Basic Information | |
---|---|
Family ID | F018868 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 232 |
Average Sequence Length | 38 residues |
Representative Sequence | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHP |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 232 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.61 % |
% of genes near scaffold ends (potentially truncated) | 97.41 % |
% of genes from short scaffolds (< 2000 bps) | 98.71 % |
Associated GOLD sequencing projects | 170 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (72.845 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (33.190 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.534 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.586 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 232 Family Scaffolds |
---|---|---|
PF01790 | LGT | 0.43 |
COG ID | Name | Functional Category | % Frequency in 232 Family Scaffolds |
---|---|---|---|
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 72.84 % |
All Organisms | root | All Organisms | 27.16 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004137|Ga0058883_1560048 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300005646|Ga0075040_1047931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 581 | Open in IMG/M |
3300007159|Ga0075020_160811 | Not Available | 800 | Open in IMG/M |
3300009233|Ga0103856_10047063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 763 | Open in IMG/M |
3300009239|Ga0103858_10079993 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
3300009239|Ga0103858_10146727 | Not Available | 607 | Open in IMG/M |
3300009581|Ga0115600_1126888 | Not Available | 825 | Open in IMG/M |
3300009582|Ga0115601_1055697 | Not Available | 805 | Open in IMG/M |
3300009584|Ga0115597_1209242 | Not Available | 823 | Open in IMG/M |
3300009587|Ga0115602_1058053 | Not Available | 759 | Open in IMG/M |
3300010143|Ga0126322_1234389 | Not Available | 819 | Open in IMG/M |
3300010188|Ga0127505_1008158 | Not Available | 819 | Open in IMG/M |
3300010200|Ga0127507_1121229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300010864|Ga0126357_1130340 | Not Available | 796 | Open in IMG/M |
3300010864|Ga0126357_1319870 | Not Available | 519 | Open in IMG/M |
3300010866|Ga0126344_1304343 | Not Available | 797 | Open in IMG/M |
3300010867|Ga0126347_1292628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
3300010876|Ga0126361_10555282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300011039|Ga0138593_127201 | Not Available | 789 | Open in IMG/M |
3300011054|Ga0138523_1089336 | Not Available | 783 | Open in IMG/M |
3300011078|Ga0138565_1144649 | Not Available | 770 | Open in IMG/M |
3300011081|Ga0138575_1094417 | Not Available | 706 | Open in IMG/M |
3300011082|Ga0138526_1073935 | Not Available | 667 | Open in IMG/M |
3300011086|Ga0138564_1013000 | Not Available | 806 | Open in IMG/M |
3300011086|Ga0138564_1035631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 803 | Open in IMG/M |
3300011087|Ga0138570_1208209 | Not Available | 707 | Open in IMG/M |
3300011120|Ga0150983_12427054 | Not Available | 650 | Open in IMG/M |
3300011282|Ga0138293_119078 | Not Available | 528 | Open in IMG/M |
3300011282|Ga0138293_140193 | Not Available | 641 | Open in IMG/M |
3300011305|Ga0138532_1140626 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300011340|Ga0151652_11889341 | Not Available | 824 | Open in IMG/M |
3300012212|Ga0150985_115087034 | Not Available | 722 | Open in IMG/M |
3300012411|Ga0153880_1060910 | Not Available | 831 | Open in IMG/M |
3300012778|Ga0138269_1011805 | Not Available | 814 | Open in IMG/M |
3300012778|Ga0138269_1201509 | Not Available | 786 | Open in IMG/M |
3300014839|Ga0182027_11560178 | Not Available | 647 | Open in IMG/M |
3300016702|Ga0181511_1025662 | Not Available | 816 | Open in IMG/M |
3300016750|Ga0181505_10277457 | Not Available | 683 | Open in IMG/M |
3300016750|Ga0181505_10553772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 811 | Open in IMG/M |
3300019155|Ga0184568_101668 | Not Available | 680 | Open in IMG/M |
3300019155|Ga0184568_103600 | Not Available | 685 | Open in IMG/M |
3300019158|Ga0184580_115786 | Not Available | 819 | Open in IMG/M |
3300019158|Ga0184580_118242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300019159|Ga0184574_115298 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300019161|Ga0184602_101214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 807 | Open in IMG/M |
3300019162|Ga0184597_111376 | Not Available | 812 | Open in IMG/M |
3300019162|Ga0184597_122214 | Not Available | 817 | Open in IMG/M |
3300019166|Ga0184595_122159 | Not Available | 1070 | Open in IMG/M |
3300019174|Ga0184579_115721 | Not Available | 645 | Open in IMG/M |
3300019177|Ga0184592_102058 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300019177|Ga0184592_108349 | Not Available | 581 | Open in IMG/M |
3300019177|Ga0184592_110327 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300019180|Ga0184578_123387 | Not Available | 706 | Open in IMG/M |
3300019181|Ga0184594_101545 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 803 | Open in IMG/M |
3300019182|Ga0184598_123876 | Not Available | 704 | Open in IMG/M |
3300019186|Ga0184588_104859 | Not Available | 806 | Open in IMG/M |
3300019186|Ga0184588_138553 | Not Available | 811 | Open in IMG/M |
3300019199|Ga0187789_1032302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300019240|Ga0181510_1055548 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300019242|Ga0181502_1172296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 921 | Open in IMG/M |
3300019250|Ga0187790_1452597 | Not Available | 507 | Open in IMG/M |
3300019260|Ga0181506_1094168 | Not Available | 752 | Open in IMG/M |
3300019260|Ga0181506_1278502 | Not Available | 804 | Open in IMG/M |
3300019260|Ga0181506_1329280 | Not Available | 752 | Open in IMG/M |
3300019265|Ga0187792_1162333 | Not Available | 507 | Open in IMG/M |
3300019268|Ga0181514_1332648 | Not Available | 799 | Open in IMG/M |
3300019268|Ga0181514_1586335 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300019270|Ga0181512_1153324 | Not Available | 820 | Open in IMG/M |
3300019270|Ga0181512_1202241 | Not Available | 810 | Open in IMG/M |
3300019275|Ga0187798_1449898 | Not Available | 806 | Open in IMG/M |
3300019278|Ga0187800_1060036 | Not Available | 748 | Open in IMG/M |
3300019278|Ga0187800_1691703 | Not Available | 805 | Open in IMG/M |
3300019284|Ga0187797_1295653 | Not Available | 837 | Open in IMG/M |
3300021273|Ga0210340_1044394 | Not Available | 805 | Open in IMG/M |
3300021855|Ga0213854_1022309 | Not Available | 805 | Open in IMG/M |
3300021855|Ga0213854_1310598 | Not Available | 611 | Open in IMG/M |
3300021857|Ga0213849_1218994 | Not Available | 804 | Open in IMG/M |
3300021858|Ga0213852_1143129 | Not Available | 588 | Open in IMG/M |
3300021858|Ga0213852_1285643 | Not Available | 552 | Open in IMG/M |
3300021861|Ga0213853_10377957 | Not Available | 816 | Open in IMG/M |
3300021861|Ga0213853_10695167 | Not Available | 702 | Open in IMG/M |
3300021929|Ga0213845_1047790 | Not Available | 554 | Open in IMG/M |
3300021929|Ga0213845_1091344 | Not Available | 593 | Open in IMG/M |
3300021938|Ga0213847_1093577 | Not Available | 552 | Open in IMG/M |
3300021938|Ga0213847_1112075 | Not Available | 589 | Open in IMG/M |
3300021938|Ga0213847_1172208 | Not Available | 731 | Open in IMG/M |
3300021938|Ga0213847_1191475 | Not Available | 561 | Open in IMG/M |
3300022154|Ga0213929_1010793 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 813 | Open in IMG/M |
3300022156|Ga0213934_1044752 | Not Available | 611 | Open in IMG/M |
3300022166|Ga0213932_1031484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 775 | Open in IMG/M |
3300022171|Ga0213857_1013455 | Not Available | 819 | Open in IMG/M |
3300022467|Ga0224712_10259154 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300022498|Ga0242644_1011523 | Not Available | 800 | Open in IMG/M |
3300022498|Ga0242644_1016969 | Not Available | 703 | Open in IMG/M |
3300022498|Ga0242644_1018187 | Not Available | 687 | Open in IMG/M |
3300022499|Ga0242641_1010390 | Not Available | 823 | Open in IMG/M |
3300022499|Ga0242641_1010774 | Not Available | 814 | Open in IMG/M |
3300022499|Ga0242641_1011423 | Not Available | 800 | Open in IMG/M |
3300022499|Ga0242641_1013615 | Not Available | 760 | Open in IMG/M |
3300022500|Ga0242643_105894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 804 | Open in IMG/M |
3300022500|Ga0242643_106015 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 800 | Open in IMG/M |
3300022501|Ga0242645_1007034 | Not Available | 833 | Open in IMG/M |
3300022501|Ga0242645_1007907 | Not Available | 800 | Open in IMG/M |
3300022505|Ga0242647_1013999 | Not Available | 749 | Open in IMG/M |
3300022506|Ga0242648_1015251 | Not Available | 924 | Open in IMG/M |
3300022507|Ga0222729_1021552 | Not Available | 766 | Open in IMG/M |
3300022510|Ga0242652_1034337 | Not Available | 595 | Open in IMG/M |
3300022510|Ga0242652_1051663 | Not Available | 521 | Open in IMG/M |
3300022511|Ga0242651_1011993 | Not Available | 822 | Open in IMG/M |
3300022511|Ga0242651_1012633 | Not Available | 809 | Open in IMG/M |
3300022511|Ga0242651_1040086 | Not Available | 554 | Open in IMG/M |
3300022513|Ga0242667_1010117 | Not Available | 845 | Open in IMG/M |
3300022522|Ga0242659_1091443 | Not Available | 591 | Open in IMG/M |
3300022523|Ga0242663_1035035 | Not Available | 828 | Open in IMG/M |
3300022523|Ga0242663_1036834 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300022525|Ga0242656_1035002 | Not Available | 819 | Open in IMG/M |
3300022525|Ga0242656_1035481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 815 | Open in IMG/M |
3300022525|Ga0242656_1060755 | Not Available | 674 | Open in IMG/M |
3300022525|Ga0242656_1062703 | Not Available | 667 | Open in IMG/M |
3300022527|Ga0242664_1032755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 882 | Open in IMG/M |
3300022527|Ga0242664_1040897 | Not Available | 816 | Open in IMG/M |
3300022527|Ga0242664_1040915 | Not Available | 816 | Open in IMG/M |
3300022531|Ga0242660_1148540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 612 | Open in IMG/M |
3300022532|Ga0242655_10099579 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 796 | Open in IMG/M |
3300022709|Ga0222756_1037741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 687 | Open in IMG/M |
3300022711|Ga0242674_1010861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 953 | Open in IMG/M |
3300022712|Ga0242653_1028708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 821 | Open in IMG/M |
3300022712|Ga0242653_1031072 | Not Available | 800 | Open in IMG/M |
3300022713|Ga0242677_1018085 | Not Available | 846 | Open in IMG/M |
3300022715|Ga0242678_1021537 | Not Available | 789 | Open in IMG/M |
3300022715|Ga0242678_1069293 | Not Available | 544 | Open in IMG/M |
3300022716|Ga0242673_1071814 | Not Available | 623 | Open in IMG/M |
3300022716|Ga0242673_1088709 | Not Available | 582 | Open in IMG/M |
3300022717|Ga0242661_1046366 | Not Available | 799 | Open in IMG/M |
3300022717|Ga0242661_1070336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 688 | Open in IMG/M |
3300022717|Ga0242661_1077636 | Not Available | 664 | Open in IMG/M |
3300022717|Ga0242661_1147811 | Not Available | 525 | Open in IMG/M |
3300022720|Ga0242672_1032387 | Not Available | 799 | Open in IMG/M |
3300022720|Ga0242672_1080874 | Not Available | 605 | Open in IMG/M |
3300022721|Ga0242666_1079477 | Not Available | 733 | Open in IMG/M |
3300022724|Ga0242665_10127975 | Not Available | 782 | Open in IMG/M |
3300022726|Ga0242654_10130982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 819 | Open in IMG/M |
3300023537|Ga0247541_100192 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1307 | Open in IMG/M |
3300023539|Ga0247555_101023 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 814 | Open in IMG/M |
3300023539|Ga0247555_101081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 804 | Open in IMG/M |
3300023542|Ga0247540_104197 | Not Available | 517 | Open in IMG/M |
3300023560|Ga0247514_113455 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300023561|Ga0247518_119893 | Not Available | 544 | Open in IMG/M |
3300023562|Ga0247516_113078 | Not Available | 801 | Open in IMG/M |
3300023669|Ga0247539_101232 | Not Available | 704 | Open in IMG/M |
3300023675|Ga0247533_102209 | Not Available | 746 | Open in IMG/M |
3300023680|Ga0247528_111068 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 624 | Open in IMG/M |
3300023690|Ga0247512_115366 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 716 | Open in IMG/M |
3300023690|Ga0247512_122926 | Not Available | 511 | Open in IMG/M |
3300023691|Ga0228704_108412 | Not Available | 802 | Open in IMG/M |
3300028329|Ga0210315_1031604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 678 | Open in IMG/M |
3300028654|Ga0265322_10044742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1260 | Open in IMG/M |
3300029911|Ga0311361_10020839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 12082 | Open in IMG/M |
3300030530|Ga0210264_1158356 | Not Available | 558 | Open in IMG/M |
3300030543|Ga0210289_1545031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 590 | Open in IMG/M |
3300030581|Ga0210270_1442212 | Not Available | 649 | Open in IMG/M |
3300030597|Ga0210286_1296790 | Not Available | 528 | Open in IMG/M |
3300030624|Ga0210251_10257416 | Not Available | 714 | Open in IMG/M |
3300030624|Ga0210251_11233875 | Not Available | 810 | Open in IMG/M |
3300030630|Ga0210282_10078278 | Not Available | 831 | Open in IMG/M |
3300030631|Ga0210279_10152997 | Not Available | 773 | Open in IMG/M |
3300030688|Ga0311345_10400769 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300030738|Ga0265462_10703979 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
3300030761|Ga0265722_103676 | Not Available | 627 | Open in IMG/M |
3300030762|Ga0265775_101093 | Not Available | 1236 | Open in IMG/M |
3300030762|Ga0265775_106172 | Not Available | 701 | Open in IMG/M |
3300030764|Ga0265720_1004017 | Not Available | 811 | Open in IMG/M |
3300030764|Ga0265720_1004838 | Not Available | 773 | Open in IMG/M |
3300030805|Ga0265756_104105 | Not Available | 813 | Open in IMG/M |
3300030806|Ga0265731_101148 | Not Available | 798 | Open in IMG/M |
3300030811|Ga0265735_101822 | Not Available | 821 | Open in IMG/M |
3300030812|Ga0265734_101656 | Not Available | 823 | Open in IMG/M |
3300030814|Ga0265741_118401 | Not Available | 540 | Open in IMG/M |
3300030816|Ga0265729_101015 | Not Available | 835 | Open in IMG/M |
3300030833|Ga0265736_101295 | Not Available | 818 | Open in IMG/M |
3300030834|Ga0265738_103441 | Not Available | 630 | Open in IMG/M |
3300030834|Ga0265738_104136 | Not Available | 592 | Open in IMG/M |
3300030835|Ga0265725_100957 | Not Available | 807 | Open in IMG/M |
3300030836|Ga0265767_104638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300030840|Ga0074020_11279682 | Not Available | 703 | Open in IMG/M |
3300030862|Ga0265753_1073693 | Not Available | 649 | Open in IMG/M |
3300030874|Ga0265742_1006571 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 826 | Open in IMG/M |
3300030876|Ga0265730_100892 | Not Available | 838 | Open in IMG/M |
3300030877|Ga0265777_108290 | Not Available | 737 | Open in IMG/M |
3300030882|Ga0265764_102887 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300030885|Ga0265743_109827 | Not Available | 651 | Open in IMG/M |
3300030886|Ga0265772_102624 | Not Available | 716 | Open in IMG/M |
3300030886|Ga0265772_105511 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 569 | Open in IMG/M |
3300030887|Ga0265733_101240 | Not Available | 825 | Open in IMG/M |
3300030913|Ga0265759_106615 | Not Available | 599 | Open in IMG/M |
3300030916|Ga0075386_12229700 | Not Available | 792 | Open in IMG/M |
3300030942|Ga0247549_103573 | Not Available | 582 | Open in IMG/M |
3300030976|Ga0265739_101665 | Not Available | 820 | Open in IMG/M |
3300030978|Ga0265757_102641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 831 | Open in IMG/M |
3300030982|Ga0265748_102464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 773 | Open in IMG/M |
3300031010|Ga0265771_1004870 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 833 | Open in IMG/M |
3300031024|Ga0265724_101058 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300031024|Ga0265724_101777 | Not Available | 691 | Open in IMG/M |
3300031030|Ga0074030_11030959 | Not Available | 556 | Open in IMG/M |
3300031040|Ga0265754_1007647 | Not Available | 793 | Open in IMG/M |
3300031057|Ga0170834_113961851 | Not Available | 785 | Open in IMG/M |
3300031064|Ga0102767_11351504 | Not Available | 782 | Open in IMG/M |
3300031090|Ga0265760_10124453 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 830 | Open in IMG/M |
3300031446|Ga0170820_10233898 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 1044 | Open in IMG/M |
3300031474|Ga0170818_108496656 | Not Available | 834 | Open in IMG/M |
3300031590|Ga0307483_1010951 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 799 | Open in IMG/M |
3300031592|Ga0310117_132010 | Not Available | 508 | Open in IMG/M |
3300031677|Ga0307480_1005093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia | 808 | Open in IMG/M |
3300031686|Ga0310119_117111 | Not Available | 811 | Open in IMG/M |
3300031814|Ga0247548_106182 | Not Available | 579 | Open in IMG/M |
3300031817|Ga0316046_103790 | Not Available | 802 | Open in IMG/M |
3300031826|Ga0316031_104983 | Not Available | 748 | Open in IMG/M |
3300031828|Ga0316043_127050 | Not Available | 590 | Open in IMG/M |
3300031828|Ga0316043_128014 | Not Available | 574 | Open in IMG/M |
3300031869|Ga0316030_109154 | Not Available | 565 | Open in IMG/M |
3300031870|Ga0316029_103074 | Not Available | 818 | Open in IMG/M |
3300031871|Ga0316036_104875 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 821 | Open in IMG/M |
3300031956|Ga0316032_103968 | Not Available | 701 | Open in IMG/M |
3300032028|Ga0316052_104075 | Not Available | 802 | Open in IMG/M |
3300032515|Ga0348332_10546682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 807 | Open in IMG/M |
3300032515|Ga0348332_10751166 | Not Available | 816 | Open in IMG/M |
3300032515|Ga0348332_13315498 | Not Available | 824 | Open in IMG/M |
3300032515|Ga0348332_14024083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 818 | Open in IMG/M |
3300032515|Ga0348332_14269220 | Not Available | 820 | Open in IMG/M |
3300034661|Ga0314782_053864 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 809 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 33.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.59% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 7.33% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.17% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.31% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 3.02% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.16% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.16% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.72% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.72% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.29% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.29% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.86% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.86% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.43% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.43% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.43% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.43% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.43% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.43% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007159 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009584 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010188 | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
3300010200 | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011039 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011054 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011282 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2012 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011305 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019155 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019158 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019159 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019162 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019166 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019174 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019180 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021929 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021938 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - EE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022154 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022166 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022171 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023537 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023542 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023560 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023561 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023669 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023675 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023690 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023691 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028329 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030530 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030543 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030581 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030594 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030597 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030630 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030631 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030761 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030764 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030806 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030811 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030812 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030816 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030833 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030834 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030835 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030840 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030876 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030887 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030913 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030942 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030976 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030978 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030982 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031024 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031030 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031064 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031817 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031826 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031869 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031870 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031871 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031956 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032028 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0058883_15600481 | 3300004137 | Forest Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKERVASAHPQI |
Ga0075040_10479312 | 3300005646 | Permafrost Soil | MRSRTSHAAKSGVGEHTARESEAPNVCAGKERVASAHPQI |
Ga0075020_1608111 | 3300007159 | Watersheds | MRPRALLAAVSGVGEHTARESEAPNVCAGKERVANAH |
Ga0103856_100470631 | 3300009233 | River Water | MRPKPLHAAVSSVGEHTARESEAPNVCAGKERVAHA |
Ga0103858_100799931 | 3300009239 | River Water | MRPKPLHAAVSSVGEHTARESEAPNVCAGKERVAHAH |
Ga0103858_101467271 | 3300009239 | River Water | MRPRSLHAAVSGVGEHTTRESEVPNVCAGKECVANTHPQVWPRDLKKVP |
Ga0115600_11268881 | 3300009581 | Wetland | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVANAHPQVWPR |
Ga0115601_10556971 | 3300009582 | Wetland | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVANAH |
Ga0115597_12092421 | 3300009584 | Wetland | MRPRALLAAVSGVGEHTARESEAPNVCAGKERVANAHPQVWP |
Ga0115602_10580531 | 3300009587 | Wetland | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVANAHP |
Ga0126322_12343891 | 3300010143 | Soil | MRPRSLLAAVSGVGEHTARESEAPNVCAGKERVANAHSQFW |
Ga0127505_10081581 | 3300010188 | Host-Associated | MRSKSSPAAKSGVGEHMARESEAPNICHGKERVASAHPQIW |
Ga0127507_11212291 | 3300010200 | Host-Associated | MRSITSHAAKSGVGEHTARESEAPNVCEGKECVASTHPH |
Ga0126357_11303401 | 3300010864 | Boreal Forest Soil | MRSITSHAAESGVGEHTARESEAPNVCEGKECVASTHLPWISWFSHR* |
Ga0126357_13198701 | 3300010864 | Boreal Forest Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKQCVASTHPQ |
Ga0126344_13043431 | 3300010866 | Boreal Forest Soil | MRSRTSHAAKSGVGKHAARESECAQCMPGKERVAN |
Ga0126347_12926281 | 3300010867 | Boreal Forest Soil | MRSITSHAAESGVGEHTARESEAPNVCEGKECVASTHP |
Ga0126361_105552822 | 3300010876 | Boreal Forest Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVA |
Ga0138593_1272011 | 3300011039 | Peatlands Soil | MRSRASHAAKSGVGEHTARESEAPNVCDGKERVASAH |
Ga0138523_10893361 | 3300011054 | Peatlands Soil | MRSRTSHSAKSGVGEHTARESEAPNVCDGKECVASTH |
Ga0138565_11446491 | 3300011078 | Peatlands Soil | MRSKTSPAAESGVGEHTARKSEAPNSVRWKERAANA |
Ga0138575_10944171 | 3300011081 | Peatlands Soil | MRPKHPHAAESRVGEHTARESEAPNSVRWKERAANA |
Ga0138526_10739351 | 3300011082 | Peatlands Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDGKERVANAH |
Ga0138562_11909971 | 3300011084 | Peatlands Soil | MRPKHPHAAESGVGEHTARESEAPNSVRWKERAANA |
Ga0138564_10130001 | 3300011086 | Peatlands Soil | MRSRASHAAKSGVGEHTARESEAPNVCDGKERVASAHP |
Ga0138564_10356312 | 3300011086 | Peatlands Soil | MRSKTSLAADSGVGEHIPRKRERPTMCDGKERVANA |
Ga0138570_12082091 | 3300011087 | Peatlands Soil | MRSRTSHAAKSGVGEHTARESECAQRCDGKERVANAH |
Ga0150983_124270542 | 3300011120 | Forest Soil | MRSTTSHAAKSGVGEHAARESEAPNACAGKERVANAQPQIWPWN |
Ga0138293_1190781 | 3300011282 | Watersheds | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVASAHP |
Ga0138293_1401931 | 3300011282 | Watersheds | MRPRALHAAVSGVGEHTARESEAPNVCAGKECVAS |
Ga0138532_11406261 | 3300011305 | Peatlands Soil | MRSRSSHAAKSGVGEHTARESEAPNVCAGKECVASTH |
Ga0151652_118893412 | 3300011340 | Wetland | MRLKPSPAAKSGVGEHAARESEAPNACEGKERVANAHPQIWPR |
Ga0150985_1150870341 | 3300012212 | Avena Fatua Rhizosphere | MRSKTSHAAKSGVGEHTARKSEAPNVCDGKERVANAHP |
Ga0153880_10609101 | 3300012411 | Freshwater Sediment | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVASAHPQVWPRD |
Ga0138269_10118052 | 3300012778 | Freshwater Lake | MRSRTSLAAKSGVGEYTARESEAPNVCDGKERVASAH |
Ga0138269_12015091 | 3300012778 | Freshwater Lake | MRSRSSHAAKSGVGEHTARESEAPNVCEGKECVASTH |
Ga0182027_115601781 | 3300014839 | Fen | MRPRALHAAVSGVGEHTARESEAPNVCAGKERVANAHPQVWPRDASP |
Ga0181511_10256621 | 3300016702 | Peatland | MRSRSSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQIW |
Ga0181505_102774571 | 3300016750 | Peatland | MRSRSSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQIWP |
Ga0181505_105537721 | 3300016750 | Peatland | MRSITSHAAESGVGEHTARESEAPNVCDGKECVASTHPQ |
Ga0184568_1016681 | 3300019155 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAH |
Ga0184568_1036001 | 3300019155 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHP |
Ga0184580_1157861 | 3300019158 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKERVASAHP |
Ga0184580_1182421 | 3300019158 | Soil | MRSKTSHAAKSGVGEHKARESESAQPCAVGKECVAST |
Ga0184574_1152981 | 3300019159 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCEGKECVASTHP |
Ga0184602_1012141 | 3300019161 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCDGKERVASAH |
Ga0184597_1113761 | 3300019162 | Soil | MRSRTSHAAKSGVGEHKARESESAQPCAVGKECVASTHP |
Ga0184597_1222141 | 3300019162 | Soil | MRSKTSHAAKSGVGEHKARESESAQPCAVGKECVASTHP |
Ga0184595_1221591 | 3300019166 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCEGKECVAS |
Ga0184579_1157211 | 3300019174 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCEGKECVAST |
Ga0184592_1020581 | 3300019177 | Soil | MRSKTSHAAKSGVGEHKARESESAQPCAVGKECVASTH |
Ga0184592_1083491 | 3300019177 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQIWPR |
Ga0184592_1103271 | 3300019177 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCAGKERVASAH |
Ga0184578_1233871 | 3300019180 | Soil | MRSKTSHAAKSGVGEHKARESESAQHCAIGKECVASTH |
Ga0184594_1015451 | 3300019181 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDGKERVASAHP |
Ga0184598_1238761 | 3300019182 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVASTHP |
Ga0184588_1048592 | 3300019186 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDGKERVASA |
Ga0184588_1385531 | 3300019186 | Soil | MRSRTSHAAKSGVGEHKARESESAQPCAVGKECVASTH |
Ga0187789_10323021 | 3300019199 | Peatland | MRPRALHAAVSGVGEHTARESEAPNVCAGKERVAHAHP |
Ga0181510_10555481 | 3300019240 | Peatland | MRPRASPAAKSGVGEHAARESECAQRMRHGKERVASAHPQ |
Ga0181502_11722961 | 3300019242 | Peatland | MRSRTSHAAKSGVGEHTARESEAPNVCAGKERVASAHPQ |
Ga0187790_14525971 | 3300019250 | Peatland | MRPRALHAAVSGVGEHTARESEAPNVCAGKERVAHAHPQ |
Ga0181506_10941681 | 3300019260 | Peatland | MRSKTSHAAKSGVGEHTARESEAPNVCAGKERVAS |
Ga0181506_12785021 | 3300019260 | Peatland | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVASTH |
Ga0181506_13292801 | 3300019260 | Peatland | MRSKSSPAAESGVGEHMARESEAPNICHGKERVASAH |
Ga0187792_11623331 | 3300019265 | Peatland | MRPRALHAAVSGVGEHTARESEAPNVCAGKERVAHAH |
Ga0181514_13326481 | 3300019268 | Peatland | MRSKSSPAAESGVGEHMARESEAPNICHGKERVAS |
Ga0181514_15863352 | 3300019268 | Peatland | MRSRTSLAAKSGVGEHTARESEAPNVCDGKERVAS |
Ga0181512_11533241 | 3300019270 | Peatland | MRSKSSPAAKSGVGEHMARESEAPNICHGKERVASAHPQIWP |
Ga0181512_12022411 | 3300019270 | Peatland | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVASTHP |
Ga0187798_14498981 | 3300019275 | Peatland | MRPRSSHAAVSGVGEHTARESEAPNVCAGKERVANAH |
Ga0187800_10600362 | 3300019278 | Peatland | MRSTTSHAAKSGVGEHAARESEAPNVCDGKERVASAHP |
Ga0187800_16917031 | 3300019278 | Peatland | MRPRSSHAAVSGVGEHTARESEAPNVCAGKERVANA |
Ga0187797_12956531 | 3300019284 | Peatland | MRPRSSHAAVSGVGEHTARESEAPNVCAGKERVANAHSQWKASRKKA |
Ga0210340_10443941 | 3300021273 | Estuarine | MRPRALHAAVSGVGEHTARESEAPNVCAGKERVANAH |
Ga0213854_10223091 | 3300021855 | Watersheds | MRPRSAHAALSGVGEHTARESEAPNVCAGKERVASAHP |
Ga0213854_13105981 | 3300021855 | Watersheds | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVASAHPQ |
Ga0213849_12189941 | 3300021857 | Watersheds | MRPRASHAAMSGVGEHTARESEAPNVCAGEERVASAHP |
Ga0213852_11431291 | 3300021858 | Watersheds | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVASAHPQVW |
Ga0213852_12856431 | 3300021858 | Watersheds | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVAST |
Ga0213853_103779572 | 3300021861 | Watersheds | MRPKSLHAAVSGVGEHTARESEAPNVCAGKERVANAHPP |
Ga0213853_106951671 | 3300021861 | Watersheds | MRPRALHAAVSGVGEHTARESEAPNVCAGKERVANAHP |
Ga0213845_10477901 | 3300021929 | Watersheds | MRPRALLAAVSGVGEHTARESEAPNVCAGKERVANAHP |
Ga0213845_10913441 | 3300021929 | Watersheds | MRPRALHAAVSGVGEHTARESEAPNVCAGKERVANAHPQVWPR |
Ga0213847_10935772 | 3300021938 | Watersheds | MRPRASHAAMSGVGEHTARESEAPNVCAGEERVASAHPQIW |
Ga0213847_11120751 | 3300021938 | Watersheds | MRSRTSHAAKSGVGEHTARESEAPNVCAGKECVASTHP |
Ga0213847_11722081 | 3300021938 | Watersheds | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVASAHPQVWPR |
Ga0213847_11914751 | 3300021938 | Watersheds | MRPRSAHAALSGVGEHTARESEAPNVCAGKECVASTHPQIW |
Ga0213929_10107931 | 3300022154 | Freshwater | MRSTTSHAAKSGVGEHRPAKARAPNVCAGKERVASAHP |
Ga0213934_10447521 | 3300022156 | Freshwater | MRPRSLHAAVSGVGEYTARESEAPNVYAGKERVASAHPH |
Ga0213932_10314841 | 3300022166 | Freshwater | MRPRHPPAAESGVGEHTARESEAPNVCAGKERVANA |
Ga0213857_10134551 | 3300022171 | Watersheds | MRPRALLAAVSGVGEHTARESEAPNVCAGKERVANAHPQVWPR |
Ga0224712_102591542 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVAS |
Ga0242644_10115232 | 3300022498 | Soil | MRSRTSHAAQSGVGEHTARESEAPNVCAGKECVASTH |
Ga0242644_10169691 | 3300022498 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDEKERVAS |
Ga0242644_10181871 | 3300022498 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECVASTHP |
Ga0242641_10103902 | 3300022499 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVASTHPH |
Ga0242641_10107741 | 3300022499 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVASTHPQL |
Ga0242641_10114231 | 3300022499 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVAN |
Ga0242641_10136151 | 3300022499 | Soil | MRTRTSHAAKSGVGEHTARESEAPNVCDGKERVASA |
Ga0242643_1058941 | 3300022500 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDGKECVAST |
Ga0242643_1060151 | 3300022500 | Soil | MRSRTSHAAKSGVGEHKARESESAQPCAVGKECVAS |
Ga0242645_10070342 | 3300022501 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVAST |
Ga0242645_10079071 | 3300022501 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECVAST |
Ga0242647_10139991 | 3300022505 | Soil | MRSIASHAAKSGVGEHTARESEAPNVCEGKECVASTH |
Ga0242648_10152511 | 3300022506 | Soil | MRSKTSHAAESGVGEHTARESEAPNVCDGKERVASA |
Ga0222729_10215521 | 3300022507 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKECVAST |
Ga0242652_10343371 | 3300022510 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECEASTH |
Ga0242652_10516631 | 3300022510 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVAS |
Ga0242651_10119931 | 3300022511 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVASTHPQLG |
Ga0242651_10126332 | 3300022511 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVAS |
Ga0242651_10400861 | 3300022511 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVANAHP |
Ga0242667_10101171 | 3300022513 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVAS |
Ga0242659_10914431 | 3300022522 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVASTHPQIWP |
Ga0242663_10350351 | 3300022523 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECVASTHPRTVKRMQ |
Ga0242663_10368342 | 3300022523 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVASTHPQIWPR |
Ga0242656_10350021 | 3300022525 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQFS |
Ga0242656_10354812 | 3300022525 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCHGKERVAS |
Ga0242656_10607551 | 3300022525 | Soil | MRSKTSHAAESGVGEHTARESEAPNVCDGKERVAS |
Ga0242656_10627031 | 3300022525 | Soil | MRSRTSHAAKSGVGEHAARESEAPNACAGKERVANAHPQIWPRNR |
Ga0242664_10327551 | 3300022527 | Soil | MRLRTSHAAKSGVGEHKARESESAQPCAVGKECVASTH |
Ga0242664_10408971 | 3300022527 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECVASTHPQLG |
Ga0242664_10409152 | 3300022527 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKERVASAH |
Ga0242660_11485401 | 3300022531 | Soil | MRSRTSPAAKSGVGNTRPAKARAPNVCAGKERVANA |
Ga0242655_100995791 | 3300022532 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCAGKECVAN |
Ga0222756_10377411 | 3300022709 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVASTHP |
Ga0242674_10108611 | 3300022711 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECVASTHPPHHPTVK |
Ga0242653_10287081 | 3300022712 | Soil | MRSRTSHAAKSGVGEHKARESESAQPCAVGKECVASTHPQ |
Ga0242653_10310722 | 3300022712 | Soil | MRSRTSHAAKSGVGEHKARESESAQHGADEKECVAS |
Ga0242677_10180851 | 3300022713 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVAR |
Ga0242678_10215372 | 3300022715 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCAGKECVASTH |
Ga0242678_10692931 | 3300022715 | Soil | MRSRTSHAAKSGDGGHKARESESAQPCPVGKECVASRSEERRAGK |
Ga0242673_10718141 | 3300022716 | Soil | MGSTTSHAAKSGVGEHTARESEAPNVCEGKECVASTH |
Ga0242673_10887091 | 3300022716 | Soil | MRSIASHAAKSGVGEHTARESEAPNVCEGKECVASTHP |
Ga0242661_10463661 | 3300022717 | Soil | MRSRTSHAAKSGVGEHTACESEAPNVCDGKERVASAH |
Ga0242661_10703361 | 3300022717 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCEGKECMASTH |
Ga0242661_10776361 | 3300022717 | Soil | MRSTASHAAKSGVGEHTARESDAPNVCEGKECVAS |
Ga0242661_11478111 | 3300022717 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVANAHPQFGP |
Ga0242672_10323871 | 3300022720 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECVAS |
Ga0242672_10808741 | 3300022720 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDGKERVASAH |
Ga0242666_10794771 | 3300022721 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPRTRT |
Ga0242665_101279751 | 3300022724 | Soil | MRSIASHAAKSGVGEHTARESEAPNVCEGKECVASTHPQLGP |
Ga0242654_101309821 | 3300022726 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKERVASA |
Ga0247541_1001923 | 3300023537 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCEGKECVAMLL |
Ga0247555_1010231 | 3300023539 | Soil | MRSRTSHAAKSGVGEHKARESESAQRCADGKECVASTH |
Ga0247555_1010811 | 3300023539 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCEGKECVASTHPH |
Ga0247540_1041971 | 3300023542 | Soil | MRSKTSHAAKSGVGEHKARESESAQPCAVGKECVAS |
Ga0247514_1134551 | 3300023560 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCEGKECVASTH |
Ga0247518_1198931 | 3300023561 | Soil | MRSRTSHAAKSGVGEHAARESEAPNVCDGKERVAS |
Ga0247516_1130782 | 3300023562 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCAGKERVASA |
Ga0247539_1012321 | 3300023669 | Soil | MRSKTSHAAKSGVGEHKARESESAQHCAIGKECVAST |
Ga0247533_1022091 | 3300023675 | Soil | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVASTH |
Ga0247528_1110681 | 3300023680 | Soil | MRSKTSHAAKSGVGEHKARESESAQHCADGKECVAS |
Ga0247512_1153661 | 3300023690 | Soil | MRSRTSHAAKSGVGEHKARESESAQRCADGKECVAST |
Ga0247512_1229261 | 3300023690 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCDGKERVASA |
Ga0228704_1084121 | 3300023691 | Freshwater | MRPRASHAAMSGVGEHTARESEAPNVCAGEERVASAH |
Ga0210315_10316041 | 3300028329 | Estuarine | MRPIASHAAVSSVGKHTARESEAPNVCAGKERVANAH |
Ga0265322_100447421 | 3300028654 | Rhizosphere | MRPRALHAAVSGVGEHTARESEAPNVCAGKERVANAHPQVWHRDASPG |
Ga0311361_100208397 | 3300029911 | Bog | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVASTHPHFKAGTVRFRP |
Ga0210264_11583561 | 3300030530 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASA |
Ga0210289_15450311 | 3300030543 | Soil | MRSRTSHAAKSGGGEHKARESESAQPCAVGKECVAS |
Ga0210270_14422121 | 3300030581 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVASN |
Ga0210280_10503851 | 3300030594 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQEKKIKKKKDEK |
Ga0210286_12967901 | 3300030597 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQ |
Ga0210251_102574161 | 3300030624 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQIWP |
Ga0210251_112338751 | 3300030624 | Soil | MRSKTSHAAESGVGEHTARESEAPNVCDGKERVASAHPQ |
Ga0210282_100782781 | 3300030630 | Soil | MRSRTSHAAKSGVGEHKARESESAQQCADGKECVASTRP |
Ga0210279_101529971 | 3300030631 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCEGKECVASTRNIKK |
Ga0311345_104007692 | 3300030688 | Bog | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVASTHPHFKAGTVRFR |
Ga0265462_107039791 | 3300030738 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQFGASNKK |
Ga0265722_1036762 | 3300030761 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKECVASTHPH |
Ga0265775_1010931 | 3300030762 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCDGKERVASAHP |
Ga0265775_1061721 | 3300030762 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVASTH |
Ga0265720_10040172 | 3300030764 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKECVAS |
Ga0265720_10048381 | 3300030764 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVASTH |
Ga0265756_1041052 | 3300030805 | Soil | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVAS |
Ga0265731_1011482 | 3300030806 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECVASTH |
Ga0265735_1018223 | 3300030811 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKECVASTHP |
Ga0265734_1016562 | 3300030812 | Soil | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVASTHPP |
Ga0265741_1184011 | 3300030814 | Soil | MRSITSHAAESGVGEHTARESEAPNVCDGKECVAS |
Ga0265729_1010152 | 3300030816 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKECVASTHPQIRPR |
Ga0265736_1012953 | 3300030833 | Soil | MRSRTSLAAKSGVGEHTARESEAPNVCDGKECVASTH |
Ga0265738_1034411 | 3300030834 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCDGKECVASTHPQLGPRD |
Ga0265738_1041361 | 3300030834 | Soil | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVASTHPQI |
Ga0265725_1009571 | 3300030835 | Soil | MRSKTSHAAKSGVGEHKARESESAQHCAIGKECVASTHP |
Ga0265767_1046381 | 3300030836 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQIW |
Ga0074020_112796821 | 3300030840 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCAGKERVASAHPQRENIKK |
Ga0265753_10736931 | 3300030862 | Soil | MRSTTSHAAKSGVGEQTARESEAPNVCEGKECVAS |
Ga0265742_10065712 | 3300030874 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVASTHPQIW |
Ga0265730_1008922 | 3300030876 | Soil | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVASTHPQIRPRN |
Ga0265777_1082901 | 3300030877 | Soil | MRSRTSHAAKSGVGEHKARESESAQPCAVGKECVASTHPQIWPR |
Ga0265764_1028872 | 3300030882 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCEGKECVAST |
Ga0265743_1098271 | 3300030885 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCAGKECVASTHPQIWPR |
Ga0265772_1026241 | 3300030886 | Soil | MKSIPSHAARSGVGEPAARESEAPNAGPGKERVASAHPQ |
Ga0265772_1055111 | 3300030886 | Soil | MRSISSHAARSGVGEPAARESEAPNAGPGKERVASAH |
Ga0265733_1012401 | 3300030887 | Soil | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVASTHPQ |
Ga0265759_1066151 | 3300030913 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCDGKERVAS |
Ga0075386_122297001 | 3300030916 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVANAHPQFGPGTARSR |
Ga0247549_1035731 | 3300030942 | Soil | MRSRTSHAAKSGVGEHAARESEAPNVCDGKERVASAH |
Ga0265739_1016651 | 3300030976 | Soil | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVASTHL |
Ga0265757_1026411 | 3300030978 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVASTHPQIWP |
Ga0265748_1024642 | 3300030982 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCAGKECVASTHPQ |
Ga0265771_10048702 | 3300031010 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVASTHPQKANA |
Ga0265724_1010581 | 3300031024 | Soil | MRSTASHAAKSGVGEHTARESEAPNVCEGKECVASTHT |
Ga0265724_1017771 | 3300031024 | Soil | MRSRPSHAAKSGVGEHTARESESAQVCDGKERVASAHP |
Ga0074030_110309591 | 3300031030 | Soil | MRSKTSHAAKSGVGEHKARESESAQHCAIGKECVAYNIIKRRK |
Ga0265754_10076471 | 3300031040 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCYGKERVASA |
Ga0170834_1139618511 | 3300031057 | Forest Soil | MRSKTSPAAKSGVGEHAARESEAPNACAGKERVANA |
Ga0102767_113515041 | 3300031064 | Soil | MRSKTSHAAKSGVGEHTARESEAPNVCHGKERVASAHPQFKEKNKS |
Ga0265760_101244531 | 3300031090 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVASTHPPMRS |
Ga0170820_102338982 | 3300031446 | Forest Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVANAHPQNTEYT |
Ga0170818_1084966561 | 3300031474 | Forest Soil | MRSKTSHAAKSGVGEHTARESEAPNVYDGKERVASAHPQFGPG |
Ga0307483_10109512 | 3300031590 | Hardwood Forest Soil | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVANA |
Ga0310117_1320101 | 3300031592 | Soil | MRSITSHASESGVGEHTARESEAPNVCDGKECVASTHPH |
Ga0307480_10050931 | 3300031677 | Hardwood Forest Soil | MRPISAHAALSGVGEHTARESEAPNVCAGKECVASTHPQI |
Ga0310119_1171111 | 3300031686 | Soil | MRSRTSHAAKSGVGEHKARESESAQPCAVGKECVAST |
Ga0247548_1061821 | 3300031814 | Soil | MRSRTSHAAKSGVGEHKARESESAQPCAVGKECVASTQP |
Ga0316046_1037901 | 3300031817 | Soil | MRSRTSHAAKSGVGEHTARESEAPNVCAGKERVASAH |
Ga0316031_1049831 | 3300031826 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVAMRDGNGF |
Ga0316043_1270501 | 3300031828 | Soil | MRSRTSHAAKSGVGEHAARESEAPNVCDGKERVASA |
Ga0316043_1280141 | 3300031828 | Soil | MRSKTSHAAKSGVGEHKARESESAQPCAVGKECVASTHPQKANA |
Ga0316030_1091541 | 3300031869 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVASTHPHFK |
Ga0316029_1030742 | 3300031870 | Soil | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVAST |
Ga0316036_1048751 | 3300031871 | Soil | MRSTTSHAAKSGVGEHTARESEAPNVCDGKECVASTHPHFKAG |
Ga0316032_1039681 | 3300031956 | Soil | MRSRTSHAAKSGVGEHKARESESAQHCADGKECVASTHPHLLK |
Ga0316052_1040751 | 3300032028 | Soil | MRSKSSHAAKSGVGEHAARESEAPNACAGKERVANA |
Ga0348332_105466821 | 3300032515 | Plant Litter | MRSKTSHAAKSGVGEHTARESEAPNVCAGKERVASAHP |
Ga0348332_107511662 | 3300032515 | Plant Litter | MRSRSSHAAKSGVGEHTSRESEAPNVCDGKERVASAHPQIL |
Ga0348332_133154981 | 3300032515 | Plant Litter | MRSRTSLAAKSGVGEHTARESEAPNVCDGKERVASAHPR |
Ga0348332_140240831 | 3300032515 | Plant Litter | MRSRTSHAAKSGVGEHTARESEAPNVCDGKERVASAHPQIWPW |
Ga0348332_142692202 | 3300032515 | Plant Litter | MRSKTSLAAKSGVGEHTARESEAPNVCDGKECVASTHP |
Ga0314782_053864_698_808 | 3300034661 | Soil | MRPKHPHAAESGVGEHTARESEAPNSVQWKERAANAH |
⦗Top⦘ |