Basic Information | |
---|---|
Family ID | F018800 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 233 |
Average Sequence Length | 43 residues |
Representative Sequence | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFT |
Number of Associated Samples | 180 |
Number of Associated Scaffolds | 233 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.85 % |
% of genes near scaffold ends (potentially truncated) | 97.85 % |
% of genes from short scaffolds (< 2000 bps) | 92.70 % |
Associated GOLD sequencing projects | 157 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.103 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (46.352 % of family members) |
Environment Ontology (ENVO) | Unclassified (72.103 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.657 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 233 Family Scaffolds |
---|---|---|
PF07879 | PHB_acc_N | 2.15 |
PF05199 | GMC_oxred_C | 1.29 |
PF13193 | AMP-binding_C | 1.29 |
PF07819 | PGAP1 | 0.86 |
PF00465 | Fe-ADH | 0.43 |
PF00561 | Abhydrolase_1 | 0.43 |
PF07859 | Abhydrolase_3 | 0.43 |
PF14539 | DUF4442 | 0.43 |
PF08327 | AHSA1 | 0.43 |
PF01734 | Patatin | 0.43 |
PF11154 | DUF2934 | 0.43 |
PF04909 | Amidohydro_2 | 0.43 |
PF07238 | PilZ | 0.43 |
PF13384 | HTH_23 | 0.43 |
PF07007 | LprI | 0.43 |
PF00441 | Acyl-CoA_dh_1 | 0.43 |
PF00248 | Aldo_ket_red | 0.43 |
COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
---|---|---|---|
COG5394 | Polyhydroxyalkanoate (PHA) synthesis regulator protein, binds DNA and PHA | Signal transduction mechanisms [T] | 2.15 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.29 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.86 |
COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.86 |
COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.86 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.43 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.43 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.43 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.43 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.43 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.43 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.43 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.43 |
COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.43 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.10 % |
Unclassified | root | N/A | 27.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918007|ConsensusfromContig158056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
2170459010|GIO7OMY01EBMRE | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300000789|JGI1027J11758_12123777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300001867|JGI12627J18819_10061887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
3300002867|Ga0006816J43186_109831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 678 | Open in IMG/M |
3300003152|Ga0052254_1135965 | Not Available | 525 | Open in IMG/M |
3300003295|Ga0006866J48919_104259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 669 | Open in IMG/M |
3300003295|Ga0006866J48919_108248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 867 | Open in IMG/M |
3300003295|Ga0006866J48919_110842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 666 | Open in IMG/M |
3300003296|Ga0006840J48914_106805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 668 | Open in IMG/M |
3300003296|Ga0006840J48914_106987 | Not Available | 635 | Open in IMG/M |
3300003296|Ga0006840J48914_107921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 666 | Open in IMG/M |
3300003297|Ga0006818J48916_103358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 665 | Open in IMG/M |
3300004465|Ga0068944_1155274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 763 | Open in IMG/M |
3300004467|Ga0068978_1208544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300004468|Ga0068977_1219950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 679 | Open in IMG/M |
3300004469|Ga0068931_1000914 | Not Available | 553 | Open in IMG/M |
3300004469|Ga0068931_1207459 | Not Available | 516 | Open in IMG/M |
3300004470|Ga0068967_1252421 | Not Available | 652 | Open in IMG/M |
3300004471|Ga0068965_1006134 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300004471|Ga0068965_1233969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300004473|Ga0068919_1334872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300004474|Ga0068968_1416539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 869 | Open in IMG/M |
3300004474|Ga0068968_1483709 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300004474|Ga0068968_1493103 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300004475|Ga0068969_1009966 | Not Available | 670 | Open in IMG/M |
3300004476|Ga0068966_1001069 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300004476|Ga0068966_1418294 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300004476|Ga0068966_1499021 | Not Available | 634 | Open in IMG/M |
3300004477|Ga0068971_1489046 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300004500|Ga0068954_1126279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300004557|Ga0068935_1177253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300004592|Ga0068938_1182685 | Not Available | 645 | Open in IMG/M |
3300004593|Ga0068946_1180475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300004593|Ga0068946_1230545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300004594|Ga0068976_1211608 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300004594|Ga0068976_1213309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 661 | Open in IMG/M |
3300004594|Ga0068976_1242344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300004597|Ga0068947_1260166 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300004601|Ga0068934_1245603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300004603|Ga0068918_1227869 | Not Available | 636 | Open in IMG/M |
3300004606|Ga0068962_1321938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 584 | Open in IMG/M |
3300004608|Ga0068924_1337941 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300004611|Ga0068925_1290883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1005 | Open in IMG/M |
3300004614|Ga0068956_1344045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300004615|Ga0068926_1402265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 589 | Open in IMG/M |
3300004956|Ga0072326_1095619 | Not Available | 535 | Open in IMG/M |
3300004973|Ga0072322_1002336 | Not Available | 657 | Open in IMG/M |
3300005542|Ga0070732_10536575 | Not Available | 709 | Open in IMG/M |
3300005841|Ga0068863_102521836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300005843|Ga0068860_102208635 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300006052|Ga0075029_101064060 | Not Available | 561 | Open in IMG/M |
3300006059|Ga0075017_100673472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300006086|Ga0075019_10075729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1912 | Open in IMG/M |
3300006086|Ga0075019_10254568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
3300006162|Ga0075030_101575947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300006172|Ga0075018_10253412 | Not Available | 853 | Open in IMG/M |
3300006174|Ga0075014_100133248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1197 | Open in IMG/M |
3300006174|Ga0075014_100817090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300006861|Ga0063777_1422683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300006861|Ga0063777_1500788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300006914|Ga0075436_100141634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1690 | Open in IMG/M |
3300009098|Ga0105245_12891864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300009519|Ga0116108_1030621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1780 | Open in IMG/M |
3300009520|Ga0116214_1342956 | Not Available | 577 | Open in IMG/M |
3300009522|Ga0116218_1082553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1464 | Open in IMG/M |
3300009522|Ga0116218_1357897 | Not Available | 652 | Open in IMG/M |
3300009523|Ga0116221_1398641 | Not Available | 599 | Open in IMG/M |
3300009547|Ga0116136_1016538 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
3300009547|Ga0116136_1170415 | Not Available | 548 | Open in IMG/M |
3300009618|Ga0116127_1026633 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300009631|Ga0116115_1080947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
3300009632|Ga0116102_1028017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1896 | Open in IMG/M |
3300009632|Ga0116102_1166596 | Not Available | 601 | Open in IMG/M |
3300009637|Ga0116118_1079560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
3300009638|Ga0116113_1045554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
3300009639|Ga0116122_1095723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
3300009640|Ga0116126_1281566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300009645|Ga0116106_1270389 | Not Available | 541 | Open in IMG/M |
3300009672|Ga0116215_1225894 | Not Available | 821 | Open in IMG/M |
3300009683|Ga0116224_10144191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
3300009683|Ga0116224_10258986 | Not Available | 829 | Open in IMG/M |
3300009762|Ga0116130_1302911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300009764|Ga0116134_1108275 | Not Available | 1002 | Open in IMG/M |
3300009764|Ga0116134_1122574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
3300009839|Ga0116223_10891754 | Not Available | 507 | Open in IMG/M |
3300010358|Ga0126370_10070654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2306 | Open in IMG/M |
3300010379|Ga0136449_100902549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
3300010379|Ga0136449_101025422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1324 | Open in IMG/M |
3300011025|Ga0138561_131875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300011031|Ga0138543_114133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300011034|Ga0138549_149052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300011036|Ga0138590_115606 | Not Available | 539 | Open in IMG/M |
3300011038|Ga0138547_124029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300011043|Ga0138528_118938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300011044|Ga0138545_120389 | Not Available | 599 | Open in IMG/M |
3300011049|Ga0138554_145430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300011050|Ga0138571_147156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300011050|Ga0138571_152455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300011050|Ga0138571_174228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300011051|Ga0138540_106853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300011051|Ga0138540_129313 | Not Available | 533 | Open in IMG/M |
3300011052|Ga0138585_132623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300011056|Ga0138538_1002228 | Not Available | 620 | Open in IMG/M |
3300011056|Ga0138538_1003141 | Not Available | 558 | Open in IMG/M |
3300011057|Ga0138544_1035579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300011059|Ga0138597_1044176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300011061|Ga0138534_1080740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300011062|Ga0138582_1113417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300011068|Ga0138599_1059714 | Not Available | 556 | Open in IMG/M |
3300011068|Ga0138599_1074091 | Not Available | 644 | Open in IMG/M |
3300011069|Ga0138592_1117030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
3300011069|Ga0138592_1133598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300011070|Ga0138567_1138799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300011071|Ga0138595_1055959 | Not Available | 647 | Open in IMG/M |
3300011072|Ga0138563_1121437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300011072|Ga0138563_1132040 | Not Available | 505 | Open in IMG/M |
3300011072|Ga0138563_1158520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300011073|Ga0138584_1130227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300011073|Ga0138584_1150590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
3300011074|Ga0138559_1040252 | Not Available | 671 | Open in IMG/M |
3300011075|Ga0138555_1069676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300011076|Ga0138574_1156631 | Not Available | 794 | Open in IMG/M |
3300011077|Ga0138572_1160851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
3300011079|Ga0138569_1011419 | Not Available | 677 | Open in IMG/M |
3300011080|Ga0138568_1080320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
3300011080|Ga0138568_1191244 | Not Available | 613 | Open in IMG/M |
3300011082|Ga0138526_1201031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300011084|Ga0138562_1066095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300011086|Ga0138564_1164210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300011086|Ga0138564_1186566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300011090|Ga0138579_1130454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300011110|Ga0138578_1130085 | Not Available | 645 | Open in IMG/M |
3300012987|Ga0164307_10350783 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300014155|Ga0181524_10412698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300014159|Ga0181530_10083582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1952 | Open in IMG/M |
3300014200|Ga0181526_10154127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1472 | Open in IMG/M |
3300014200|Ga0181526_11010415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300014489|Ga0182018_10005508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10157 | Open in IMG/M |
3300014491|Ga0182014_10125502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
3300014638|Ga0181536_10438935 | Not Available | 577 | Open in IMG/M |
3300016445|Ga0182038_11813505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300016702|Ga0181511_1006271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300016705|Ga0181507_1079249 | Not Available | 564 | Open in IMG/M |
3300016705|Ga0181507_1089604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300017822|Ga0187802_10046336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1581 | Open in IMG/M |
3300017822|Ga0187802_10210070 | Not Available | 749 | Open in IMG/M |
3300017822|Ga0187802_10424344 | Not Available | 528 | Open in IMG/M |
3300017823|Ga0187818_10278222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
3300017924|Ga0187820_1030870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1390 | Open in IMG/M |
3300017924|Ga0187820_1151646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
3300017926|Ga0187807_1266453 | Not Available | 564 | Open in IMG/M |
3300017928|Ga0187806_1226807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300017929|Ga0187849_1285909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300017931|Ga0187877_1028942 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
3300017933|Ga0187801_10016713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2456 | Open in IMG/M |
3300017933|Ga0187801_10179825 | Not Available | 833 | Open in IMG/M |
3300017934|Ga0187803_10393949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300017936|Ga0187821_10503406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300017940|Ga0187853_10052384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2088 | Open in IMG/M |
3300017942|Ga0187808_10458398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300017943|Ga0187819_10336851 | Not Available | 873 | Open in IMG/M |
3300017959|Ga0187779_10188051 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300017975|Ga0187782_10262829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
3300017975|Ga0187782_11211177 | Not Available | 591 | Open in IMG/M |
3300017988|Ga0181520_10610080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
3300017995|Ga0187816_10265561 | Not Available | 750 | Open in IMG/M |
3300017995|Ga0187816_10432721 | Not Available | 587 | Open in IMG/M |
3300017995|Ga0187816_10566859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300018002|Ga0187868_1158866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
3300018006|Ga0187804_10222019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
3300018008|Ga0187888_1085705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
3300018008|Ga0187888_1121595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
3300018009|Ga0187884_10070756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1573 | Open in IMG/M |
3300018012|Ga0187810_10158990 | Not Available | 909 | Open in IMG/M |
3300018016|Ga0187880_1133487 | Not Available | 1184 | Open in IMG/M |
3300018019|Ga0187874_10437636 | Not Available | 526 | Open in IMG/M |
3300018020|Ga0187861_10016785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4569 | Open in IMG/M |
3300018022|Ga0187864_10098749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1523 | Open in IMG/M |
3300018022|Ga0187864_10178283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1025 | Open in IMG/M |
3300018023|Ga0187889_10087793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1560 | Open in IMG/M |
3300018024|Ga0187881_10039695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2363 | Open in IMG/M |
3300018037|Ga0187883_10580826 | Not Available | 581 | Open in IMG/M |
3300018043|Ga0187887_10007028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7973 | Open in IMG/M |
3300018047|Ga0187859_10651532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300018085|Ga0187772_10034574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3024 | Open in IMG/M |
3300018085|Ga0187772_10141368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1585 | Open in IMG/M |
3300018086|Ga0187769_10005982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7476 | Open in IMG/M |
3300018086|Ga0187769_10547311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
3300018088|Ga0187771_11233445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300019241|Ga0187793_1250679 | Not Available | 525 | Open in IMG/M |
3300019245|Ga0187791_1024734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300019278|Ga0187800_1313741 | Not Available | 611 | Open in IMG/M |
3300019278|Ga0187800_1715717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300019278|Ga0187800_1792960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300025432|Ga0208821_1033414 | Not Available | 1021 | Open in IMG/M |
3300025448|Ga0208037_1028127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1232 | Open in IMG/M |
3300025454|Ga0208039_1041187 | Not Available | 877 | Open in IMG/M |
3300025500|Ga0208686_1095827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300025501|Ga0208563_1070247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300025506|Ga0208937_1090536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
3300025581|Ga0208355_1085286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300025906|Ga0207699_11004333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300025917|Ga0207660_10112180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2053 | Open in IMG/M |
3300025924|Ga0207694_10263010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1413 | Open in IMG/M |
3300025929|Ga0207664_11070216 | Not Available | 721 | Open in IMG/M |
3300027035|Ga0207776_1029222 | Not Available | 705 | Open in IMG/M |
3300027326|Ga0209731_1000593 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
3300027604|Ga0208324_1119320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300027604|Ga0208324_1162542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300027696|Ga0208696_1067722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1220 | Open in IMG/M |
3300027696|Ga0208696_1076748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1132 | Open in IMG/M |
3300027821|Ga0209811_10251814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300027825|Ga0209039_10133180 | Not Available | 1044 | Open in IMG/M |
3300027854|Ga0209517_10268656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1012 | Open in IMG/M |
3300027905|Ga0209415_10389394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
3300027911|Ga0209698_10478716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
3300028268|Ga0255348_1032501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1000 | Open in IMG/M |
3300029911|Ga0311361_10874845 | Not Available | 778 | Open in IMG/M |
3300030494|Ga0310037_10256921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
3300031017|Ga0265744_102936 | Not Available | 835 | Open in IMG/M |
3300031235|Ga0265330_10312754 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300031823|Ga0307478_11092762 | Not Available | 665 | Open in IMG/M |
3300031954|Ga0306926_12099216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300032160|Ga0311301_10111903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5227 | Open in IMG/M |
3300032160|Ga0311301_10682587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1450 | Open in IMG/M |
3300032205|Ga0307472_100402286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1146 | Open in IMG/M |
3300032515|Ga0348332_12178979 | Not Available | 830 | Open in IMG/M |
3300032828|Ga0335080_10214709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2112 | Open in IMG/M |
3300032892|Ga0335081_10039371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7519 | Open in IMG/M |
3300032892|Ga0335081_10320764 | Not Available | 2038 | Open in IMG/M |
3300032892|Ga0335081_12411223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 546 | Open in IMG/M |
3300033743|Ga0334844_111546 | Not Available | 541 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 46.35% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.01% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.58% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.15% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.43% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.58% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.15% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.43% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.43% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.43% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.43% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.43% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.43% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.43% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.43% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.43% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.43% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.43% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002867 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 17 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
3300003295 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003296 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003297 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300004465 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004467 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004469 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004500 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 46 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004557 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 23 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004592 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 26 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004593 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004594 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004597 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004601 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004603 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004606 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004608 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004611 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004614 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004956 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 43 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004973 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011025 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 46 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011031 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 24 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011034 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 30 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011036 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011038 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011043 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011044 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 26 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011049 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011050 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011051 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011052 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011056 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011059 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011062 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011070 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011071 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028268 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5 | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033743 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A_all_C_01780240 | 2140918007 | Soil | MITSEAVQERVQIPLAAESLSEERIAYLERLVSQARTAA |
F62_06845550 | 2170459010 | Grass Soil | MIACEAVPERVQIPLTAEDLSPERIAYLEQLVSQARTAAAV |
JGI1027J11758_121237772 | 3300000789 | Soil | MIASEAVKERVQIPLNAESLSAERIAYLDGLVRQARTA |
JGI12627J18819_100618871 | 3300001867 | Forest Soil | MIASGTEQQRIQAPAESLCAERIAHLEGLVSQAKTAAAVFTQFTQE |
Ga0006816J43186_1098312 | 3300002867 | Peatlands Soil | MITQEVLQERVAIPQATESLSPERVAYLEKLVSQARTAAAVFTQFTQED |
Ga0052254_11359651 | 3300003152 | Sediment | MITTEALERIKIPLDAEALSGERTAYLERLVAQARIAISAKH |
Ga0006866J48919_1042592 | 3300003295 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFTQFT |
Ga0006866J48919_1082483 | 3300003295 | Peatlands Soil | MITSKTVKERVEIPLITEGLSAERIAYLEGLVSQARTAAAVFTQFT |
Ga0006866J48919_1108422 | 3300003295 | Peatlands Soil | MITCEEVQERVQIPLAAESLSEERIAYLERLVSQARTAAAVFTQFTQE |
Ga0006840J48914_1068052 | 3300003296 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVSQARTAAAVFTQFT |
Ga0006840J48914_1069872 | 3300003296 | Peatlands Soil | MNTCEATLERIQIPLAAETLSEERIAYLDGLVTRARTAAAV |
Ga0006840J48914_1079212 | 3300003296 | Peatlands Soil | MITQEVLQERVAIPQATESLSPERVAYLEKLVSQARTAAAVFTQ |
Ga0006818J48916_1033582 | 3300003297 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLFTQARTAAAVFTQFT |
Ga0068944_11552742 | 3300004465 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFTQF |
Ga0068978_12085442 | 3300004467 | Peatlands Soil | MIATEAMPQRVQIPLAAESLSEDRIAYLERLVRQARTAAAVFTQF |
Ga0068977_12199502 | 3300004468 | Peatlands Soil | MATSEVVEKRVQIRLPVESLSEERIAYLEGLVGQARTAAAVFTQYT |
Ga0068931_10009141 | 3300004469 | Peatlands Soil | MVTHEVVQERVQIPLTAESLSQERIAYLERLVSQARTAAAVF |
Ga0068931_12074592 | 3300004469 | Peatlands Soil | MATSEVIQERLQIPLAAESLSEERIAYLERLVSQAKTAAA |
Ga0068967_12524211 | 3300004470 | Peatlands Soil | MVRREALQHRVQIPLAVETLSEERIAYLERLVSQARTAAAVFTQF |
Ga0068965_10061341 | 3300004471 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVSQARTAAAVFTQFTQED |
Ga0068965_12339691 | 3300004471 | Peatlands Soil | MATSEVVEKRVQIRLPVESLSEERIAYLEGLVGQARTAAAVFTQ |
Ga0068919_13348722 | 3300004473 | Peatlands Soil | MATSEVVQERIQISLAGESLSEERIAYLERLVSQARSAAAVFTQFT |
Ga0068968_14165393 | 3300004474 | Peatlands Soil | MITSKTVKERVEIPLITEGLSAERIAYLEGLVSQARTAAAVFTQFTQ |
Ga0068968_14837091 | 3300004474 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAHLEGLIDQARTAAAVFS |
Ga0068968_14931032 | 3300004474 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVSQARTAAAVFTQFTQEDV |
Ga0068969_10099662 | 3300004475 | Peatlands Soil | MITSEVVQERVQIPLESLSQERTAYLEGLVSQAKTAAAVFTQFT |
Ga0068966_10010691 | 3300004476 | Peatlands Soil | MITCEEVQERVQIPLAAESLSEERIAYLERLVSQARTAAAVFTQFTQEDVD |
Ga0068966_14182941 | 3300004476 | Peatlands Soil | MIATEAMPQRVQIPLAAESLSEDRIAYLERLVRQARTAAAVFTQFTQE |
Ga0068966_14990212 | 3300004476 | Peatlands Soil | MNTCEATLERIQIPLAAETLSEERIAYLDGLVTRARTAAA |
Ga0068971_14890462 | 3300004477 | Peatlands Soil | MATSEVVQERIQISLAGESLSEERIAYLERLVSQARSAAAVFTQFTQE |
Ga0068954_11262792 | 3300004500 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVRQARTAAAVF |
Ga0068935_11772531 | 3300004557 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAV |
Ga0068938_11826851 | 3300004592 | Peatlands Soil | MVRREALQHRVQIPLAVETLSEERIAYLERLVSQARTAAAVF |
Ga0068946_11804751 | 3300004593 | Peatlands Soil | MGVVMNTSEAVLERVQIPVAADSLSEERIAYLERVVSQARTAAAVF |
Ga0068946_12305452 | 3300004593 | Peatlands Soil | MATSEVVQERIQISLAGESLSEERIAYLERLVSQARSAAAVF |
Ga0068976_12116081 | 3300004594 | Peatlands Soil | MGVVMNTSEAVLERVQIPVAADSLSEERIAYLERVVSQARTAAAVFTQFTQ |
Ga0068976_12133091 | 3300004594 | Peatlands Soil | MITCEEVQERVQIPLAAESLSEERIAYLERLVSQARTAAAVFTQFTQ |
Ga0068976_12423441 | 3300004594 | Peatlands Soil | MITSKTVKERVEIPLITEGLSAERIAYLEGLVSQARTAAAVFT |
Ga0068947_12601661 | 3300004597 | Peatlands Soil | MIASEAVQERVQIPLAVEGLSAERIAYLEGLVNQARTAAAVFTQF |
Ga0068934_12456032 | 3300004601 | Peatlands Soil | MIATEAMPQRVQIPLAAESLSEDRIAYLEILVRQARTAAAVF |
Ga0068918_12278692 | 3300004603 | Peatlands Soil | MNTCEATLERIQIPLAAETLSEERIAYLDGLVTRARTAAAVF |
Ga0068962_13219381 | 3300004606 | Peatlands Soil | MIASEAVQERLQIPLAAEILSEERVAYLEGLINQARTAAAVFSQFT |
Ga0068924_13379412 | 3300004608 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVTQARTAAAVFTQFT |
Ga0068925_12908831 | 3300004611 | Peatlands Soil | MITSKTVKERVEIPLITERLSAERIAYLEGLVSQARTAAAVFT* |
Ga0068956_13440451 | 3300004614 | Peatlands Soil | MITQEVLQERVAILQATESLSPERVAYLEKLVSQARTAAAV |
Ga0068926_14022651 | 3300004615 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVSQARTAAAVFTQFTQE |
Ga0072326_10956191 | 3300004956 | Peatlands Soil | MITQEVLQERVAIPQATESLSPERVAYPEKLVSQARTAAAV |
Ga0072322_10023361 | 3300004973 | Peatlands Soil | MITSEVVQERVQIPLATESLSPERIAYLEGLVSQAKTAAA |
Ga0070732_105365752 | 3300005542 | Surface Soil | MIATEKVQERVQIPLAVEILSAERIAYLEGLVNQAKTAA |
Ga0068863_1025218362 | 3300005841 | Switchgrass Rhizosphere | MIATEVIQERGQIPPATEELSKERIAYLERLVSQARTAAAVFTQ |
Ga0068860_1022086352 | 3300005843 | Switchgrass Rhizosphere | MIVSEAEQRVQSPPPAEDLGKERIAYLEKLVHQARLASAAFTQFTQEDV |
Ga0075029_1010640602 | 3300006052 | Watersheds | MIVTDVVKERVQIPLAVEGLSADRIAYLEGLAGQA |
Ga0075017_1006734721 | 3300006059 | Watersheds | MITSEAVPERVQIPLPAEGLSEERIAYLEGLVSQARTAAAVFTQYT |
Ga0075019_100757293 | 3300006086 | Watersheds | MITDEVVQERLQIPPATESLSEERIGYLEKLVSQARTAAAVFTQYTQ |
Ga0075019_102545683 | 3300006086 | Watersheds | MITDKVVNEVVKERVQIPLAAESLSKERIAYLEGLVSQAR |
Ga0075030_1015759471 | 3300006162 | Watersheds | MNTSEAVQERVQIPLPQESLSEERVAYLEKLVSQARTAAAVFTQF |
Ga0075018_102534123 | 3300006172 | Watersheds | MITSEAAQERVQIPLAADSLSAERIAYLERLVSQARTAAA |
Ga0075014_1001332482 | 3300006174 | Watersheds | MIASEAVQERVQIPLTAESLSGERIAYLERLVNQARTAAAVFTQF |
Ga0075014_1008170902 | 3300006174 | Watersheds | MITDEVVQEQLQIPPAAEILSPERITYLERLVSQARTA |
Ga0063777_14226831 | 3300006861 | Peatlands Soil | MIVSEAVEERVQIPLAVETLSAERIAYLEGLVSQARTAAAVF |
Ga0063777_15007882 | 3300006861 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAYLEGLINQARTAAAVFSQFTQEDV |
Ga0075436_1001416341 | 3300006914 | Populus Rhizosphere | MITSEATKERIQIPLAEKTLSAERIAYLEGLVNQARIAAAVFTQFTQE |
Ga0105245_128918642 | 3300009098 | Miscanthus Rhizosphere | MNTSEAVRERVLIPVAAEGLTEERIAYLEGLVGQARTAAAVFTQFTQED |
Ga0116108_10306213 | 3300009519 | Peatland | MITCEEVQERVPIPLAAESLSEERIAYLEKLVSQA |
Ga0116214_13429562 | 3300009520 | Peatlands Soil | MIASEAEQKTFQMPLAAESLSAERIAYLERLVSQARTAAAVFSQF |
Ga0116218_10825531 | 3300009522 | Peatlands Soil | MITCEEVQERVQIPLAAESLSEERIAYLERLVSQARTAAAVFTQFTQED |
Ga0116218_13578971 | 3300009522 | Peatlands Soil | MIASEAEQKTIQIPIAAETLSAERIAYLEKLVSQARTAAAVFSQFTQ |
Ga0116221_13986412 | 3300009523 | Peatlands Soil | MATREAVRVQIPLAAEGLSEERIAALEKLVSQARTAA |
Ga0116136_10165385 | 3300009547 | Peatland | MITSEVVEERVQIPLAAENLSEERIAYLERLVSQARTAAAVFTQFTQEDV |
Ga0116136_11704152 | 3300009547 | Peatland | MVTREVMQQRVQIPLSAESLTEERTAYLERLVRQARTAAAVFTQFT |
Ga0116127_10266334 | 3300009618 | Peatland | MITCEEVQERVPIPLAAESLSEERIAYLEKLVSQARAAAAVFTQFTQ |
Ga0116115_10809472 | 3300009631 | Peatland | MIASEAVQERVQIPLAAESLSPERIAYLETLVSQARTAAAV |
Ga0116102_10280173 | 3300009632 | Peatland | MITCEEVQERVPIPFAAESLSEERIAYLEKLVSQARTAAAVFT |
Ga0116102_11665961 | 3300009632 | Peatland | MATQEVLQERIPLPLAAESLSDERIAYLERLVSQART |
Ga0116118_10795602 | 3300009637 | Peatland | MITCEEVQERVPIPLAAESLSEERIAYLEKLVSQAR |
Ga0116113_10455541 | 3300009638 | Peatland | MSASEAVQERVQIPLPAESLSEERIAYLERVVSQARTAAA |
Ga0116122_10957233 | 3300009639 | Peatland | MIASEAVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFTQFT |
Ga0116126_12815661 | 3300009640 | Peatland | MVTRETVPERVQIPLAAESLSEERITYLERLVSQARSAAAVCT |
Ga0116106_12703891 | 3300009645 | Peatland | MIASEKVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFTQ |
Ga0116215_12258941 | 3300009672 | Peatlands Soil | MIASETMQARIQIPLAAESLSEERIAYLERLVRQARAAAAVFTQ |
Ga0116224_101441911 | 3300009683 | Peatlands Soil | MITQEVLQERVAIPQATESLSPERVAYLEKLVSQARTAAAV |
Ga0116224_102589862 | 3300009683 | Peatlands Soil | MIATENLQEPVQAPLAAEILSAERIAYLEGLVQQA |
Ga0116130_13029112 | 3300009762 | Peatland | MIASEAVRERVQIPLAAEILSEERVAYLEGLINQA |
Ga0116134_11082751 | 3300009764 | Peatland | MATREVVPQRVQIPLSTESLSEERIAYLERLVRQAKT |
Ga0116134_11225742 | 3300009764 | Peatland | MKQGAAMITREAVQERVQIPLAAESLSEERITYLEGLVSQARAA |
Ga0116223_108917541 | 3300009839 | Peatlands Soil | MATSEVIQERLQIPLAAESLSEERIAYLERLVSQAKTAAAVFTQ |
Ga0126370_100706544 | 3300010358 | Tropical Forest Soil | MITSEVVQERVKIPLDAEILPKERIAYLEGLVAQSKTAAAVFTQFTQE |
Ga0136449_1009025491 | 3300010379 | Peatlands Soil | MATCEVVQERVQISLAAESLSEERIAYLERLVSQARTAAAVFTQF |
Ga0136449_1010254223 | 3300010379 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAYLEGLINQARTAAAVFSQLTQKDVERFVKP |
Ga0138561_1318751 | 3300011025 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVRQARTAAAVFTQFTQED |
Ga0138543_1141331 | 3300011031 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFTQ |
Ga0138549_1490521 | 3300011034 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAYLEGLINQARTAAAVFSQFTQ |
Ga0138590_1156061 | 3300011036 | Peatlands Soil | MVTHELVQERVQIPLTAESLSQERIAYLERLVSQARTA |
Ga0138547_1240291 | 3300011038 | Peatlands Soil | MIASEAVQERLQIPLAAEILSEERVAYLEGLINQARTAAAVFSQFTQED |
Ga0138528_1189382 | 3300011043 | Peatlands Soil | MATSEVVQERIQISLSGESLSEERIAYLERLASQARSAAAVFTQF |
Ga0138545_1203891 | 3300011044 | Peatlands Soil | MVRREALQHRVQIPLAVETLSEERIAYLERLVSQARTAAAVFTQ |
Ga0138554_1454301 | 3300011049 | Peatlands Soil | MIASEAVQERVQIPLAVEGLSAERIAYLEGLVNQARTAAAVFTQFT |
Ga0138571_1471561 | 3300011050 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVTQARTAAA |
Ga0138571_1524552 | 3300011050 | Peatlands Soil | MIASEAVQERLQIPLAAEILSEERVAYLEGLINQARTAAAVFSQFTQEDV |
Ga0138571_1742281 | 3300011050 | Peatlands Soil | MIVSEAVQGRVQIPLAAENLSEERTAYLERLISRARTA |
Ga0138540_1068531 | 3300011051 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVSQARTAAAVF |
Ga0138540_1293131 | 3300011051 | Peatlands Soil | MIASETVQERVQIPLAAESLSPDRIAYLEGLVSQARTAAAVFTQFTQED |
Ga0138585_1326232 | 3300011052 | Peatlands Soil | MIATEAMPQRVQIPLAAESLSEDRIAYLERLVRQARTAAAVFTQFT |
Ga0138538_10022282 | 3300011056 | Peatlands Soil | MNTCEATLERIQIPLAAETLSEERIAYLDGLVTRARTA |
Ga0138538_10031411 | 3300011056 | Peatlands Soil | MVTHEVVQERVQIPLTAESLSQERIAYLERLVSQARTAAAVFTQ |
Ga0138544_10355792 | 3300011057 | Peatlands Soil | MITQEVLQERVAIPQATESLSPERVAYLEKLVSQARTAAAVFTQFT |
Ga0138597_10441761 | 3300011059 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAYLEGLINQAR |
Ga0138534_10807402 | 3300011061 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVSQARTAAAVFTQFTQ |
Ga0138582_11134171 | 3300011062 | Peatlands Soil | MIASEAVQERVQIPLAAESLSPERIAYLEGLVSQARAAAAVFTQFTQ |
Ga0138599_10597142 | 3300011068 | Peatlands Soil | MIVSEAVKERLQIPLACESLSEERLAYLERLVSQARIASAVF |
Ga0138599_10740911 | 3300011068 | Peatlands Soil | MITSEVVQERVQIPLAAESLSAERIAYLERLVMPRSRWLK |
Ga0138592_11170301 | 3300011069 | Peatlands Soil | MIVSEAVEERVQIPLAVETLSAERIAYLEGLVSQARTAAA |
Ga0138592_11335981 | 3300011069 | Peatlands Soil | MITCEEVQERVQIPLAAEKLSEERIAYLERLVSQARTAAAV |
Ga0138567_11387991 | 3300011070 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAYLEGLINQA |
Ga0138595_10559592 | 3300011071 | Peatlands Soil | MVTSEVVQERVQIPLATESLSQERIAYLEGLVSQAKTAA |
Ga0138563_11214371 | 3300011072 | Peatlands Soil | MIASEAVQERVQIPLAAESLSPERIAYLEGLVSQARAAAAVFT |
Ga0138563_11320401 | 3300011072 | Peatlands Soil | MITQEVLQERVAILQATESLSPERVAYLEKLVSQARTA |
Ga0138563_11585202 | 3300011072 | Peatlands Soil | MIASEAVQGRVQIPLAAENLSEERTAYLERLISQARTAD |
Ga0138584_11302272 | 3300011073 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAYLEGLINQARTAAAVFSQF |
Ga0138584_11505902 | 3300011073 | Peatlands Soil | MATSEVVEKRVQIRLPVESLSEERIAYLEGLVGQARTAAAVFTQYTQE |
Ga0138559_10402522 | 3300011074 | Peatlands Soil | MVRREALQHRVQIPLAVETLSEERIAYLERLVSQARTAAAVFTQFTQ |
Ga0138555_10696762 | 3300011075 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAYLEGLINQARTAAAVFSQFTQED |
Ga0138574_11566312 | 3300011076 | Peatlands Soil | MNTCEATLERIQIPLAAETLSEERIAYLDGLVTRARTAA |
Ga0138572_11608511 | 3300011077 | Peatlands Soil | VAAIIATEAMPQRVQIPLAAESLSEDRIAYLERLVRQARTAAAVFTQ |
Ga0138569_10114192 | 3300011079 | Peatlands Soil | MATSEVIQERLQIPLAAESLSEERIAYLERLVSQAKTAAAVFTQFTQE |
Ga0138568_10803203 | 3300011080 | Peatlands Soil | MIVSEAVEERVQIPLAVETLSAERIAYLEGLVSQART |
Ga0138568_11912441 | 3300011080 | Peatlands Soil | MIARDVVKERIQIPLAAESLSDERIADLERLVSQARTAAAVF |
Ga0138526_12010312 | 3300011082 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVTQARTAAAVFTQF |
Ga0138562_10660952 | 3300011084 | Peatlands Soil | MITCEEVQERVQIPLAAESLSEERIAYLERLVSQARTAAA |
Ga0138564_11642101 | 3300011086 | Peatlands Soil | MIASEAVQERLQIPLAAEILSEERVAYLEGLINQARTAAAVFSQFTQ |
Ga0138564_11865661 | 3300011086 | Peatlands Soil | MIASEAVQERVQIPLAAESLSPERIAYLEGLVSQA |
Ga0138579_11304542 | 3300011090 | Peatlands Soil | MATSEVVEERVQIPLAADSLSEERITYLEGLVSQARTA |
Ga0138578_11300852 | 3300011110 | Peatlands Soil | MIARDVVKERIQIPLAAESLSDERIADLERLVSQARTA |
Ga0164307_103507831 | 3300012987 | Soil | MIATERKERAQLPLPAEGPSAERIAYLESLVSQARIAAAVFTQFTQEDV |
Ga0181524_104126982 | 3300014155 | Bog | MATREVVQERIQIALAAESLSEERIAYLDGLVRQA |
Ga0181530_100835821 | 3300014159 | Bog | MGPWQSTEGAAMIASEKVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFTQ |
Ga0181526_101541271 | 3300014200 | Bog | MIASEAVRERVQIPLAAEILSEEHVAYLEGLINQARTAAAVF |
Ga0181526_110104151 | 3300014200 | Bog | MVTHETVPERVPIPLAAESLSEERITYLERLVSQA |
Ga0182018_100055082 | 3300014489 | Palsa | MITREVVQQRVQILLPTESLNDERIAYLEGLIHRARAAAAACHQ* |
Ga0182014_101255024 | 3300014491 | Bog | MVTRETVPERVQIPLAAESLSEERITYLERLVSQARS |
Ga0181536_104389351 | 3300014638 | Bog | MITCEEVQERVPNPLAAESLSEERIAYLEKLVSQARTAAAVFTQ |
Ga0182038_118135051 | 3300016445 | Soil | MIASEEVERTQLPHATENLSLERMAYLERLVSQAKSAAAVFTQF |
Ga0181511_10062712 | 3300016702 | Peatland | MVTSETVPERVQIPLAAESLSEERITYLERLVSQARSAAAVF |
Ga0181507_10792492 | 3300016705 | Peatland | MATSEAMEERVKIALAAESLSEERIAYLERLVSQARTAAAVFTQF |
Ga0181507_10896041 | 3300016705 | Peatland | MIASEAVRERVQIPLAAEILSEERVAYLEGLINQARTAAAVFS |
Ga0187802_100463361 | 3300017822 | Freshwater Sediment | MITNDAVKERIKIPLDVETLPGERIAYLEGLVGQARTAAAIFTQ |
Ga0187802_102100701 | 3300017822 | Freshwater Sediment | MSMSDAVQERVQIPLGPESLSKERIAYLERLVCQARTAAAVFTQFTQEDV |
Ga0187802_104243442 | 3300017822 | Freshwater Sediment | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFTQFTQE |
Ga0187818_102782221 | 3300017823 | Freshwater Sediment | MITSETVKERVQIPLATETLSAERTAYLEGLVSQARTAA |
Ga0187820_10308704 | 3300017924 | Freshwater Sediment | MITSETVKERVQIPLATETLSAERTAYLEGLVSQARTAAAVFTQFTQGDV |
Ga0187820_11516462 | 3300017924 | Freshwater Sediment | MVTSEAVLPRVPIPSATESLNEERIAYLEGLVSQARTAAAVFTQ |
Ga0187807_12664531 | 3300017926 | Freshwater Sediment | MIAREAEQKTIHIPLVAESLSAERMAYLEKLVSQAKTAAA |
Ga0187806_12268072 | 3300017928 | Freshwater Sediment | MIASETVQERVQIPLATECLSEERIAYLEKLVRQARTAAAVFT |
Ga0187849_12859092 | 3300017929 | Peatland | MITCEEVQERVPIPFAAESLSEERIAYLEKLVSQARTA |
Ga0187877_10289425 | 3300017931 | Peatland | MIASEAVQERVQIPLAAESLSPERIAYLETLVSQARA |
Ga0187801_100167131 | 3300017933 | Freshwater Sediment | MATREVLQEQTQVSIVTESLSEERIAYLDRLVNQARAAAAVFTQFTQEDV |
Ga0187801_101798253 | 3300017933 | Freshwater Sediment | VSEILIEQVLTPANAEGLSDERTAYLEGLVSQAKTAAAVFTQF |
Ga0187803_103939491 | 3300017934 | Freshwater Sediment | MITSDVVQEAVPIPPAVESLSEVRIAYLERLVSQARTAAAVFTQFTQE |
Ga0187821_105034062 | 3300017936 | Freshwater Sediment | MIATETLKERINIPLNTESLTEERIAYLEGLVGQAKTAAAVFIQF |
Ga0187853_100523843 | 3300017940 | Peatland | MITREAVQERVQIPLAAESLSEERITYLERLVSQARA |
Ga0187808_104583981 | 3300017942 | Freshwater Sediment | MVTSEAVLPRVPIPSATESLNEGRIAYLEGLVSQARTAAA |
Ga0187819_103368511 | 3300017943 | Freshwater Sediment | MIAREVEQKTIHIPLAPESLSAERIAYLERLVSQAKTA |
Ga0187779_101880513 | 3300017959 | Tropical Peatland | MIASEAVQERVQLPVAEGLSRERITYLEQLVKQARTA |
Ga0187782_102628292 | 3300017975 | Tropical Peatland | MIASKALEEWVQIPPPAEHLSEERITYLERLVSQAR |
Ga0187782_112111772 | 3300017975 | Tropical Peatland | MATGEVVRERVQIPLATESLSDERIAWLEKLVSQAKTAAAV |
Ga0181520_106100802 | 3300017988 | Bog | MSEVVRPGWVPTPTAPPSLNQERIACLEGLVRQARTAAAVFTQFTQEDVDH |
Ga0187816_102655611 | 3300017995 | Freshwater Sediment | MIASETQERNPIPSAAEALSAERVAYLEGLVSQARAASA |
Ga0187816_104327212 | 3300017995 | Freshwater Sediment | MSTSEVVKERVQNLPTAESLSEERIAYLESLVSQARNASAVF |
Ga0187816_105668591 | 3300017995 | Freshwater Sediment | MATREVLQEQTQVSIVTESLSEERIAYLDRLVNQARAAAAVF |
Ga0187868_11588661 | 3300018002 | Peatland | MITCEEVQERVPIPFAAESLSEERIAYLEKLVSQARTAAAVFTQFTQEDVD |
Ga0187804_102220191 | 3300018006 | Freshwater Sediment | MIASEAVQERVQIPRAAENLGEERIAYLEGLVSQARTAA |
Ga0187888_10857053 | 3300018008 | Peatland | MATREVVQPRVEIPLSTESLSEERIAYLERLVRQAKTAAAVFT |
Ga0187888_11215951 | 3300018008 | Peatland | MVMSEVVRPGWVPTPTAPPSLNQERIAYLEGLVRQARTAAAVFTQ |
Ga0187884_100707561 | 3300018009 | Peatland | MATQEVLQERIPLPLAAESLSDERIAYLERLVSQARTAAAVFTQFTQEDVD |
Ga0187810_101589902 | 3300018012 | Freshwater Sediment | MLTSEVVQERVQIPLATESLSQERIAYLEGLVSQAKT |
Ga0187880_11334873 | 3300018016 | Peatland | MVTRDVMQQRVQIPLSAESLTEERTAYLERLVRQARTAAAVFTQFT |
Ga0187874_104376361 | 3300018019 | Peatland | MATSEVVQERVQITLATESLSEERIAYLERLVSQARTAAAVFTQFTQEDV |
Ga0187861_100167851 | 3300018020 | Peatland | MATQEVLQERIPLPLAAESLSDERIAYLERLVSQARTAAA |
Ga0187864_100987492 | 3300018022 | Peatland | MATSEVVQERVQITLATESLSEERIAYLERLVSQARTAAAVFTQFT |
Ga0187864_101782833 | 3300018022 | Peatland | MITCEEVQERVPIPFAAESLSEERIAYLEKLVSQARTAAAVFTQFTQE |
Ga0187889_100877931 | 3300018023 | Peatland | MITCEEVQERVPIPLAAESLSEERIAHLEKLVSQART |
Ga0187881_100396954 | 3300018024 | Peatland | MATQEVLQERIPLPLAAESLSDERIAYLERLVSQARTAAAVFTQFTQ |
Ga0187883_105808262 | 3300018037 | Peatland | MITDEVVKERIQIPLAAESLSEERIAYLETLVSQARTAAA |
Ga0187887_100070281 | 3300018043 | Peatland | MITREVVQQRVQILLPTESLNDERIAYLEGLIHRARAAAAACH |
Ga0187859_106515322 | 3300018047 | Peatland | MVTSEAVLPRVTIPPATESLNQERIAYLEGLVSQARTAAAVFTQFTQE |
Ga0187772_100345741 | 3300018085 | Tropical Peatland | MISSAEVKEPVPSPQTAEGLSEERIAYLDGLVHQARVAAAV |
Ga0187772_101413681 | 3300018085 | Tropical Peatland | MIASEVVQERACVSSAPESPSPERIAYLDGLVSRAKTAA |
Ga0187769_100059821 | 3300018086 | Tropical Peatland | MTVSGAEQEKIQTPPAAEGLSAERIAYLDSLVRQARTASAVFTQF |
Ga0187769_105473111 | 3300018086 | Tropical Peatland | MNASQAVKEPIEDALAAEYLSEERIAYLNRLVSRAKVAAAVFTQFTQEDV |
Ga0187771_112334452 | 3300018088 | Tropical Peatland | MIASEAVQERVQIPLATEGLSAERIAYLEGLVNQARVAAAVFTQFTQE |
Ga0187793_12506791 | 3300019241 | Peatland | MVAKEELKERVEIPLTTESLSPERIASLEKLVAQARIAAAVFTQFTQAD |
Ga0187791_10247342 | 3300019245 | Peatland | MIAKEEVQERVQIPLASDGLSKDRIAYLEGLTGQAKTA |
Ga0187800_13137412 | 3300019278 | Peatland | MSTCEADLERIQIPLSAERLTEERIAYLESLVHRT |
Ga0187800_17157172 | 3300019278 | Peatland | MVVKEEVEVKKRVQIPLAPEILNPERTAYLEQLVAQARTAAAVFTQFT |
Ga0187800_17929601 | 3300019278 | Peatland | MITSDAVQERVQIPLGAESLSAERIAYLEALVNQAR |
Ga0208821_10334142 | 3300025432 | Peatland | MITSEVVEERVQIPLAAENLSEERIAYLERLVSQARTAA |
Ga0208037_10281271 | 3300025448 | Peatland | MITCEEVQERVPIPLAAESLSEERIAYLEKLVSQARAAAAVFTQF |
Ga0208039_10411872 | 3300025454 | Peatland | MITCEEVQERVPIPLAAESLSEERIAYLEKLVSQARTAAAVFTQ |
Ga0208686_10958271 | 3300025500 | Peatland | MITCEEVQERVPIPFAAESLSEERIAYLEKLVSQARTAAAVFTQFTQED |
Ga0208563_10702472 | 3300025501 | Peatland | MIASEAVQERVQIPLAAESLSPERIAYLEGLVSQARTAA |
Ga0208937_10905362 | 3300025506 | Peatland | MITCEEVQERVPIPFAAESLSEERIAYLEKLVSQA |
Ga0208355_10852861 | 3300025581 | Arctic Peat Soil | MATHEVLPARVQFPIVTESLSEERIAYLERLVSQARAAAAVFTQFTQED |
Ga0207699_110043331 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MITSEAVKERIKVPLDAEPLAAERIAYLETLVNQAKRAAAVFTQFTQEDVDHIVE |
Ga0207660_101121805 | 3300025917 | Corn Rhizosphere | MNTSEAVRERVLIPVAAEGLTEERIAYLEGLVGQART |
Ga0207694_102630101 | 3300025924 | Corn Rhizosphere | MNTSEAVRERVLIPVAAEGLTEERIAYLEGLVRQARTAAAVFT |
Ga0207664_110702162 | 3300025929 | Agricultural Soil | MITSEATKERIQIPLAEKTLSPERIAYLEGLVSQTRIA |
Ga0207776_10292222 | 3300027035 | Tropical Forest Soil | MVARSGLLERVGNPQAQDNLTQERVEYLERLVSRARTAAAVFTQFS |
Ga0209731_10005933 | 3300027326 | Forest Soil | MIASGTEQQRTQAPAESLSAERIAHLEGLVSQAKTAAAVFTQFTQEDSIEL |
Ga0208324_11193202 | 3300027604 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVTQAR |
Ga0208324_11625422 | 3300027604 | Peatlands Soil | MITCEEVQERVQIPLAAESLSEERIAYLERLVSQAR |
Ga0208696_10677221 | 3300027696 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQAR |
Ga0208696_10767483 | 3300027696 | Peatlands Soil | MITQEVLQERVAIPQATESLSPERVAYLEKLVSQAR |
Ga0209811_102518143 | 3300027821 | Surface Soil | MIGIEAVKERVQIPLNAESLSAERIAYLDGLVRQARTAAA |
Ga0209039_101331801 | 3300027825 | Bog Forest Soil | MATREVVPQRVQLPLSTESLSEERIAYLERLVLQAKT |
Ga0209517_102686563 | 3300027854 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVF |
Ga0209415_103893943 | 3300027905 | Peatlands Soil | MATSEVVEKRVQIRLPVESLSEERIAYLEGLVGQARTAAAVFTQYTQ |
Ga0209698_104787163 | 3300027911 | Watersheds | MITSEAVQERVKIPLAAESLSEERITSLERIVSQARTAAAVFTQFTQEDVD |
Ga0255348_10325011 | 3300028268 | Soil | MIASEAVQERAHIPLAAESLSPERIAYLESLVSQARTAAAVFTQFTQ |
Ga0311361_108748451 | 3300029911 | Bog | MATQEVVQQRVQIPLTAESLSEERIATLEGLVSQARIAAAVFTQFTQED |
Ga0310037_102569212 | 3300030494 | Peatlands Soil | MIASETVQERVQIPLAAESLSPERIAYLEGLVSQARTAAAVFT |
Ga0265744_1029361 | 3300031017 | Soil | MNTSEAVMERVQIPVATESLSDERIAYLERLIYQARTAAA |
Ga0265330_103127541 | 3300031235 | Rhizosphere | MTVADAVKERVQIPLAIEGVSAERIAYLEGLVSQARTAAAVFSQFTQEDVD |
Ga0307478_110927621 | 3300031823 | Hardwood Forest Soil | MIASEAIQERAQAPSGKESLTAERMSYLETLVTQARTASAVFTQFTQEEVDQIVKPMVL |
Ga0306926_120992161 | 3300031954 | Soil | MIASEEVERTQLPHATENLSLERMAYLERLVSQAKS |
Ga0311301_101119037 | 3300032160 | Peatlands Soil | MIASEAVQERVQIPLAAEILSEERVAYLEGLINQARTAAAVF |
Ga0311301_106825873 | 3300032160 | Peatlands Soil | MATCEVVQERVQISLAAESLSEERIAYLERLVSQARTAAAVFTQFTQED |
Ga0307472_1004022863 | 3300032205 | Hardwood Forest Soil | MITSDAVKERIKIPLDAEPLPKERIAYLEGLVAQARTAAAVFT |
Ga0348332_121789791 | 3300032515 | Plant Litter | MGVVMNTSEAVLVRIQIPVAADSLSEERIAYLERIVSQART |
Ga0335080_102147091 | 3300032828 | Soil | MIASEAEQKTFKIPLAAESLSAERIAYLERLVDQART |
Ga0335081_100393719 | 3300032892 | Soil | MIANEAVQERVQSPLAAEDLGKERVAYLEGLISRARTAA |
Ga0335081_103207643 | 3300032892 | Soil | MGRSDSVQERMQVPHTEECLSNERIAYLDGLVSQARTAAV |
Ga0335081_124112231 | 3300032892 | Soil | MDTSEAVRERIQIPLAAESLSEERAAYLERLVSRAKTAAAVFTQ |
Ga0334844_111546_414_539 | 3300033743 | Soil | MITHEAAQERIPIPLAAESLSEERIATLDRLVSQARTAAAVF |
⦗Top⦘ |