMG/M
3300034068|Ga0334990_0470561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii672Open in IMG/M
3300034068|Ga0334990_0507299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii642Open in IMG/M
3300034105|Ga0335035_0527269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii640Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine21.55%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.53%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.47%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.17%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.31%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.59%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.59%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.16%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.16%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.72%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.72%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.72%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.29%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.86%
WatershedsEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.86%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.86%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.86%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.86%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.86%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.43%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.43%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.43%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.43%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.43%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.43%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002305Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004241Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006033Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017166Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)Host-AssociatedOpen in IMG/M
3300017210Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 103 ?mol photons light - Favella ehrenbergii Fehren 1 (MMETSP0123)Host-AssociatedOpen in IMG/M
3300017238Metatranscriptome of marine eukaryotic communities from unknown location in Brackish water medium, at 19 C, 5 psu salinity and 389 ?mol photons light - Pseudokeronopsis sp. Brazil (MMETSP1396)Host-AssociatedOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018759Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000759 (ERX1789554-ERR1719287)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019035Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789492-ERR1719296)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021067Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13CEnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300027719Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027851Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030599Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030603Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J29619_100258853300002305FreshwaterMIRKMRWIFWSIGASVPIYRNTYWDYLGRRVAWRDSLSGKTEEQKREEAEALIGGWGYVPRFTPNTDYSIKARKYAL*
B570J40625_10013486843300002835FreshwaterMVFHVTNYMRETNVWMIRKMRWIFWSIGASVPIYRNTYWDYLGRRVAWRDSLSGKTEEQKREEAEALIGGWGYVPRFTPNTDYSIKARKYAL*
Ga0066604_1022712313300004241FreshwaterMVFHITNYMRETNVWMIRKMRWILWGGCLSLPLYRNFYWDFIGRRVVLKDYLSGMTEEDKRNDAIEKRANWGYKPRYEPIYNFSLKTRKYAL*
Ga0007751_1134783623300004794Freshwater LakeSNYMRETNVWMIRKCRWIFWGLGASVPFYRNTYWEYLGRRVAWKDHYSGTEEEKRAQAEAKRADWGFHPRYEAKYDFSIKT*
Ga0007756_1088956423300004795Freshwater LakeFHISNYMRETNVWMIRKCRWIFWGLGASVPFYRNTYWEYLGRRVAWKDHYSGTEEEKRAQAEAKRADWGFHPRYEAKYDFSIKT*
Ga0007756_1130733013300004795Freshwater LakeNYMRETNVWMIRKGRWMLWGFCGFVPAYRNFYWDFLGRRVAWKDYYSGLTEEEKKKQAEDLRADWGYKPRYEPIYNFSLKKRKYDS*
Ga0078894_1027388833300005662Freshwater LakeMVFHVTNYMRETNVWMIRKGRWMLWGFCGFVPAYRNFYWDFLGRRVAWKDYYSGLTEEEKKKQAEDLRADWGYKPRYEPIYNFSLKKRKYDS*
Ga0078894_1160780413300005662Freshwater LakeMVFHITNYMRETNVWMIRKMRWIFWSIAGAIPFYRNTYWDYLGRRVAWKEKLFAKTEEEQREKAIKDRGNWGYKPRYEPVYNFSIKQKKYAN*
Ga0078894_1165145423300005662Freshwater LakeNYMRETNVWMIRKCRWIFWGLGASVPFYRNTYWEYLGRRVAWKDHYSGTEEEKRAQAEAKRADWGFHPRYEAKYDFSIKT*
Ga0078117_113979723300005758Lake WaterMRETNVWMIRKCRWIFWSLGASVPIYRNTYWDFLGRRVAWKDYYAGTEEEKKAQAEAKRADWGFHPRYEAKYDFSIKT*
Ga0075158_1037250913300005987Wastewater EffluentMVFHITNYMRETNVWMIRKMRWMLWGFVSFIPIYRNVYWDYHGRRVAWKKWFAGKSEDEQRQEAESLRAGWGYKPRYEPVYDFSLKKSKYDT*
Ga0075160_1045562913300005988Wastewater EffluentNNKVRMVFHITNYMRETNVWMIRKMRWMLWGFVSFIPIYRNVYWDYHGRRVAWKKWFAGKSEDEQRQEAESLRAGWGYKPRYEPVYDFSLKKSKYDT*
Ga0075154_1056804023300005989Wastewater EffluentMVFHVTNYMRETNVWMIRKMRWLLWGFVGFIPMYRNFYWDYTGRRVVLKQWLAGKTEQQRREEDENKRANWGYKPRYE
Ga0075012_1071650123300006033WatershedsNYMRETNVWMIRKMRWMLWGFVGFIPMYRNFYWDYIGRRVALKKWIAGKSEDEQRQEAESVRANWGYKPRYEPVYEFSLKRHKYD*
Ga0075465_1012496613300006037AqueousMVFHISNYMRETNVWMIRKCRWIFWGLGASVPFYRNTYWEFLGRRVAWKDHYTGTEEEKRAQAEAKRADWGFHPRYEAKYDFSIKT*
Ga0075443_1003468433300006165MarineMVFHIMNYMRETNVWMIRKMRWIFWGGVLATPFYRITYWDFLGRRTAWRRSLFGGTPEEQQAAAEAKKADWGFTPRYEPSIDFSIKA*
Ga0075502_150880913300006357AqueousMVFHISNYMRETNVWMIRKMRWMFWSLVWCVPIYRNVYWDYFGRRAAWRDSLFGGTDAEKKEWAESQRADWGFHPRYEPKYEFSIKAAKHA*
Ga0075503_142641913300006400AqueousISNYMRETNVWMIRKMRWMFWSLVWCVPIYRNVYWDYFGRRAAWRDSLFGGTDAEKKEWAESQRADWGFHPRYEPKYEFSIKAAKHA*
Ga0075473_1045964223300006875AqueousMVFHITNYMRETNVWMIRKMRWILWGIFGALPLYRNTYWDYLGRRTAWRDHFSGKTEEQKRKEAEERRADWGYHPRYEPKYEFSIKTRKYAL*
Ga0105019_123361213300007513MarineMVFHITNYMRETNVWMIRKCRWLFWGGVMSTVIYRNTYWDYLGRRVAWKERLGWYGDDDEKMKFSKKWKADWGYVPRYVPAYDFSIKARKRVGETDA*
Ga0105019_127103113300007513MarineMVFHVTNYMRETNVWMIRKMRWILWGGVAAVPIYRMTYWDTLGRRIAWRSHWFGGSEDYQKERAEALSAYWGYHPRYEPVYAFSMKHRKYNA*
Ga0105050_1040686113300007516FreshwaterMVFHVTNYMRETNVWMIRKARWIFWSLGALIPAYRNFYWDYLGRRVAWKDYWSGKTDEQKQAEAEAIRADWGYKPRYTPSIDFSIKNRKHAEQTREERMADHPRIVTGH*
Ga0105050_1051026813300007516FreshwaterMRETNVWMIRKMRWILWGAVGATPIYRNVYWDFLGRRVAWRDHLGFWGTEEEKKVKAEQDRAEWGYHPRYEPKYSFSLKTRKYS*
Ga0102818_108571113300007552EstuarinePKTPKPRALYNNLRMVFHVMNYMRETNVWMIRKCRWLFWGIVWSVPVYRATYWDYLGRRVAWREYFNRETEDEQRARAEAERGDWGFNMRYDAKYDFSLKTRKYA*
Ga0103951_1059405213300008832MarineHGMVFHITNYMRETNTWMIRKGRWILWSIFGSLPFYRNTYWDYLGRRVAWKEYFNGKTVDENIADADAARANWGYKPRY*
Ga0102810_126206113300009002EstuarineNINKMVFHVTNYMRETNVWMIRKMRWIFWCSVAMVPVYRNTYWDFLGRRVAWRDHYGFWGTEEEKKVKAESLEANWGYHPRYEPKYNFSIKSKKYETQTDEEKLNDTPRL*
Ga0115566_1040776913300009071Pelagic MarineMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEAAEKNSASWGYHPRYEPVYGFSIKS*
Ga0115566_1051242223300009071Pelagic MarineMVFHVTNYMRETNVWMIRKMRWILWGMVSSVPIYRNTYWDYLGRRVAWRDSLGFWGTEEDKKEKAESLRANWGYNPRYEPVYDFSIKSRKYETQTDLEKV*
Ga0115566_1056562413300009071Pelagic MarineMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDFLGRRVAWRDSLGFWGTEAEKKEKAEKDSANWGYHPRYEPVYDFSIKGRKYSSQTDLEKL*
Ga0115552_124728613300009077Pelagic MarineMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDFLGRRVAWRDSLGFWGTEAEKKEKAEKDSANWGYHPRYEPVYDFSIKSRKYSSQTDLEKL*
Ga0105248_1311501613300009177Switchgrass RhizosphereMRETNTWMIRKMRWMLWLFVGGIPLYRNVYWDYLGRRVAWSNYFSRKTEDEKKVDAEAERTNWCYKPRYEPVYNFSLKRAKYD*
Ga0115005_1082369713300009432MarineMRETNVWMIRKCRWILWGGVAATPFYRCTYWDYLGRRVAWRDHLGFWGTEEEKKIKAEADRGNWGYHPRYEPVYGFSLKSRKYET*
Ga0115008_1004902353300009436MarineMVFHVTNYMRETNVWMIRKMRWIFWSIALSVPIYRNVYWDYLGRRSAWRERFSTMTEEEKRAKAESERTNWGYNPRYTPVHDFSIKKRI*
Ga0115008_1058574913300009436MarineMRETNVWMIRKMRWILWGAVSAVPIYRITYWDYLGRRQAWRTHWFGGSEDEQKARAESLAGDWGYHPRYEPVYAFSMKQRKYAS*
Ga0115008_1099344123300009436MarineVIFIIDFYKKKKKLEMVFHITNYMRETNTWMIRKMRWIFWGAGSFIPLYRNFYWDYLGRRVAWKDSLSGKTEEDKKAEAIADRADWGFRPRYEGRLPFSIKTRAQA*
Ga0115570_1029414213300009496Pelagic MarineICYVYKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDQLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYET*
Ga0115569_1024494913300009497Pelagic MarineMIRKMRYILWGGVLATPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKAEAEKLSASWGYHPRYEPVYGFSLKARKYETQTETERVLDTPRLRPQGDQTFGHG*
Ga0115572_1044077813300009507Pelagic MarinePQNPKTPKPFLKKIICYVYKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDQLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYET*
Ga0115099_1017868313300009543MarineKKQKMVFHITNYMRETNVWMIRKMRWILWGGVAATPIYRNTYWDFLGRRVAWRDSLFGGTEEEKKKWAEDHSAAWGYVPRYEPVYSFSLKARKYEN*
Ga0115006_1040829313300009544MarineKKKLEMVFHITNYMRETNTWMIRKMRWIFWGAGSFIPLYRNFYWDYLGRRVAWKDSLSGKTEEDKKAEAIADRADWGFRPRYEGRLPFSIKTRAQA*
Ga0115101_109674913300009592MarineLNSSKTMVFHVTNYMRETNVWMIRKMRWILWGGVSMTPIYRCTYWDTLGRRTAWRDTLFGGTEEFKKEKAEDLKANWGYKPRYDPVYDFSLKNQKYAG*
Ga0115101_115275623300009592MarineMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEDEKKEKAEKSSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL*
Ga0115101_170551913300009592MarineLNKKQKMVFHITNYMRETNVWMIRKMRWILWGGVAATPIYRNTYWDFLGRRVAWRDSLFGGTEEEKKKWAEDHSAAWGYVPRYEPVYSFSLKARKYEN*
Ga0115103_147295113300009599MarineIKLKMVFHVTNYMRETNVWMIRKCRWILWGGVAATPLYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET*
Ga0115103_155687213300009599MarineVFHVTNYMRETNVWMIRKMRWILWGLVAATPIYRNTYWDYLGRRVAWRDHFGFWGTEEEKKAEAESRIGEWGYKPRYEPVYEFSLKARKYETQTDVEKVSDTPRLSPVGN*
Ga0115102_1005262013300009606MarineIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYET*
Ga0115102_1035943113300009606MarineLFEAKAKMVFHITNYMRETNTWMIRKMRWMFWCTFGFVPVYRNVYWDYLGRRVAWKDSLSGKSEADRAAEADEQRANWGYRPRYEGKYDFSIKSRIQA*
Ga0115100_1048550213300009608MarineLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYET*
Ga0115100_1094890723300009608MarineNSSKTMVFHVTNYMRETNVWMIRKMRWILWGGVSMTPIYRCTYWDTLGRRTAWRDTLFGGTEEFKKEKAEDLKANWGYKPRYDPVYDFSLKNQKYAG*
Ga0115100_1124299923300009608MarineTNYMRETNVWMIRKMRWILWGGVLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKASAEERRADWGYHPRYEAKYDFSLKTRKYAQ*
Ga0115001_1053469213300009785MarineMVFHITNYMRETNVWMIRKMRWIFWAGVISTPVYRLTYWDTLNRRVAWKDYLFGGSEADKKAHNEALIGNWGYHPRYEPNYDFSIKHQKYDT*
Ga0133913_1114018613300010885Freshwater LakeIIIILICKMVFHITNYMRETNVWMIRKMRWIFWSIGASVPIYRNTYWDYLGRRVAWRDSLSGKTEEQKREEAKALIGGWGYVPRFTPNTDYSIKARKYAL*
Ga0138265_124847713300012408Polar MarineIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYEV*
Ga0138266_144416213300012412Polar MarineVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYEV*
Ga0138258_105262813300012413Polar MarineFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYEV*
Ga0138259_134444213300012416Polar MarineWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYEV*
Ga0129328_113781823300012472AqueousVFHVTNYMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEAAEKNSASWGYHPRYEPVYGFSIKS*
Ga0129347_124815813300012504AqueousMNYMRETNVWMIRKMRWILWGTIGFIPFYRNTYWDFLGRRAAWRDSLSGKTEEEKRAEAEALRGNWGYHPRYEAKYDFSIKT*
Ga0129326_124774313300012522AqueousSIMVFHVTNYMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEAAEKNSASWGYHPRYEPVYGFSIKS*
Ga0129350_104161613300012523AqueousMVFHVMNYMRETNVWMIRKMRWMFWSLVWCVPIYRNVYWDYFGRRAAWRDSLFGGTDAEKKEWAESQRADWGFHPRYEPKYEFSIKAAKHA*
Ga0138257_119797013300012935Polar MarineGKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYEV*
Ga0163179_1190662613300012953SeawaterMVFHITNYMRETNVWMIRKMRWQLWGLVLAVPIFRITYWDMLGRRVAWRSHWFGGSEEDQRARAENLIGDWGYHPRYEPVYGFSLK*
Ga0129340_118760113300012963AqueousINMVFHVMNYMRETNVWMIRKMRWILWGTIGFIPFYRNTYWDFLGRRAAWRDSLSGKTEEEKRAEAEALRGNWGYHPRYEAKYDFSIKT*
Ga0129346_101095313300012965AqueousMVFHVMNYMRETNVWMIRKMRWILWGTIGFIPFYRNTYWDFLGRRAAWRDSLSGKTEEEKRAEAEALRGNWGYHPRYEAKYDFSIKT*
Ga0129346_114795813300012965AqueousMVFHVTNYMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKAKAEKDSASWGYNPRYEPVYDFSIKSRKYST*
Ga0129341_128759923300012966AqueousMNYMRETNVWMIRKMRWILWGTIGFIPFYRNTYWDFLGRRAAWRDSLSGKTEEEKRAEAEALRGNWGYHPRYEAKNDFSIKT*
Ga0182088_115647923300016703Salt MarshVFHITNYMRETNVWMIRKMRWLLWGMCLSTPIYRNTYWDFLGRRVAWRDSLGFWGTEEEKKAKSESLSASWGYHPRYEPVYGFSIKARKYSE
Ga0186577_10828713300016882Host-AssociatedEEMVFHVTNYMRETNVWAIRKVRWITWSLGLSIPIYRNTYWDYLGRRVAWKDSLGYYGDEDYKKKNNEELKANWGYTPRYDPVYWFSMKKRKY
Ga0186523_11259423300017166Host-AssociatedIKARMVFHITNYMRETNVWMIRKMRWILWGTFSFIPIYRNVYWDFLGRRVAWKDSLRGETEADKEAAAVADRADWGYTPRYEGKYDFSIKTKKQAEQTRE
Ga0186339_11375513300017210Host-AssociatedKIKARMVFHITNYMRETNVWMIRKMRWILWGTFSFIPIYRNVYWDFLGRRVAWKDSLRGETEAEKEAAAVADRADWGYTPRYEGKYDFSIKTKKQAEQTRE
Ga0186197_11757313300017238Host-AssociatedLRMVFHITNYMRETNVWMIRKMRWIFWGFVAFVPIYRVTYWDYLSRRVAWNTYFTAGSEEEQRKRAEEQRANWGYKPRYEPVYNFSIKARKYAL
Ga0181380_126383413300017782SeawaterMVFHVTNYMRETNVWMIRKMRYLLWGTFSFIPLYRNFYWDYLGRRVAWKDSLSGMSEDEKRAYWESRKADWGFHPRFEATLPFSLKTAKYAA
Ga0181584_1062235613300017949Salt MarshMVFHVTNYMRETNVWMIRKMRWMFWGLVWSGPFYRNTYWDYLGRRAAWRDHLFGGTEEEKIAQAESKRADWGFHPRYEPKYEFSIKTAKHAQ
Ga0181583_1009614613300017952Salt MarshMVFHVTNYMRETNVWMIRKMRWMFWGLVWSGPFYRNTYWDYLGRRAAWRDHLFGGTEEEKIAHAESKRADWGFHPRYEPKYEFSIKTAKHAQ
Ga0181566_1080546513300018426Salt MarshKAMVFHITNYMRETNVWMIRKMRWLLWGMCLSTPIYRNTYWDFLGRRVAWRDSLGFWGTEEEKKAKSESLSASWGYHPRYEPVYGFSIKARKYSE
Ga0188862_103004623300018622Freshwater LakeVFHVTNYMRETNVWMIRKMRWILWGTFGSIPFYRNTCWEYHGRRTAWKEKLTFMTEADKREAAEKERGDWGFHPRYEPKLDFSLKT
Ga0193355_102110823300018628MarineMVFHITNYMRETNVWMIRKMRWILWGFVLSTPIYRNTYWDYLGRRGAWRDSLGFYGTEAEKKAKAEENKADWGYHPRYEPKHDFSIKARKYESQTRLE
Ga0192889_105316713300018657MarineFHITNYMRETNVWMIRKMRWMFWSFFLFVPAYRNFYWDYLGRRVAWKDDLKTEDDKKAIAESHKGDWGFHPRYEAKYPFSIKT
Ga0192944_103537513300018692MarineHGGKYFSYKINKKMVFHVTNYMRETNVWMIRKMRWIFWTGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0192883_106185613300018759MarineFHITNYMRETNVWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLISEEDKKANAEALRADWGFNPRYLSKYDFSIKTQKYAS
Ga0192949_110745713300018831MarineKKMVFHVTNYMRETNVWMIRKMRWIFWTGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0193253_111000323300018846MarineKKQKMVFHITNYMRETNVWMIRKMRWILWGGVAATPIYRNTYWDFLGRRVAWRDSLFGGTEEEKKKWAEDHSAAWGYVPRYEPVYSFSLKARKYEN
Ga0192977_108801523300018874MarineMVFHVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAEKDSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL
Ga0192977_109597023300018874MarineKKKKMVFHVTNYMRETNVWMIRKMRWILWGAVASTPFYRNTYWDFLGRRVAWRDTLFGGTEEEKKKWAEDHSAAWGYVPRYEPVYSFSLKARKYET
Ga0192989_1014026213300018926MarineQKMVFHITNYMRETNVWMIRKMRWILWGGVAATPIYRNTYWDFLGRRVAWRDSLFGGTEEEKKKWAEDHSAAWGYVPRYEPVYSFSLKARKYEN
Ga0192961_1021030313300018980MarineMVFHVTNYMRETNVWMIRKMRWIFWTGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0192947_1017500813300018982MarineTWGKYFSYKINKKMVFHVTNYMRETNVWMIRKMRWIFWTGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0192947_1025295623300018982MarineMVFHVTNYMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEAEKKEKAEKDSANWGYHPRYEPVYDFSIKGRKYSSQTDLEKL
Ga0193017_1018581433300018983MarineMGISYCIYNRKKMVFHVTNYMRETNVWMIRKMRWIFWGGVMSTVIYRNTYWDYLGRRVAWKERLGWYGDDDEKMKFSKKWKADWGYMPRYVPAYDFSIKARKRVGETDA
Ga0193196_1028604313300019007MarineMVFHIMNYMRETNVWMIRKMRWMFWGFFGFVPMYRNFYWDYLGRRVAWKDSLSGKTEADRQAEAEAARADWGFTPRYEGKYDFSIKTRKQ
Ga0192880_1016520213300019009MarineWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLISEEDKKANAEALRADWGFNPRYLSKYDFSIKTQKYAS
Ga0193569_1029062113300019017MarineRKEEEEYSRAMVFHIMNYMRETNVWMIRKMRWIFWGFFGFVPMYRNFYWDYLGRRVAWKDSLSGKTDADRQAEAEAARADWGFTPRYEGRYDFSIKTRKH
Ga0193569_1031409413300019017MarineMVFHITNYMRETNTWMIRKMRWIFWCTFGALPFYRNVYWDYLGRRVAWKDSMSGMTEDEKKAQAESERADWGFHPRYEGKYPFSIKTRKQA
Ga0193569_1035624013300019017MarineMVFHITNYMRETNVWMIRKMRWMFWSFFLFVPAYRNFYWDYLGRRVAWKDDFKGTEDEKRKAAEDLKGDWGFHPRYEAKYPFSIKTRKYA
Ga0193555_1025170523300019019MarineHTMVFHITNYMRETNVWMIRKMRWMFWSFFLFVPMYRNFYWDYLGRRVAWKDDFQGTDKEKREKAEAEKADWGFHPRYEAKYPFSIKT
Ga0192982_1022573313300019021MarineMVFHVTNYMRETNVWMIRKMRWILWGAVASTPFYRNTYWDFLGRRVAWRDTLFGGTEEEKKKWAEDHSAAWGYVPRYEPVYSFSLKARKYET
Ga0192875_1015480023300019035MarineLIKMVFHITNYMRETNVWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLISEEDKKANAEALRADWGFNPRYLSKYDFSIKTQKYAA
Ga0192945_1013369313300019036MarineMVFHVTNYMRETNVWMIRKMRWILWIGVASTPIYRCTYWDTFGRRAAWRDKLFGGTEEFKKDKAEDLRANWGYKPRYDPVYDFSLKN
Ga0192945_1018976423300019036MarineMVFHVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEDEKKEKAEKSSASWGYHPRYEPVYGFSLKARKYSTQTDSEKL
Ga0192945_1026885913300019036MarineTNYMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEAEKKEKAEKDSANWGYHPRYEPVYDFSIKGRKYSSQTDLEKL
Ga0193123_1020595913300019039MarineMVFHVTNYMRETNVWMIRKMRWILWGMVSATPIYRCTYWDYLNRRVAWRTYYFGGTEDEKKAHAESLIGNWGYKPRYEPVYDFSLKNKKYEG
Ga0192981_1019244713300019048MarineMVFHIMNYMRETNVWMIRKMRWIFWGGVLSTPFYRITYWDFLGRRTAWKRHYFGGTPEEQQEFAESKKADWGFTPRYEPSIDFSIKA
Ga0192981_1023655813300019048MarineMGVYKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGQWGYHPRYEPVYGFSLKARKYET
Ga0192981_1023710313300019048MarineNVWMIRKTRWIFWGGVLATPFYRITYWDFLGRRTAWRRSLFGGTPEEQQAAAEAKKADWGFTPRYEPSIDFSIKA
Ga0192981_1024854413300019048MarineMGVYKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0192981_1026342813300019048MarineMGVYKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYEV
Ga0192966_1017514813300019050MarineMVFHVTNYMRETNVWMIRKMRYILWIGVASTPIYRCTYWDTFGRRAAWRDTLFGGTEEFKKDKAEGLVANWGYKPRYDPVYDFSLKN
Ga0188866_102874123300019095Freshwater LakeMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEAAEKNSASWGYHPRYEPVYGFSIKS
Ga0192946_103967913300019103MarineHGGKYFSYKIKKKMVFHVTNYMRETNVWMIRKMRWIFWTGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0192980_106784913300019123MarineTWGKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0192980_107002713300019123MarineTWGKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGQWGYHPRYEPVYGFSLKARKYET
Ga0193249_112733713300019131MarineHITNYMRETNVWMIRKMRWILWGGVLATPIYRNTYWDYLGRRVSWRDSLGFWGTEEEKKAKAEETKANWGYHPRYEAKYDFSIKTRKYET
Ga0192888_1020799613300019151MarineNTMVFHITNYMRETNVWMIRKMRWMFWSFFLFVPAYRNFYWDYLGRRVAWKDDLKTEDDKIAHAESHKGDWGFHPRYEAKYPFSIKT
Ga0182097_122780223300019261Salt MarshNYMRETNVWMIRKMRWLLWGMCLSTPIYRNTYWDFLGRRVAWRDSLGFWGTEEEKKAKSESLSASWGYHPRYEPVYGFSIKARKYSE
Ga0182073_105411123300019274Salt MarshVFHVTNYMRETNVWMIRKMRWMFWGLVWSGPFYRNTYWDYLGRRAAWRDHLFGGTEEEKIAHAESKRADWGFHPRYEPKYEFSIKTAKHAQ
Ga0182067_140162913300019276Salt MarshKIMVFHVTNYMRETNVWMIRKMRWILWGCIGAVPFYRNTYWDFLGRRVAWRDSLGFWGTEEEKKVKAEELRANWGYHPRYEPVYGFSI
Ga0181562_1039379313300019459Salt MarshMVFHITNYMRETNVWMIRKMRWLLWGMCLSTPIYRNTYWDFLGRRVAWRDSLGFWGTEEEKKAKSESLSASWGYHPRYEPVYGFSIKARKYSE
Ga0194113_1111365013300020074Freshwater LakeMRETNVWMIRKMRWIFWSLGLGIPFYRNTYWDYLGRRVAWRDHLFGGTEAEKQAWAESKRADWGYHPRYEPKLDFSIKT
Ga0196977_104019923300020146SoilMVFHITNYMRETNVWMIRKMRWILWGGVAFVPLYRNFYWDYHGRRVAFKKWWYGLSEAQLREQAENSKADWGYHPRY
Ga0211734_1023981713300020159FreshwaterMVFHISNYMRETNVWMIRKCRWIFWSLGASVPIYRNTYWDFLGRRVAWKDYYAGTEEEKKAQAEAKRANWGFNPRYEAKYDFSIKTQKYA
Ga0181578_1046829123300020189Salt MarshMVFHVTNYMRETNVWMIRKMRWMFWGLVWSGPFYRNTYWDYLGRRAAWRDHLFGGTEEEKIAHAESKRADWGFHPRYEPRYEFSIKTAKHAQ
Ga0194128_1014988213300020197Freshwater LakeMNYMRETNVWMIRKMRWIFWSLALGIPFYRNTYWDYLGRRVAWRDHLFGGTEAEKQAWAESKRADWGYHPRYEPKLDFSIKTQKYAQ
Ga0208853_100562553300020546FreshwaterMVFHVTNYMRETNVWMIRKMRWIFWSIGASVPIYRNTYWDYLGRRVAWRDSLSGKTEEQKREEAEALIGGWGYVPRFTPNTDYSIKARKYAL
Ga0194126_1037094813300020603Freshwater LakeMVFHIMNYMRETNVWMIRKMRWIFWSLALGIPFYRNTYWDYLGRRVAWRDHLFGGTEAEKQAWAESKRADWGYHPRYEPKLDFSIKTQKYAQ
Ga0196978_104873613300021067SoilMRETNVWMIRKMRWILWGGVAFVPLYRNFYWDYHGRRVAFKKWWYGLSEAQLREQAENSKADWGYHPRY
Ga0214162_106372913300021108FreshwaterFNKRMVFHISNYMRETNVWMIRKCRWIFWGLGASVPFYRNTYWEFLGRRVAWKDHYSGTEEEKRAQAEAKRADWGFHPRYEAKYNFSIKT
Ga0206687_199473513300021169SeawaterIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0206692_109847623300021350SeawaterMVFHITNYMRETNTWMIRKSRWIMYCTFGSVPFYRNTYWDYLGRRVAWKEYFDGKTEAEKIDEADSARADWGYKPRYTPVYDFSIK
Ga0206690_1046390923300021355SeawaterRETNVWMIRKMRWILWGGVAAVPLYRCVYWDFLGRRVAWRDSLGFWGSEEDKKNKAEELRANWGYHPRYEPVYNFSIKSKKYETQTDEEVVNDTPRLSPYGTLRAKK
Ga0206123_1024419313300021365SeawaterMVFHVTNYMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEAAEKNSASWGYHPRYEPVYGFSIKS
Ga0063090_107216313300021890MarineHVTNYMRETNVWMIRKMRWIFWSIALSVPIYRNVYWDYLGRRSAWRERFSTMTEEEKRAKAESERTNWGYNPRYTPVHDFSIKKRI
Ga0063096_106484513300021925MarineVFHITNFMRETNTWMIRKMRWILWGTFSFVPIYRNVYWDFLGRRVAWKDSMSGKDEAQKEAEAGNDRADWGYHPRYEGKLDFSIKTRK
Ga0063103_103071913300021927MarineIKLKMVFHVTNYMRETNVWMIRKCRWILWGGVAATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0063102_100946913300021941MarineIKLKMVFHVTNYMRETNVWMIRKCRWILWGGVAATPFYRCTYWDYLGRRVAWRDHLGFWGTEEXKKIKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0063101_105608613300021950MarineVFHVTNYMRETNVWMIRKCRWILWGGVAATPFYRCTYWDYLGRRVAWRDHLGFWGTEEEKKIKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0222713_1052197813300021962Estuarine WaterMVFHVTNYMRETNVWMIRKMRWILWGAVSFVPIYRNTYWDFLGRRVAWRDYFGTWGNEEQKKAEAERLSANWGYKPRYEPVYAFSIKSRKYEEQTDMEKVMDTPRMHNSG
Ga0209306_113130813300025680Pelagic MarineMVFHVTNYMRETNVWMIRKMRWILWGVCLSTPIYRNTYWDFLGRRVAWRDSLGFWGTEAEKKEKAEKDSANWGYHPRYEPVYDFSIKSRKYSSQTDLEKL
Ga0209602_115251313300025704Pelagic MarinePKTPKPLLKKIICYVYKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDQLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYET
Ga0209308_1029458613300025869Pelagic MarineMVFHVTNYMRETNVWMIRKMRWILWGMVSSVPIYRNTYWDYLGRRVAWRDSLGFWGTEEDKKEKAESLRANWGYNPRYEPVYDFSIKSRKYETQTDLEKV
Ga0208763_100952913300026136MarineMVFHVSNYMRETNVWMIRKMRWMLWGLVGGVPFYRGTYWDFLGRRVAWRDHLFGGTEQEKKEYNESLKANWGYVQRYEPVY
Ga0209467_118042023300027719FreshwaterMVFHITNYMRETNVWMIRKMRWILWGGCLSLPLYRNFYWDFIGRRVVLKDYLSGMTEEDKRNDAIEKRANWGYKPRYEPIYNFSLKTRKYAL
Ga0209279_1027288613300027771MarineMVFHIMNYMRETNVWMIRKMRWIFWGGVLATPFYRITYWDFLGRRTAWRRSLFGGTPEEQQAAAEAKKADWGFTPRYEPSIDFSIKA
Ga0209175_1022912223300027781Wastewater EffluentMVFHITNYMRETNVWMIRKMRWMLWGFVSFIPIYRNVYWDYHGRRVAWKKWFAGKSEDEQRQEAESLRAGWGYKPRYEPVYDFSLKKSKYDT
Ga0209830_1023176713300027791MarineMVFHITNYMRETNVWMIRKMRWIFWAGVISTPVYRLTYWDTLNRRVAWKDYLFGGSEADKKAHNEALIGNWGYHPRYEPNYDFSIKHQKYDT
Ga0209302_1028013123300027810MarineMVFHVCNYMRETNVWMIRKMRWIFWTCGAALPIYRNVYWDYLSRRVAWKDAWSGKTEDEKKADAEAERADWGYHPRFEGRLPFSIKTRAQA
Ga0209302_1056307523300027810MarineMVFHIQNYMRETNTWMIRKGRWIFWTLGGSVPFYRNTYWDYLGRRVAWKEYFNGKTEEERIAEAESEKANWGYRPRYAPVHEFSIK
Ga0209092_1008590263300027833MarineMVFHVTNYMRETNVWMIRKMRWIFWSIALSVPIYRNVYWDYLGRRSAWRERFSTMTEEEKRAKAESERTNWGYNPRYTPVHDFSIKKRI
Ga0209712_1044280513300027849MarineMVFHVTNYMRETNVWMIRKCRWILWGGVAATPFYRCTYWDYLGRRVAWRDHLGFWGTEEEKKIKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0209066_1049857323300027851WatershedsFHITNYMRETNVWMIRKMRWMLWGFVGFIPMYRNFYWDYIGRRVALKKWIAGKSEDEQRQEAESVRANWGYKPRYEPVYEFSLKRHKYD
Ga0209668_1006162213300027899Freshwater Lake SedimentMVFHITNYMRETNVWMIRKMRWIFWSIGASVPIYRNTYWDYLGRRVAWRDSLSGKTEEQKREEAEALIGGWGYVPRFTPNTDYSIKARKYAL
Ga0209668_1121672523300027899Freshwater Lake SedimentTNYMRETNVWMIRKMRWIFWSLGLSIPIYRNTYWSYLGRRSAWRDDFTSEEDKKKEAQEQRADWGYHPRFEPHLDFSIKARK
Ga0209284_1029735913300027983FreshwaterMVFHVTNYMRETNVWMIRKARWIFWSLGALIPAYRNFYWDYLGRRVAWKDYWSGKTDEQKQAEAEAIRADWGYKPRYTPSIDFSIKNRKHAEQTREERMADHPRIVTGH
Ga0256412_125345113300028137SeawaterMVFHITNYMRETNVWMIRKMRWIFWGGVMATPIYRCTYWDTLNRRVAWKDRFFDGTEEEKKKYNEDRIGNWGYHPRYEPNYDFSLKH
Ga0256412_140561423300028137SeawaterWMIRKMRWILWGGVLATPIYRNTYWDYLGRRVAWRDSLGFWGTEQEKKAKAEEDSASWGYHPRYEPVYGFSLKSRKYEN
Ga0256417_117940013300028233SeawaterKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0256413_129858713300028282SeawaterMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0247572_118324413300028290SeawaterNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEDEKKEKAEKSSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL
Ga0247566_108318913300028335SeawaterETNVWMIRKMRWMLWLGVGAVPIFRNTYWDFLGRRVAWRTHLGMWGTEEEMKASAEERKGMWGYVPRYEPKYNFSIKNQRYS
Ga0311369_1126432913300029910PalsaMVFHITNYMRETNVWMIRKMRWMLWGFVGFIPAYRNFYWDYLGRRVAFRDYYFGGSEESKKERAESLRADWGYKRRYEPVYAFSLKSKKYET
Ga0247630_114162113300030599SoilVFHVTNYMRETNVWMIRKMRWMLWGFVGFIPIYRNVYWDYLGRRVAWKSYWSGKSEDQKKHEAELARANWGYKPRYEPVYDFSIKRARYDE
Ga0210253_1078337813300030603SoilFHVTNYMRETNVWMIRKMRWMLWGLVGFVPVYRNVYWDYHGRRVAVKKWFAGKTEKEQKEEAESKRANWGYIPRYEPIYEFSLKK
Ga0210259_1058009413300030625SoilVTNYMRETNVWMIRKMRWILWGGVGFIPLYRNFYWDYIGRRVALKDWLYGGTEKQKKENAEAERANWGYKPRYEPVYPFSIKS
Ga0210259_1082967513300030625SoilFHVTNYMRETNVWMIRKMRWLLWGMCSSVPLYRNFYWDYHSRRVVFKDWLAGKTEEQKKQDAENLKGMWGYKPRYEPVLDFSLKKVKHDS
Ga0210291_1118514913300030626SoilWILWGGVGFIPLYRNFYWDYIGRRVALKDWLYGGTEKQKKENAEAERANWGYKPRYEPVYPFSIKSQKYGQQTVEEHFADVPRLRT
Ga0210291_1132086013300030626SoilMVFHVTNYMRETNVWMIRKMRWIFWGFVGSIPIYRNTYWDYHGRRVAWKNWWFSATGGTEKQIKEEAENKRANWGYKQRYEPVYDFSLKKARYE
Ga0307398_1057275423300030699MarineLSKMVFHISNYMRETNVWMIRKLRFVFWGIAFSPIIYRNTYWDYLGRRNAWRDYYFGGTEQEKIDYAESKRADWGFTPRY
Ga0307400_1087845813300030709MarineKKKMVFHVTNYMRETNVWMIRKMRWILWGAVASTPFYRNTYWDFLGRRVAWRDTLFGGTEEEKKKWAEDHSAAWGYVPRYEPVYSFSLKARKYET
Ga0307400_1095206823300030709MarineLIMVFHVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAEKDSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL
Ga0265462_1173637613300030738SoilVTNYMRETNVWMIRKMRWLLWGFVGFIPAYRNFYWDYLGRRVALKDWLLGGTEEAKKEKAESLRANWGYKPRYEPVYDFSLKARKYENQTKEEYY
Ga0265459_1330588613300030741SoilVFHVTNYMRETNVWMIRKMRWIFWGLVGSIPIYRNTYWDYHGRRVAWKNWWFSTTGGTEKDSKEIAEKMRANWGYKPRYEPIYDFSLKK
Ga0265459_1330963513300030741SoilITNYMRETNVWMIRKMRWIFWGFVGSIPIYRNTYWDYHARRVAWKNWWFGVTGGTEKDKKEEAERLRANWGYHPRYEPVYEFSLKKAKYNS
Ga0265459_1332395323300030741SoilHITNYMRETNVWMIRKMRWILWGIVLSIPLYRNTYWDFLGRRVAWRNYLDWRTPAQKEEAAKAMKADWGYHPRYTPKYEFSIKAQKYAHQTDAERIADTPRLHT
Ga0265461_1310414723300030743SoilWMIRKMRWLLWGMVGFIPAYRNFYWDYLGRRAALWEYLFEGSEQNKKDKAESLRANWGYKPRYEPVYDFSIKNQRYAS
Ga0074021_143757313300030775SoilHVTNYMRETNTWMIRKMRWLLWGLVGFIPLYRNFYWDFLGRRVAWKSYFNRQSDDEKREEADRLRADWGYHPRYTPVYNFSLKQRKYD
Ga0074020_1000081713300030840SoilFHVTNYMRETNTWMIRKMRWLLWGLVGFIPLYRNFYWDFLGRRVAWKSYFNRQSDDEKREEADRLRADWGYHPRYTPVYNFSLKQRKYD
Ga0074020_1128307413300030840SoilTNFMRETNTWMIRKMRWLLWGFVGFIPAYRNFYWDYLGRRVAWKAYFNRQSDDEKREEADTLRADWGYHPRYTPVYNFSLK
Ga0074026_1073545813300031035SoilWMIRKMRWLLWGFVGFIPAYRNFYWDYLGRRVAWKAYFNRQSDDEKREEADTLRADWGYHPRYTPVYNFSLK
Ga0170824_11415870613300031231Forest SoilRVTNYMRETNVWMIRKMRYILWGLCGSVPAYRNFYWDYQSRRVVFKDWLAGKTEEEKRAESESLKGMWGYKPRYEPVLDFSIKA
Ga0307388_1110923613300031522MarineIKKKMVFHVTNYMRETNVWMIRKMRWIFWTGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0307388_1119617413300031522MarineKMVFHITNYMRETNVWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLISEEDKKANAEGLKADWGFNPRYVTKYDFSIKTQKYAA
Ga0307489_1003900533300031569Sackhole BrineMNYMRETNTWMIRKMRWIFWGIVLAVPIYRNTYWDYLGRRVAWRDHLFGGTEAERIQWAESKRADWGFKARYESKYDFSIKKQKYAE
Ga0307489_1059015833300031569Sackhole BrineMVFHVTNYMRETNVWMIRKMRWIFWGLVSAVPIYRNTYWDFLGRRVAWRDYFGMWGTEDEKKVKAEKDMANWGYHPRYEPVYSFSLKSRKYESQTDL
Ga0307993_103933133300031602MarineMVFHITNYMRETNVWMIRKMRWIFWSVFAFVPLYRNFYWDYLGRRVAWKDDFKGTPEEKRAYAESLKGDWGFHPRYDAKYPFSIKTRKYAE
Ga0302125_1016780413300031638MarinePKPQNPCGSILEVIIINKISKKDEMVFHITNYMRETNTWMIRKMRWILWGTFSFVPIYRNVYWDFLGRRVAWKDSMSGKDEAQKEAEAGNDRADWGYHPRYEGKLDFSIKTRK
Ga0307386_1057466413300031710MarineIKLKMVFHVTNYMRETNVWMIRKCRWILWGGVAATPFYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0307386_1059063723300031710MarineVFHISNYMRETNVWMIRKLRFVFWGMAFSPIIYRNTYWDYLGRRNAWRDYYFGGTEQEKIDYAESKRADWGFTPRY
Ga0307396_1042588823300031717MarineNMVFHVTNYMRETNVWMIRKMRYILWIGVASTPIYRCTYWDTFGRRAAWRDTLFGGTEEFKKDKAEGLVANWGYKPRYDPVYDFSLKN
Ga0307381_1031779613300031725MarineNKLSKMVFHISNYMRETNVWMIRKLRFVFWGMAFSPIIYRNTYWDYLGRRNAWRDYYFGGTEQEKIDYAESKRADWGFTPRY
Ga0307391_1065871913300031729MarineKIKKKMVFHVTNYMRETNVWMIRKMRWIFWGGVITTPIYRLTYWDTLNRRVAWKDYLFGGTEADKKAHNESLIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0307397_1034065213300031734MarineIRLNMVFHVTNYMRETNVWMIRKMRYILWIGVASTPIYRCTYWDTFGRRAAWRDTLFGGTEEFKKDKAEGLVANWGYKPRYDPVYDFSLKN
Ga0307397_1037234513300031734MarineMVFHVTNYMRETNVWMIRKMRWIFWGGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0307397_1051896313300031734MarineMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGQWGYHPRYEPVYGFSLKARKYET
Ga0307397_1052495813300031734MarineITNYMRETNCWMIRKMRWILWGGVTAIPIYRNTYWDFLGRRVAWRDHLGFWGTEKEKKEISESLKGNWGYHPRYEPVYSFSLKARKYATQTDMEKVMDTPRLGTGDADF
Ga0307394_1040651123300031735MarineNVWMIRKLRFVFWGIAFSPIIYRNTYWDYLGRRNAWRDYYFGGTEQEKIDYAESKRADWGFTPRY
Ga0307394_1040795413300031735MarineLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYEV
Ga0307387_1104673513300031737MarineHVTNYMRETNVWMIRKMRWIFWTGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0307384_1047746213300031738MarineKMVFHVTNYMRETNVWMIRKCRWILWGGVAATPFYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0307383_1053793413300031739MarineLSKMVFHISNYMRETNVWMIRKLRFVFWGMAFSPIIYRNTYWDYLGRRNAWRDYYFGGTEQEKIDYAESKRADWGFTPRY
Ga0307383_1058696713300031739MarineNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKSRKYET
Ga0307395_1051003913300031742MarineKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYEV
Ga0307382_1060822713300031743MarineMIRKMRWIFWTGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0335396_1050775713300032462FreshwaterMVFHVTNYMRETNVWMIRKMRWILWGAVGATPIYRNVYWDFLGRRVAWRDHLGFWGTEEEKKVKAEQDRAEWGYHPRYEPKYSFSLKTRKYS
Ga0314670_1053350023300032470SeawaterKNMVFHVTNYMRETNVWMIRKMRWIFWGGVISTPIYRLTYWDTLNRRVAWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0314670_1057457223300032470SeawaterFHVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAEESSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL
Ga0314675_1056664813300032491SeawaterLIMVFHVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAEESSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL
Ga0314688_1052495613300032517SeawaterNMVFHVTNYMRETNVWMIRKMRWIFWGGVISTPIYRLTYWDTLNRRVAWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0314689_1060607213300032518SeawaterFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDQLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYET
Ga0314667_1079420113300032520SeawaterTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAEESSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL
Ga0314682_1058795813300032540SeawaterLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDQLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYET
Ga0314671_1051740313300032616SeawaterKKNMVFHVTNYMRETNVWMIRKMRWIFWGGVISTPIYRLTYWDTLNRRVAWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0314671_1060571513300032616SeawaterKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDQLGFWGTEEEKKLKAEADRGNWGYHPRYEPVYGFSLKARKYET
Ga0314671_1070583913300032616SeawaterVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAEESSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL
Ga0314685_1064125723300032651SeawaterVWMIRKMRWIFWGGVISTPIYRLTYWDTLNRRVAWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0314678_1038366213300032666SeawaterMVFHVTNYMRETNVWMIRKMRWIFWGGVISTPIYRLTYWDTLNRRVAWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0314669_1051789713300032708SeawaterIKKNMVFHVTNYMRETNVWMIRKMRWIFWGGVISTPIYRLTYWDTLNRRVAWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0314693_1056577523300032727SeawaterMVFHVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAEESSASWGYHPRYEPVYGFSLKARKYSTQTDLEKL
Ga0314696_1047790513300032728SeawaterTNYMRETNVWMIRKMRWIFWGGVISTPIYRLTYWDTLNRRVAWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0315741_1131772623300032739Forest SoilTNFMRETNVWMIRKMRWILWGCVGFIPLYRNFYWDYLGRRVAWKDYYKKGTEGDRIEEADRLRAAWGYHPRYEPVYSFSLKKQKYDQQTPEEYY
Ga0315741_1140548723300032739Forest SoilVTNFMRETNTWMIRKMRWLLWGFVGFIPAYRNFYWDYLGRRVAWKAYFNRQSDDEKREEADTLRADWGYHPRYTPVYNFSLK
Ga0314700_1076563523300032752SeawaterRWIFWGGVISTPIYRLTYWDTLNRRVAWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0314692_1050040713300032754SeawaterIKKNMVFHVTNYMRETNVWMIRKMRWIFWGGVISTPIYRLTYWDTLNRRVVWKDHFFGGTEEEKKAHNEALVGNWGYHPRYEPTYDFSIKHQRYDT
Ga0315742_1189475623300032756Forest SoilFRITNFMRETNVWMIRKMRWLLWGMVGSIPLYRNFYWDYLGRRVAWKDYYNRKTEAERIEEADRLRTGWGYHPRYEPVYSFSLKKQKYD
Ga0315742_1211188913300032756Forest SoilMVFHVTNFMRETNTWMIRKMRWLLWGFVGFIPAYRNFYWDYLGRRVAWKAYFNRQSDDEKREEADTLRADWGYHPRYTPVYNFSLK
Ga0307390_1077502413300033572MarineYKLKKKMVFHVTNYMRETNVWMIRKMRWIFWGGVITTPIYRLTYWDTLNRRVAWKDYLFGGTEADKKAHNESLIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0307390_1089865213300033572MarineNVWMIRKCRWIFWGAVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKLKAEGDKGNWGYHPRYEPVYGFSLKSRKYET
Ga0307390_1096534513300033572MarineKNKMVFHVTNYMRETNVWMIRKMRWIFWGGVITTPIYRLTYWDTLNRRVAWKDHFFGGTEEDKKAHNEALIGNWGYHPRYEPTYDFSIKHQRYDT
Ga0334977_0049841_397_6303300033978FreshwaterMIRKMRWIFWSIGASVPIYRNTYWDYLGRRVAWRDSLSGKTEEQKREEAEALIGGWGYVPRFTPNTDYSIKARKYAL
Ga0334989_0085057_65_2953300033984FreshwaterMVFHVTNYMRETNVWMIRKLRWIFWGLGASVPIYRNTYWDYLGKRVAWKDHFAGTDQEKREHAESKIGNWGFNPRY
Ga0334989_0425151_54_2843300033984FreshwaterMVFHISNYMRETNVWMIRKMRWIFWSFGLALPIYRNTYWDYLGRRVAWRDHYAGTEVEKQALAEQKIGNWGFNPRF
Ga0334990_0470561_22_3123300034068FreshwaterVLDTNIIFEEMVFHISNYMRETNVWMIRKCRWIFWSLGISVPFYRNTYWDFLGRRVAWKDHFAGTEVEKQALAESKRADWGFHPRYEAKYDFSIKT
Ga0334990_0507299_329_5893300034068FreshwaterMVFHISNYMRETNVWMIRKCRWIFWSLGISVPFYRNTYWDFLGRRVAWKDHYSGTEEEKRAQAEAKRADWGFHPRYEAKYDFSIKT
Ga0335035_0527269_339_5993300034105FreshwaterMVFHISNYMRETNVWMIRKCRWIFWGLGASVPFYRNTYWEFLGRRVAWKDHYSGTEEEKRAQAEAKRADWGFHPRYEAKYDFSIKT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.