Basic Information | |
---|---|
Family ID | F018679 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 233 |
Average Sequence Length | 42 residues |
Representative Sequence | MKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 233 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 8.58 % |
% of genes near scaffold ends (potentially truncated) | 60.52 % |
% of genes from short scaffolds (< 2000 bps) | 89.27 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (71.674 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (36.481 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.648 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.652 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 233 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 3.43 |
PF04392 | ABC_sub_bind | 1.72 |
PF00856 | SET | 1.29 |
PF05050 | Methyltransf_21 | 1.29 |
PF04026 | SpoVG | 1.29 |
PF10282 | Lactonase | 1.29 |
PF05598 | DUF772 | 0.86 |
PF04972 | BON | 0.86 |
PF02416 | TatA_B_E | 0.86 |
PF02265 | S1-P1_nuclease | 0.43 |
PF13411 | MerR_1 | 0.43 |
PF05930 | Phage_AlpA | 0.43 |
PF13884 | Peptidase_S74 | 0.43 |
PF12849 | PBP_like_2 | 0.43 |
PF14023 | DUF4239 | 0.43 |
PF13745 | Obsolete Pfam Family | 0.43 |
PF02230 | Abhydrolase_2 | 0.43 |
PF00483 | NTP_transferase | 0.43 |
PF01068 | DNA_ligase_A_M | 0.43 |
PF13924 | Lipocalin_5 | 0.43 |
PF14346 | DUF4398 | 0.43 |
PF04072 | LCM | 0.43 |
PF01717 | Meth_synt_2 | 0.43 |
PF01435 | Peptidase_M48 | 0.43 |
PF01609 | DDE_Tnp_1 | 0.43 |
PF13701 | DDE_Tnp_1_4 | 0.43 |
PF00156 | Pribosyltran | 0.43 |
PF05721 | PhyH | 0.43 |
PF00571 | CBS | 0.43 |
PF00534 | Glycos_transf_1 | 0.43 |
PF00582 | Usp | 0.43 |
COG ID | Name | Functional Category | % Frequency in 233 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.72 |
COG2088 | DNA- and RNA-binding protein SpoVG, cell septation regulator | Transcription [K] | 1.29 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.86 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.43 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.43 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.43 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.43 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG3311 | DNA-binding transcriptional regulator AlpA | Transcription [K] | 0.43 |
COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.43 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.43 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.43 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.43 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.67 % |
Unclassified | root | N/A | 28.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ01DX69P | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_103696877 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1059997 | Not Available | 581 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1040912 | Not Available | 839 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1097393 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10003774 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3463 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10060960 | Not Available | 827 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1057544 | Not Available | 551 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1061593 | Not Available | 532 | Open in IMG/M |
3300000955|JGI1027J12803_101328040 | Not Available | 1113 | Open in IMG/M |
3300000955|JGI1027J12803_101669370 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300000955|JGI1027J12803_102683229 | Not Available | 996 | Open in IMG/M |
3300000956|JGI10216J12902_111596624 | Not Available | 837 | Open in IMG/M |
3300000956|JGI10216J12902_124225654 | Not Available | 573 | Open in IMG/M |
3300002100|JGI24809J26612_1052441 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300004268|Ga0066398_10015955 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300004268|Ga0066398_10172419 | Not Available | 556 | Open in IMG/M |
3300004633|Ga0066395_10695129 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005206|Ga0068995_10128448 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300005295|Ga0065707_10661214 | Not Available | 658 | Open in IMG/M |
3300005332|Ga0066388_101885814 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300005332|Ga0066388_102346743 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300005332|Ga0066388_103656225 | Not Available | 785 | Open in IMG/M |
3300005332|Ga0066388_105762917 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300005332|Ga0066388_106766306 | Not Available | 577 | Open in IMG/M |
3300005468|Ga0070707_101452469 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005518|Ga0070699_101896785 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005713|Ga0066905_100105390 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
3300005713|Ga0066905_100452632 | Not Available | 1056 | Open in IMG/M |
3300005713|Ga0066905_100518574 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300005713|Ga0066905_101020479 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300005713|Ga0066905_101130796 | Not Available | 697 | Open in IMG/M |
3300005713|Ga0066905_101166500 | Not Available | 687 | Open in IMG/M |
3300005713|Ga0066905_101344583 | Not Available | 644 | Open in IMG/M |
3300005713|Ga0066905_101591203 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300005713|Ga0066905_101851182 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300005764|Ga0066903_101753462 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300005764|Ga0066903_103970053 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300005764|Ga0066903_107344509 | Not Available | 569 | Open in IMG/M |
3300005937|Ga0081455_10005104 | All Organisms → cellular organisms → Bacteria | 14479 | Open in IMG/M |
3300005981|Ga0081538_10070241 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
3300005981|Ga0081538_10164790 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300006031|Ga0066651_10713444 | Not Available | 539 | Open in IMG/M |
3300006049|Ga0075417_10018727 | All Organisms → cellular organisms → Bacteria | 2727 | Open in IMG/M |
3300006049|Ga0075417_10054114 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
3300006049|Ga0075417_10181775 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 990 | Open in IMG/M |
3300006844|Ga0075428_100344629 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300006844|Ga0075428_100629941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1144 | Open in IMG/M |
3300006844|Ga0075428_100997787 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300006844|Ga0075428_101435130 | Not Available | 724 | Open in IMG/M |
3300006845|Ga0075421_100918194 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300006845|Ga0075421_102352190 | Not Available | 559 | Open in IMG/M |
3300006846|Ga0075430_100597018 | Not Available | 911 | Open in IMG/M |
3300006847|Ga0075431_100848795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 885 | Open in IMG/M |
3300006852|Ga0075433_10214896 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
3300006852|Ga0075433_11155011 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300006852|Ga0075433_11431690 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300006853|Ga0075420_100183008 | Not Available | 1832 | Open in IMG/M |
3300006853|Ga0075420_100287853 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300006853|Ga0075420_100984381 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300006854|Ga0075425_100222372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2172 | Open in IMG/M |
3300006854|Ga0075425_102517680 | Not Available | 569 | Open in IMG/M |
3300006871|Ga0075434_100281463 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300006871|Ga0075434_101826686 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300006880|Ga0075429_100550997 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300006904|Ga0075424_100266289 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
3300006904|Ga0075424_101902516 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300006914|Ga0075436_100863138 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300006969|Ga0075419_10122509 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
3300006969|Ga0075419_10507387 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300006969|Ga0075419_10566153 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300006969|Ga0075419_10729026 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300006969|Ga0075419_10999189 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300009100|Ga0075418_10604921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1180 | Open in IMG/M |
3300009100|Ga0075418_11744208 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300009147|Ga0114129_10171587 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
3300009147|Ga0114129_10650591 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1360 | Open in IMG/M |
3300009147|Ga0114129_10785047 | Not Available | 1216 | Open in IMG/M |
3300009147|Ga0114129_11314060 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300009147|Ga0114129_12728557 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300009147|Ga0114129_12767780 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300009147|Ga0114129_12976774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
3300009156|Ga0111538_13932403 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300009157|Ga0105092_10029996 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
3300009157|Ga0105092_10263269 | Not Available | 970 | Open in IMG/M |
3300009157|Ga0105092_10266947 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300009157|Ga0105092_10279643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 940 | Open in IMG/M |
3300009157|Ga0105092_10466952 | Not Available | 722 | Open in IMG/M |
3300009162|Ga0075423_10069247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3661 | Open in IMG/M |
3300009162|Ga0075423_10507543 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300009162|Ga0075423_11438340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
3300009162|Ga0075423_11707635 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300009168|Ga0105104_10745969 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300009792|Ga0126374_10021714 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
3300009792|Ga0126374_10058651 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300009792|Ga0126374_10089656 | All Organisms → cellular organisms → Bacteria → PVC group | 1710 | Open in IMG/M |
3300009792|Ga0126374_10181687 | Not Available | 1311 | Open in IMG/M |
3300009792|Ga0126374_10187437 | Not Available | 1295 | Open in IMG/M |
3300009792|Ga0126374_10358388 | Not Available | 1003 | Open in IMG/M |
3300009792|Ga0126374_10389007 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300009792|Ga0126374_10794245 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300009792|Ga0126374_11872134 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300009801|Ga0105056_1000280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3447 | Open in IMG/M |
3300009823|Ga0105078_1042813 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300010043|Ga0126380_10000156 | All Organisms → cellular organisms → Bacteria | 18305 | Open in IMG/M |
3300010043|Ga0126380_10477381 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300010043|Ga0126380_10543474 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300010043|Ga0126380_11089321 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300010043|Ga0126380_11165119 | Not Available | 662 | Open in IMG/M |
3300010043|Ga0126380_11269915 | Not Available | 639 | Open in IMG/M |
3300010046|Ga0126384_10297383 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300010046|Ga0126384_10451598 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300010046|Ga0126384_10869371 | Not Available | 812 | Open in IMG/M |
3300010046|Ga0126384_11089106 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300010046|Ga0126384_11135976 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300010046|Ga0126384_11430885 | Not Available | 645 | Open in IMG/M |
3300010046|Ga0126384_11734116 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300010046|Ga0126384_11882005 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300010046|Ga0126384_12004782 | Not Available | 554 | Open in IMG/M |
3300010047|Ga0126382_10072490 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
3300010047|Ga0126382_10246330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1306 | Open in IMG/M |
3300010047|Ga0126382_10325841 | Not Available | 1165 | Open in IMG/M |
3300010047|Ga0126382_10658076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 872 | Open in IMG/M |
3300010047|Ga0126382_10669977 | Not Available | 865 | Open in IMG/M |
3300010047|Ga0126382_10767394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
3300010047|Ga0126382_10788152 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300010047|Ga0126382_11116057 | Not Available | 700 | Open in IMG/M |
3300010047|Ga0126382_11517534 | Not Available | 617 | Open in IMG/M |
3300010047|Ga0126382_11517543 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010047|Ga0126382_11681563 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300010047|Ga0126382_12325576 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300010154|Ga0127503_10781801 | Not Available | 817 | Open in IMG/M |
3300010358|Ga0126370_11559957 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300010359|Ga0126376_10035520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3415 | Open in IMG/M |
3300010359|Ga0126376_10624541 | Not Available | 1023 | Open in IMG/M |
3300010359|Ga0126376_10834722 | Not Available | 904 | Open in IMG/M |
3300010359|Ga0126376_10903487 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300010359|Ga0126376_12338139 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300010359|Ga0126376_12465778 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300010360|Ga0126372_10117116 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
3300010360|Ga0126372_12096709 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300010361|Ga0126378_10878516 | Not Available | 1004 | Open in IMG/M |
3300010361|Ga0126378_12368432 | Not Available | 606 | Open in IMG/M |
3300010361|Ga0126378_12973256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 540 | Open in IMG/M |
3300010362|Ga0126377_10468096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1286 | Open in IMG/M |
3300010362|Ga0126377_10559113 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300010362|Ga0126377_10681408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1079 | Open in IMG/M |
3300010362|Ga0126377_10687685 | Not Available | 1075 | Open in IMG/M |
3300010362|Ga0126377_11148155 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 846 | Open in IMG/M |
3300010362|Ga0126377_11342531 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300010366|Ga0126379_10726435 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300010376|Ga0126381_100346478 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300010376|Ga0126381_104498685 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300010398|Ga0126383_10082763 | Not Available | 2808 | Open in IMG/M |
3300010398|Ga0126383_10246762 | Not Available | 1749 | Open in IMG/M |
3300010398|Ga0126383_10434099 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300010398|Ga0126383_10843976 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300010398|Ga0126383_11086247 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300010398|Ga0126383_11559196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 750 | Open in IMG/M |
3300010398|Ga0126383_11860520 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300010398|Ga0126383_11911996 | Not Available | 681 | Open in IMG/M |
3300010398|Ga0126383_12747361 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300010398|Ga0126383_13404452 | Not Available | 519 | Open in IMG/M |
3300010398|Ga0126383_13659413 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300012202|Ga0137363_10324358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 1269 | Open in IMG/M |
3300012205|Ga0137362_11386203 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300012211|Ga0137377_10953009 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300012350|Ga0137372_10033588 | All Organisms → cellular organisms → Bacteria | 4683 | Open in IMG/M |
3300012350|Ga0137372_10465336 | Not Available | 946 | Open in IMG/M |
3300012353|Ga0137367_11188809 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300012361|Ga0137360_10062498 | All Organisms → cellular organisms → Bacteria | 2726 | Open in IMG/M |
3300012361|Ga0137360_10861730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 780 | Open in IMG/M |
3300012532|Ga0137373_10411264 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300012929|Ga0137404_10344306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1303 | Open in IMG/M |
3300012929|Ga0137404_10631374 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300012930|Ga0137407_11112459 | Not Available | 749 | Open in IMG/M |
3300012948|Ga0126375_10085249 | Not Available | 1822 | Open in IMG/M |
3300012948|Ga0126375_10221479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1259 | Open in IMG/M |
3300012948|Ga0126375_10324835 | Not Available | 1080 | Open in IMG/M |
3300012948|Ga0126375_10516467 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 894 | Open in IMG/M |
3300012948|Ga0126375_10641304 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300012948|Ga0126375_11131085 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300012948|Ga0126375_11251976 | Not Available | 620 | Open in IMG/M |
3300012948|Ga0126375_11420453 | Not Available | 589 | Open in IMG/M |
3300012948|Ga0126375_11524263 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300012948|Ga0126375_11754199 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300012948|Ga0126375_11968641 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012948|Ga0126375_12041119 | Not Available | 508 | Open in IMG/M |
3300012971|Ga0126369_12124841 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012971|Ga0126369_12417384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
3300015374|Ga0132255_100011170 | All Organisms → cellular organisms → Bacteria | 10516 | Open in IMG/M |
3300016270|Ga0182036_10750574 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300018064|Ga0187773_10089168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1499 | Open in IMG/M |
3300018081|Ga0184625_10154944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1197 | Open in IMG/M |
3300018081|Ga0184625_10215406 | Not Available | 1006 | Open in IMG/M |
3300020579|Ga0210407_11317023 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300021560|Ga0126371_10208011 | Not Available | 2055 | Open in IMG/M |
3300021560|Ga0126371_11842091 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300021560|Ga0126371_13889226 | Not Available | 503 | Open in IMG/M |
3300022756|Ga0222622_11202225 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300026537|Ga0209157_1250113 | Not Available | 699 | Open in IMG/M |
3300027163|Ga0209878_1005630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1817 | Open in IMG/M |
3300027277|Ga0209846_1048105 | Not Available | 658 | Open in IMG/M |
3300027379|Ga0209842_1011674 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300027646|Ga0209466_1002910 | All Organisms → cellular organisms → Bacteria | 3527 | Open in IMG/M |
3300027646|Ga0209466_1012853 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
3300027646|Ga0209466_1053395 | Not Available | 816 | Open in IMG/M |
3300027722|Ga0209819_10052497 | Not Available | 1399 | Open in IMG/M |
3300027722|Ga0209819_10114156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 943 | Open in IMG/M |
3300027722|Ga0209819_10323081 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300027873|Ga0209814_10009653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3783 | Open in IMG/M |
3300027873|Ga0209814_10041359 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
3300027873|Ga0209814_10093169 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1275 | Open in IMG/M |
3300027873|Ga0209814_10317922 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300027873|Ga0209814_10417469 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300027873|Ga0209814_10564402 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300027874|Ga0209465_10216154 | Not Available | 957 | Open in IMG/M |
3300027880|Ga0209481_10177530 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300027909|Ga0209382_10017681 | All Organisms → cellular organisms → Bacteria | 8675 | Open in IMG/M |
3300027909|Ga0209382_11751283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
3300031740|Ga0307468_100547849 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300031744|Ga0306918_10874020 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300031820|Ga0307473_10112877 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1474 | Open in IMG/M |
3300031820|Ga0307473_10312002 | Not Available | 995 | Open in IMG/M |
3300031820|Ga0307473_10469157 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300031833|Ga0310917_10760862 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300031910|Ga0306923_10686452 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300031946|Ga0310910_10332534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1199 | Open in IMG/M |
3300031946|Ga0310910_10700289 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300032174|Ga0307470_10058486 | Not Available | 2018 | Open in IMG/M |
3300032180|Ga0307471_100015314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5373 | Open in IMG/M |
3300032180|Ga0307471_100185661 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
3300032180|Ga0307471_101101682 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 36.48% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 22.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.30% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.15% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.43% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.43% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.00% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.29% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.43% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.43% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.43% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002100 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_03781100 | 2170459024 | Grass Soil | VLADSMKSAIKMAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
INPhiseqgaiiFebDRAFT_1036968771 | 3300000364 | Soil | FIVLADSMKQAIKMAWEHGGAEFQSLFDKTTAQAQKMKEGVLRVL* |
AF_2010_repII_A01DRAFT_10599971 | 3300000580 | Forest Soil | ADHMKFVIKLAWEHGGADFQSRFDKSTGQEEMKEGALGVL* |
AF_2010_repII_A100DRAFT_10409121 | 3300000655 | Forest Soil | VVAEYRKQAINMAWEHGGPDFQVRFDKSSGQAQEMKEGSLRVL* |
AF_2010_repII_A100DRAFT_10973931 | 3300000655 | Forest Soil | NMKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGSLRVL* |
AF_2010_repII_A001DRAFT_100037741 | 3300000793 | Forest Soil | KRAINMAWEHGGSDFQARFDKSTGQAQEMKEGALRVL* |
AF_2010_repII_A001DRAFT_100609601 | 3300000793 | Forest Soil | MKSAINMAWQHGGADFQSRFDESAGQAQEMKEGALRVL* |
AP72_2010_repI_A100DRAFT_10575442 | 3300000837 | Forest Soil | RKQAVNMAWKHGGSDFQARFDKATAQAQKMKEGALRLL* |
AP72_2010_repI_A100DRAFT_10615931 | 3300000837 | Forest Soil | VADSMKSAINMAWQHGEADFQSRFDKSAGQAQEMKEGALRVL* |
JGI1027J12803_1013280401 | 3300000955 | Soil | FIVLADNMKSPIKMAWEHGGADFQSRFDKSTAQAHEMKEGALRVL* |
JGI1027J12803_1016693703 | 3300000955 | Soil | LADSMRQAINMAWEHGGAEFQSLFDKTTAQAQEMKEGVLRVL* |
JGI1027J12803_1026832292 | 3300000955 | Soil | MKSAIKMAWEHGGPDFQPRFDKSTAQAEQMKEGALRVL* |
JGI10216J12902_1115966241 | 3300000956 | Soil | ADNMKSAIKMAWEHGGADFQSRFDKSTAQPEQMKEGVLRVL* |
JGI10216J12902_1242256541 | 3300000956 | Soil | MRHFIVLADIMKSAIKTAREHGGADFQSRFDKSTRQAQEMKEGALRVL* |
JGI24809J26612_10524412 | 3300002100 | Soil | MDDRRASKFIVLAKMKSAIKMTWEHGGADFQSRFDKSTAQAQEMKEGSVRAG |
Ga0066398_100159551 | 3300004268 | Tropical Forest Soil | SHNGDTQSEFIVVAKDRERAINIAWEHGGADFQSRFDKATGQAQEMKECALRVL* |
Ga0066398_101724192 | 3300004268 | Tropical Forest Soil | GDRPSKFIVVAANRKQAINTAWEHGGADFQVRFDKSTGQAQEMKEGALRVL* |
Ga0066395_106951291 | 3300004633 | Tropical Forest Soil | KDRERAINIAWEHGGADFQSRFDKATGQAQEMKECALRVL* |
Ga0068995_101284482 | 3300005206 | Natural And Restored Wetlands | FIVLADNMKSAINMAWEHGGADFQSRFDKSTGQAQEMKEGALRVL* |
Ga0065707_106612142 | 3300005295 | Switchgrass Rhizosphere | GMKFAIKMAWEHGRADFRLRFDKSTAQAQEMKEGALRVL* |
Ga0066388_1018858142 | 3300005332 | Tropical Forest Soil | VAPDRNAAINMAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0066388_1023467431 | 3300005332 | Tropical Forest Soil | VANDRKAAINMAWEHGGADFQSRFDKSTAQAEQMKEGVLRVL* |
Ga0066388_1036562251 | 3300005332 | Tropical Forest Soil | SKFIVVANDRKQAIGIAWEHGEPDFQARFDGSTGRAQEMQEGVLRVL* |
Ga0066388_1057629171 | 3300005332 | Tropical Forest Soil | PDRKAAINMAWEHGGADFQSRFDKSTGQAQEIKEGALRVL* |
Ga0066388_1067663062 | 3300005332 | Tropical Forest Soil | IVVAKDRKQAINIAWEHGGADFQSRFDKSTGEAQEMKEGALRVL* |
Ga0070707_1014524692 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VLADNMKSAIKMAWEHGGTDFQSRFDKSTGQAQEMKEGALRVL* |
Ga0070699_1018967852 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KFIVLADSMKSAINMAYEHGGADFQSRFDKSTAQAEQMKEGVLRVL* |
Ga0066905_1001053901 | 3300005713 | Tropical Forest Soil | RAINIAWEHGGADFQSRFDKATGQAQEMKECALRVL* |
Ga0066905_1004526321 | 3300005713 | Tropical Forest Soil | VINIAWEHAGSDSQSRFDKSTGQAEQMKEGVQPVL* |
Ga0066905_1005185742 | 3300005713 | Tropical Forest Soil | MKSAINMAWEHGGLDFQSRFDKSTAQTQEIKEGLVLVL* |
Ga0066905_1010204791 | 3300005713 | Tropical Forest Soil | FIVLADNMRAAIEMAWEHGRPDFQSRFDKSTAQAQEMKEGALRVL* |
Ga0066905_1011307961 | 3300005713 | Tropical Forest Soil | MKSAIKMAWEHGEPDFHSRFDKPTAQAQGMKEGVLRVL* |
Ga0066905_1011665001 | 3300005713 | Tropical Forest Soil | VKSTINVAWEHGGPDFQSRFDKATGQTQEMKEAALRVL* |
Ga0066905_1013445832 | 3300005713 | Tropical Forest Soil | MKSAINMAWQHGGADFQSRFDKSAGQAQEMKEGALRVL* |
Ga0066905_1015912031 | 3300005713 | Tropical Forest Soil | PAAIEMAWEHGRPDFQSRFDKSTAQAQEMKEGALRVL* |
Ga0066905_1018511823 | 3300005713 | Tropical Forest Soil | FIVLADNMRAAIEMAWEHGRPDFQSRFDKSTAQAQEMKEDALRVL* |
Ga0066903_1017534623 | 3300005764 | Tropical Forest Soil | MKSAINMAWEHGGPDFQSRFDKSTAQAEEMKAGALRVL* |
Ga0066903_1039700531 | 3300005764 | Tropical Forest Soil | KFIVLADNMKSAINMAWEHGGADFQSRFDKATGQAQEMKEGALRVL* |
Ga0066903_1073445091 | 3300005764 | Tropical Forest Soil | MKSAINTAWQHGGADFQSRFDKSAGQAQEMKEGALRVL* |
Ga0081455_1000510410 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MQSAINVAGDHGGADFQSRFDKSTAQAEQMKEGVLRVL* |
Ga0081538_100702411 | 3300005981 | Tabebuia Heterophylla Rhizosphere | ADNMGEAINMAWEHGGTDFQSRFDKSTAQAIEMKKGALRVL* |
Ga0081538_101647902 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MKAAINMAWEHGGADFQSRFDKSTAQAEQMKAGALRVL* |
Ga0066651_107134442 | 3300006031 | Soil | FIVLADSMKSAINMAWDHGGPDFQARFDKSTGQAQEMKEGALRVL* |
Ga0075417_100187272 | 3300006049 | Populus Rhizosphere | MKSAIKMAWEHGGADFQSRFDKSTAQAEQMKEGRCGFCDA* |
Ga0075417_100541144 | 3300006049 | Populus Rhizosphere | MKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075417_101817751 | 3300006049 | Populus Rhizosphere | MKSAINKAWEHGGADFQSRFDKSTAQAAEMKEGALRVL* |
Ga0075428_1003446291 | 3300006844 | Populus Rhizosphere | KMTWEHGGADFQSRFDKSTAQAQEMKEGSVRAGSTTL* |
Ga0075428_1006299412 | 3300006844 | Populus Rhizosphere | MRAAIKMAWEHGGADFQSRYDKSTAQAEEMKEGALRVL* |
Ga0075428_1009977873 | 3300006844 | Populus Rhizosphere | AINMAWEHGGADFQSRFDKSTVQAEQMKGGALRVL* |
Ga0075428_1014351301 | 3300006844 | Populus Rhizosphere | SMKSAIKIAWEHGGADFQSRFDKSTQAEQMKEGVLRVR* |
Ga0075421_1009181942 | 3300006845 | Populus Rhizosphere | MRSAINMAWEHGGADFRSRFDKSTGQAAEMKEGALRVL* |
Ga0075421_1023521903 | 3300006845 | Populus Rhizosphere | RPSKFIVLADSMKSAIKMAWENGGGDFQSRFDKATGQAQEMKEGALRVL* |
Ga0075430_1005970182 | 3300006846 | Populus Rhizosphere | KFIVLADNMKSAITKAWEHGADFQSRFDKSTAQAEQMKEGRCGFCDA* |
Ga0075431_1008487951 | 3300006847 | Populus Rhizosphere | DSMKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075433_102148962 | 3300006852 | Populus Rhizosphere | MKSAIKVAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075433_111550112 | 3300006852 | Populus Rhizosphere | MKSAINKAWEHGGADFQSRFDKSTAQAEQMKEGALRVL* |
Ga0075433_114316901 | 3300006852 | Populus Rhizosphere | RRPSKFIVLADSMKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075420_1001830083 | 3300006853 | Populus Rhizosphere | RPSKFIVLADSMKSAINMAWEHGGVDFQSRFDKSTVQAEQMKGGALRVL* |
Ga0075420_1002878533 | 3300006853 | Populus Rhizosphere | DNMKSAIKLAWEHGGSDFQSRLDKSTGQAQEMKEGALRVL* |
Ga0075420_1009843811 | 3300006853 | Populus Rhizosphere | RPSKFIVLADDMRAAINMAWEHGGVDFQSRFDKSTAQAEQMKEGALRVL* |
Ga0075425_1002223723 | 3300006854 | Populus Rhizosphere | VADNMKSAINKAWEHGGADFQSRFDKSTAQAEQMKEGALRVL* |
Ga0075425_1025176802 | 3300006854 | Populus Rhizosphere | DRRPSKFIVLADNMKSAIIKAREHGGADFQSRFDKSTGQAAEMKEGALRVL* |
Ga0075434_1002814635 | 3300006871 | Populus Rhizosphere | DNMKSAIKMAWEHGGADFQSRFDKSTAQAQEMKDGALRVL* |
Ga0075434_1018266861 | 3300006871 | Populus Rhizosphere | MRAAINMVWEHGGPDFQSRFDKSTAQAEQMKEGVTRPMNIFE |
Ga0075429_1005509972 | 3300006880 | Populus Rhizosphere | VADNMKSAIKMAWEHGGANFQSRFDKSTAQAVEMKEGALRVL* |
Ga0075424_1002662891 | 3300006904 | Populus Rhizosphere | INKAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075424_1019025162 | 3300006904 | Populus Rhizosphere | MRAAINMAWEHGGVDFQSRFDKSTAQAEQMKEGALRVL* |
Ga0075436_1008631383 | 3300006914 | Populus Rhizosphere | LADNMKSAIKMAWEHGGADFQSRFDKSTAQAQEMKDGALRVL* |
Ga0075419_101225091 | 3300006969 | Populus Rhizosphere | VADKMKSAIKMTWEHGGADFQSRFDKSTAQAQEMKEGSVRAGSTTL* |
Ga0075419_105073871 | 3300006969 | Populus Rhizosphere | MKPAINMAWEHGGSDFQSRFDKSTAQAEQMKEGALR |
Ga0075419_105661531 | 3300006969 | Populus Rhizosphere | IKTAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075419_107290261 | 3300006969 | Populus Rhizosphere | RPSKFIVLADNMKSAIKTAWEHGGADFQSRFDKSTAQAEQMKEGALRVL* |
Ga0075419_109991891 | 3300006969 | Populus Rhizosphere | MKDEAKSAINMAWEHGGSDFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075418_106049212 | 3300009100 | Populus Rhizosphere | MKSAIKKAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075418_117442081 | 3300009100 | Populus Rhizosphere | MKPAINMAWEHGGSDFQSRFDKSTAQAEEMKEGALRVL* |
Ga0114129_101715871 | 3300009147 | Populus Rhizosphere | RPSKFIVVADNMKSAIKTAWEHGGADFQSRFDKSTAQAQEMKEEALRVL* |
Ga0114129_106505913 | 3300009147 | Populus Rhizosphere | PSKFIVLADNMKSAINKAWEHGGADFQSRFDKSTAQAAEMKEGALRVL* |
Ga0114129_107850471 | 3300009147 | Populus Rhizosphere | SSWPTIQAINVAWEHGGADFQARFDKATGQAQEMKAGVLRIL* |
Ga0114129_113140602 | 3300009147 | Populus Rhizosphere | AIKMAWEHGGADFQSRFDKSTAQAEQMKEGALRVL* |
Ga0114129_127285573 | 3300009147 | Populus Rhizosphere | HQLAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0114129_127677802 | 3300009147 | Populus Rhizosphere | LADNMRSAINMAWEHGGADFQSRFDKSTAQTEQMKEGALRVL* |
Ga0114129_129767741 | 3300009147 | Populus Rhizosphere | FIVLADNMKSAIKLAWEHGGSHFQSRFDKSTGQAQEMKEGALRVP* |
Ga0111538_139324032 | 3300009156 | Populus Rhizosphere | VLADNMKSAINMAWEHGGADFQSRFDKSTAQAEQMKEGALRVL* |
Ga0105092_100299961 | 3300009157 | Freshwater Sediment | DRRPSKFIVLADNMKSAIKMAWEHGGVDFQSRFDKSTAQALEMKEGVLRVL* |
Ga0105092_102632692 | 3300009157 | Freshwater Sediment | MRAAINKAWEHGGADFQWQFDKSTAQAREMKEALRIL* |
Ga0105092_102669472 | 3300009157 | Freshwater Sediment | VKDDAKSAIKMALEHGGVDFQSRFGKSTAQAEQMKEGVLR |
Ga0105092_102796431 | 3300009157 | Freshwater Sediment | MKSAINVAWEHGGADFRLRFDKSTAQAEQMKEGALRVL* |
Ga0105092_104669522 | 3300009157 | Freshwater Sediment | MKSAINMAWEHGGTDFRLRFDKSTAQAEQMKEGALRVL* |
Ga0075423_100692471 | 3300009162 | Populus Rhizosphere | RPSKFIVLADNMKSAIKVAWEHGGSDFQSRFDKSTAQAEQMKEGALRVL* |
Ga0075423_105075432 | 3300009162 | Populus Rhizosphere | MKSAIKMAWEHGGADFQSRFDKSTAQAVEMKEGALRVL* |
Ga0075423_114383401 | 3300009162 | Populus Rhizosphere | DRRPSKFIVLADNMKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0075423_117076351 | 3300009162 | Populus Rhizosphere | RPSKFIVLADNMRSAISKAWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0105104_107459691 | 3300009168 | Freshwater Sediment | MKSAINMAWEHGGADFRLRFDKSTGQAQEMKEGALRVL* |
Ga0126374_100217145 | 3300009792 | Tropical Forest Soil | MKSAINMAWEHGGADFQSRFDKLTAQAEQMKEGALRVL* |
Ga0126374_100586512 | 3300009792 | Tropical Forest Soil | MSAQNPRNVVANDRKQAVDMAWEHGGADFQSRFDKSTGQAQEMKEGALRVL* |
Ga0126374_100896561 | 3300009792 | Tropical Forest Soil | NDRKQAINMAWEHGGADFQSRFDKSTGQAHEMKEGALRVL* |
Ga0126374_101816872 | 3300009792 | Tropical Forest Soil | MKSSINMAWEHGGADFQSRFDKSTGQAQEMKAGALRVL* |
Ga0126374_101874372 | 3300009792 | Tropical Forest Soil | MKSAIKMAWEHGGPDFQARFDKSTGQAQEMKEGALRVL* |
Ga0126374_103583883 | 3300009792 | Tropical Forest Soil | MKSAIKMAWEHGGPDFQSRLDKTTAQAELIKEGVLRVL* |
Ga0126374_103890071 | 3300009792 | Tropical Forest Soil | KSAINMAWEHGGADFQSRFDKSTGQAQEMKEGVLRVL* |
Ga0126374_107942451 | 3300009792 | Tropical Forest Soil | MKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGAL |
Ga0126374_118721341 | 3300009792 | Tropical Forest Soil | RPSKFIVVANDRKAAINMAWEHGGADFQSRFDKSTAQAEQMKEGVLRVL* |
Ga0105056_10002802 | 3300009801 | Groundwater Sand | MKSAIKMAWDHGGADFQSRFDKSTAQAAEMKEGALRVL* |
Ga0105078_10428131 | 3300009823 | Groundwater Sand | GRPSKFIVLADSMKSAIKMAWDHGGADFQSRFDKSTAQAAEMKEGALRVL* |
Ga0126380_1000015615 | 3300010043 | Tropical Forest Soil | MKSAINMTWEHGGLDFQSRFDKSTAQTQEIKEGLVLVL* |
Ga0126380_104773811 | 3300010043 | Tropical Forest Soil | MKSATNIAWEHGGPDFQVRFDKSTGQAQEMKEGVLRVL* |
Ga0126380_105434741 | 3300010043 | Tropical Forest Soil | AIEMAWEHGRPDFQSRFDKSTAQAQEMKEGALRVL* |
Ga0126380_110893213 | 3300010043 | Tropical Forest Soil | IVLADNMRAAIEMAWEHGRPDFQSRFDKSTAQAQEMKEDALRVL* |
Ga0126380_111651193 | 3300010043 | Tropical Forest Soil | ADNMKSAIKMAWEHGGPDFQSRLDKTTAQAELIKEGVLRVL* |
Ga0126380_112699152 | 3300010043 | Tropical Forest Soil | MKFVIKLAREHGGADFQSRFDKSTGQEEMKEGALGIL* |
Ga0126384_102973831 | 3300010046 | Tropical Forest Soil | VICMSDQNPRNVVANDRKQAVDMAWEHGGADFQSRFDKSTGQAREMKEGALRVL* |
Ga0126384_104515983 | 3300010046 | Tropical Forest Soil | MKAAIKLAWEHGGADFQSRFDKSTAQAEQMKEGVLRVL* |
Ga0126384_108693711 | 3300010046 | Tropical Forest Soil | RPSKFIVVANDGKEAIKMAWKHGGPDLQARFDKAAGQAQEMKEG* |
Ga0126384_110891062 | 3300010046 | Tropical Forest Soil | MKSAITMAWEHGGADFQSRFDKSTAQAEQMKEGVLRVL* |
Ga0126384_111359762 | 3300010046 | Tropical Forest Soil | MKSAINMAWEHGGADFQSRFDKSTGQAQEMKEGALRVL* |
Ga0126384_114308851 | 3300010046 | Tropical Forest Soil | HNDDRPSKFIVIANDRKQAINIAWEHGGPDFQVRFDKATGQAQE* |
Ga0126384_117341162 | 3300010046 | Tropical Forest Soil | MRAAINIAWEKGGPDFQVRFDKSTAQAEQMKEGALRVL* |
Ga0126384_118820051 | 3300010046 | Tropical Forest Soil | MKQAINMAWEHGGAEFQSLFDKTTAQAQEMKEGVLR |
Ga0126384_120047821 | 3300010046 | Tropical Forest Soil | MKSAIKLAWDHGGPDFQARFDKSTAQAQEMKEGALRVL* |
Ga0126382_100724903 | 3300010047 | Tropical Forest Soil | VAANRKQAINMAWEHGGLDFQARFDKSTGQGQEMKEGALRIL* |
Ga0126382_102463301 | 3300010047 | Tropical Forest Soil | AINTAWEHGGPDFQVRFDKASGQAQEMKEGALRVL* |
Ga0126382_103258413 | 3300010047 | Tropical Forest Soil | CLGWPSKFIVLADNMPAAIEMAWEHGRPDFQSRFDKSTVQAQEMKEGVLRVL* |
Ga0126382_106580761 | 3300010047 | Tropical Forest Soil | IVLAENMKSAINMAWENGGADFQSRFDKLTAQAEQMKEGALRVL* |
Ga0126382_106699771 | 3300010047 | Tropical Forest Soil | SAIKMAWEHGEGPDFQSRFDKSTAHAQEIREGVLRAL* |
Ga0126382_107673943 | 3300010047 | Tropical Forest Soil | AVNMKSVIKIAWEHGGADFQLRFDKSTAQAEQMKQGALRVL* |
Ga0126382_107881521 | 3300010047 | Tropical Forest Soil | SKFIVLADNMRAAINMAWEHGGVDFQSRFDKSTAQAQEMKEGALRAL* |
Ga0126382_111160571 | 3300010047 | Tropical Forest Soil | ADDRKQAINIAWEHGGPDFQSRFDKATGQAQEMKEGALRVL* |
Ga0126382_115175342 | 3300010047 | Tropical Forest Soil | MMTAGPSMFIALANNMKSVIKLARQHGGADFQSWFDKSRGQAQEMKEGALGVL* |
Ga0126382_115175431 | 3300010047 | Tropical Forest Soil | SAIKMAWEHGGADFQARFDKSTGQAQEMKEGALRVL* |
Ga0126382_116815633 | 3300010047 | Tropical Forest Soil | MKSAINKPWEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0126382_123255762 | 3300010047 | Tropical Forest Soil | MRAAINIAWEHGEPDFQSRFDKSTAQAEQMKNGALR |
Ga0127503_107818012 | 3300010154 | Soil | MKSAIKTAWEHGGTDFQSRFDKSTGQAQEMKEGVLRVL* |
Ga0126370_115599571 | 3300010358 | Tropical Forest Soil | MKSAINVAWEHGGTDFQLRFDKSTAQAEQMKEGALRVL* |
Ga0126376_100355201 | 3300010359 | Tropical Forest Soil | MSDQNPRNVVANDRKQAVDMAWEHGGADFQSRFDKSTGQAQEMKEGALRVL* |
Ga0126376_106245413 | 3300010359 | Tropical Forest Soil | RHQTAWEHGGPDFQSRFDKSTAQVQEMKEGVLRVL* |
Ga0126376_108347221 | 3300010359 | Tropical Forest Soil | VAANRKQAINTAWEHGGADFQVRFDKSTGQAQEMKEGALRVL* |
Ga0126376_109034872 | 3300010359 | Tropical Forest Soil | SKFIVLADNMKSAINMAWEHGGADFQSRFDKSTAQAQEMKQGALRVL* |
Ga0126376_123381391 | 3300010359 | Tropical Forest Soil | AINMAWEHGGGDFQSRFDKSTAQAEQMKEGALRVL* |
Ga0126376_124657781 | 3300010359 | Tropical Forest Soil | MKSVIKIAWEHGGADFQLRFDKSTAQAEQMKEGALRVL* |
Ga0126372_101171166 | 3300010360 | Tropical Forest Soil | MSAQNPRNVVANDRKQAVDMAWEHGGADFQSRFDKSTGQAREMKEGALRVL* |
Ga0126372_120967091 | 3300010360 | Tropical Forest Soil | MVVADNMKSAIKMAGEHGGADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0126378_108785162 | 3300010361 | Tropical Forest Soil | FIVVADNRKQAINKPWEHGGPDFQVRFDKSSGQAQEMKEGSLRVL* |
Ga0126378_123684321 | 3300010361 | Tropical Forest Soil | ISINMAWEHGGPDFQARFDKSTAQAEQMKEGALRVL* |
Ga0126378_129732561 | 3300010361 | Tropical Forest Soil | MKSAINIAWEHGGSDFQARFDKSTGQAQVMKEGALRVL* |
Ga0126377_104680962 | 3300010362 | Tropical Forest Soil | MKSAINMAWGHGGADFQLRFDKSTAQAEQMKEGALRVL* |
Ga0126377_105591132 | 3300010362 | Tropical Forest Soil | MKAAINMAWEQGGKDFQSRFDKSTGQAQEMKEGALRFL* |
Ga0126377_106814081 | 3300010362 | Tropical Forest Soil | VATDRKQAINMAWEHGGPDFQVRFDKTSGQAQEMKEGALRVL* |
Ga0126377_106876851 | 3300010362 | Tropical Forest Soil | KFIVLAGNMKSAIKMSWEHGGPDFQSRFDKSTGQVQEMKEGALRVL* |
Ga0126377_111481552 | 3300010362 | Tropical Forest Soil | IVLADGRKEAIQMAWEHGGPDFQARFDKSTAQAQEMKEGVLRVL* |
Ga0126377_113425311 | 3300010362 | Tropical Forest Soil | VLADNMKSAINMAWEHGGGDFQSRFDKSTAQAEQIKEGPLRVL* |
Ga0126379_107264352 | 3300010366 | Tropical Forest Soil | MKSAINMAWEHGGGDFQSRFDKSTAQAEQIKEGAVRVL* |
Ga0126381_1003464785 | 3300010376 | Tropical Forest Soil | MRAAVEMAWEHGMADFQSRFDKSTAQAQEMKEGALRVL* |
Ga0126381_1044986851 | 3300010376 | Tropical Forest Soil | MKSAINMAWEHGGADFQSRFDKSTAQEMKEGGFWLMLK |
Ga0126383_100827631 | 3300010398 | Tropical Forest Soil | KFIVVANNMRAAINIAWEKGGPDFQVRFDKATGQAQEMKEGALRVL* |
Ga0126383_102467623 | 3300010398 | Tropical Forest Soil | PSKFIVVAEYRKQAINMAWEHGGPDFQLRFDKSSGQAQEMKEGSLRVL* |
Ga0126383_104340992 | 3300010398 | Tropical Forest Soil | MKSAIKMAWEHGGTDFQSRFDKSTAQAQEMKEGALRVL* |
Ga0126383_108439761 | 3300010398 | Tropical Forest Soil | VANDRKQAINMAWEHGGADFQLRFDKSTAQAEQMKDGVLLA* |
Ga0126383_110862472 | 3300010398 | Tropical Forest Soil | MTTADRSKFIVLTDNMRAAINMAWEHGGADFQSRFDKSTAQAIEMKKGGAKAL* |
Ga0126383_115591962 | 3300010398 | Tropical Forest Soil | MKSAIKMAWEHGGSDFQSRFDKSTGQAQEMKEGALRVL* |
Ga0126383_118605203 | 3300010398 | Tropical Forest Soil | MKSAINMAWEHGGPDFQARFDKSTAQAQEMKEGALRVL* |
Ga0126383_119119961 | 3300010398 | Tropical Forest Soil | MKSAIKMAWEHGEPDFQSRFDKSTAQAEQMKNGAL |
Ga0126383_127473612 | 3300010398 | Tropical Forest Soil | SKFIVLADNMRSAINMAWEHGGADFQSRFDKSTAEAQEMKQGALRVL* |
Ga0126383_134044521 | 3300010398 | Tropical Forest Soil | MKSAINMAWQHGGADFQSRLDKSAGQAQEMKEGVLRVL* |
Ga0126383_136594132 | 3300010398 | Tropical Forest Soil | MKSAINMAWEHGGPDFQSRFDKSTAQAEQIKEGALRVL* |
Ga0137363_103243581 | 3300012202 | Vadose Zone Soil | RRPSKFIVLADNMRSAIKMAWEHGGVDFQSRFDKSTGQAQEMKEGALRVL* |
Ga0137362_113862031 | 3300012205 | Vadose Zone Soil | MKSAIKMAWEHGGTDFQSRFDKSTGQAQEMKEGALRVL* |
Ga0137377_109530093 | 3300012211 | Vadose Zone Soil | PSKFIVLADSMKSAIKMAWEHGGADFQSRFDKSTAQAQEMKEGSLRVL* |
Ga0137372_100335886 | 3300012350 | Vadose Zone Soil | FIVLADNMKSAINKAWEHGGPDFQSRFDKSTAQAQEMKEGALRVL* |
Ga0137372_104653361 | 3300012350 | Vadose Zone Soil | VMSHFIVLADSMKSAIKTAWEHGGADFQSRFDKSTRQAQEMKEGALRVL* |
Ga0137367_111888091 | 3300012353 | Vadose Zone Soil | IILADSMKSAINMAWEHGGADFQSRFDKSTAQAAAIKEGALRVL* |
Ga0137360_100624983 | 3300012361 | Vadose Zone Soil | MRAAIKMAWEHGGTDFQSRFDKSTAQAQEMKEGVLRVL* |
Ga0137360_108617301 | 3300012361 | Vadose Zone Soil | MKSAIKKAWEHGGANFQSRFDKSTGQAQEMKEGALRVL* |
Ga0137373_104112641 | 3300012532 | Vadose Zone Soil | MKSAIKAAWDHGGADFQSRFDKSTGQAQEMKEGALRV |
Ga0137404_103443062 | 3300012929 | Vadose Zone Soil | MKSAINKAWEHGGADFQSRFDKSTGQAQEMKEGVLRVL* |
Ga0137404_106313742 | 3300012929 | Vadose Zone Soil | MKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGSLRVL* |
Ga0137407_111124592 | 3300012930 | Vadose Zone Soil | ADNMKSAINKAWEHGGVDFQSRFDKSTAQAEQMKEGAIRIL* |
Ga0126375_100852491 | 3300012948 | Tropical Forest Soil | MKSAINMAWEHGGADFQSRFDKSTAQEMKKGGFWLMLKDSG |
Ga0126375_102214791 | 3300012948 | Tropical Forest Soil | NDRKQAINMAWEHGGADFQSRFDKSTGQAQEMKEGALRVL* |
Ga0126375_103248351 | 3300012948 | Tropical Forest Soil | NRPSIMAWEHGAFQSRFNKSTGQAQEMKEGALRVL* |
Ga0126375_105164671 | 3300012948 | Tropical Forest Soil | NDCPSKFIVLADGRKEAIQMAWEHEALDFQARFYKSTAQAQEMKEGVLRVL* |
Ga0126375_106413041 | 3300012948 | Tropical Forest Soil | MKSAINVAWEHGGADFQLRFDKSTAQAEQMKEGALR |
Ga0126375_111310852 | 3300012948 | Tropical Forest Soil | MKSAIKIAWEHGGGDFQSRFDKSTAQAQEMKEGALRVL* |
Ga0126375_112519761 | 3300012948 | Tropical Forest Soil | KFIVVATDRKQAVNMAWKHGGSDFQARFDKATAQAQEMKEGALRLL* |
Ga0126375_114204531 | 3300012948 | Tropical Forest Soil | IVVADNMKSAINLAWEHGGADFQSRFDKSTGQAQEMKEGALRIL* |
Ga0126375_115242631 | 3300012948 | Tropical Forest Soil | MATGRPSFIVVADNMKSAINRAWEHGGAGFQSRFDKSTAQAQEMKEGALRV |
Ga0126375_117541992 | 3300012948 | Tropical Forest Soil | GLPNDRKAAIKIAWEHGGAYFQSRFDRATAQAQEMKEGALRVL* |
Ga0126375_119686411 | 3300012948 | Tropical Forest Soil | MRAAIEMAWENGGADFQSRFDKSTGQAQEMKEGVLRVL* |
Ga0126375_120411191 | 3300012948 | Tropical Forest Soil | SKFIVVANDRKAAINMAWEHEGADFQSRFDKSTGQAQEMKEGALRVL* |
Ga0126369_121248412 | 3300012971 | Tropical Forest Soil | VVTDNMKSAINIAWEHGGADFQSRFDRSRAQAQEMKEGALRVL* |
Ga0126369_124173842 | 3300012971 | Tropical Forest Soil | IVVANNMRAAINIAWEKGGPDFQVGFDKSSGQAQEIKEGALRVL* |
Ga0132255_1000111701 | 3300015374 | Arabidopsis Rhizosphere | MKSAIKMEWEHGGPDFQSRFDKSTGHAQEMKEGALRVL* |
Ga0182036_107505741 | 3300016270 | Soil | KFIVLGGNMKSAINMAWEHGGADFQSRFDKSTGQEQQMKEGALRVL |
Ga0187773_100891681 | 3300018064 | Tropical Peatland | ANDMKEAIKMAWEHGGSEFQALFDRTTAQGQEMKEGALRVL |
Ga0184625_101549441 | 3300018081 | Groundwater Sediment | KSAIKTAWDHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0184625_102154061 | 3300018081 | Groundwater Sediment | DRRPSKFIVLADNMKSAISKAWEHGGPDFQSRFDKSTGQALEMKQGVLRVL |
Ga0210407_113170232 | 3300020579 | Soil | HPATRRTSKFIVLADSMKSAINMAYEHGGADFQSRFDKSTAQAEQMKEGVLRVL |
Ga0126371_102080113 | 3300021560 | Tropical Forest Soil | MKSAINMAWQHGGADFQSRLDKSAGQAQEMKEGALRVL |
Ga0126371_118420912 | 3300021560 | Tropical Forest Soil | YGDRPSKFIVVAKDRKQAINIAWDHGGLDFQARFDKSTGQTQEMKEGCCGFCK |
Ga0126371_138892261 | 3300021560 | Tropical Forest Soil | KFIVVADNMKSAINMAWEHGGLDFQSRFDKSTAQTQEIKEGLVLVL |
Ga0222622_112022251 | 3300022756 | Groundwater Sediment | PSKFIVLADNMKSAIKMAWEHGGADFQSRFDKATAQAEEMKAGALRVL |
Ga0209157_12501132 | 3300026537 | Soil | ADSMKSAINMAWDHGGPDFQARFDKSTGQAQEMKEGALRVL |
Ga0209878_10056301 | 3300027163 | Groundwater Sand | GRPSKFIVLADSMKSAIKMAWDHGGADFQSRFDKSTAQAAEMKEGALRVL |
Ga0209846_10481051 | 3300027277 | Groundwater Sand | SAINMAWEHGGPDFQSRFDKSTGQAQEMKEGALRVL |
Ga0209842_10116743 | 3300027379 | Groundwater Sand | MKSAIKMAWDHGGADFQSRFDKSTAQAAEMKEGALRVL |
Ga0209466_10029103 | 3300027646 | Tropical Forest Soil | MKSAINMAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0209466_10128532 | 3300027646 | Tropical Forest Soil | KFIVVAKDRKQAINIAWDHGGLDFQARFDKSTGQTQEMKEGCCGFCK |
Ga0209466_10533951 | 3300027646 | Tropical Forest Soil | MKSAINMAWQHGGADFQSRFDKSAGQAQEMKEGALRVL |
Ga0209819_100524974 | 3300027722 | Freshwater Sediment | PCSVLADNMKSAINMAWEHGGTDFRLRFDKSTAQAEQMKEGALRVL |
Ga0209819_101141562 | 3300027722 | Freshwater Sediment | MKSAINVAWEHGGADFRLRFDKSTAQAEQMKEGALRVL |
Ga0209819_103230812 | 3300027722 | Freshwater Sediment | AITMAWEHGGADFQSRFDKSTGQAQEMKEGALRVL |
Ga0209814_100096535 | 3300027873 | Populus Rhizosphere | MRAAIKMAWEHGGADFQSRYDKSTAQAEEMKEGALRVL |
Ga0209814_100413593 | 3300027873 | Populus Rhizosphere | NMKSAIKMAWEHGGADFQSRFDKSTAQAEQMKEGALRVL |
Ga0209814_100931693 | 3300027873 | Populus Rhizosphere | MKSAINKAWEHGGADFQSRFDKSTAQAAEMKEGALRVL |
Ga0209814_103179222 | 3300027873 | Populus Rhizosphere | SRPSKFIVLADNMKSAINKAWEHGGADFQSRFDKSTAQARGMKEDVLRVL |
Ga0209814_104174691 | 3300027873 | Populus Rhizosphere | FIVLADNMKSAIKTAWEHGGADFQSRFDKSTAQAEQMKEGALRVL |
Ga0209814_105644021 | 3300027873 | Populus Rhizosphere | MKSAIKVAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0209465_102161542 | 3300027874 | Tropical Forest Soil | KQAINIAWDHGGLDFQARFDKSTGQTQEMKEGCCGFCK |
Ga0209481_101775301 | 3300027880 | Populus Rhizosphere | FIVLADNMKSAIKMAWEHGGADFQSRFDKSTAQAQEMKEGTLRVL |
Ga0209382_1001768118 | 3300027909 | Populus Rhizosphere | SKFIVLADNMKSAINMAWEHGGADFQSRFDKSTAQAAEMKEGALRVL |
Ga0209382_117512832 | 3300027909 | Populus Rhizosphere | MKSAIKKAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0307468_1005478491 | 3300031740 | Hardwood Forest Soil | VLADNMRSAIEKAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0306918_108740202 | 3300031744 | Soil | MKSAINMAWEHGGADFQSRFDKSTGQTQQMKEGALRVL |
Ga0307473_101128772 | 3300031820 | Hardwood Forest Soil | ARPSKFIVLADNMKSDIKMAWDHGGADFQSRFDKSTGQAQEMKEGALRVL |
Ga0307473_103120021 | 3300031820 | Hardwood Forest Soil | VADSMKSAIKTAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0307473_104691572 | 3300031820 | Hardwood Forest Soil | MKSAIKMAWEHGGADFQSRFDKSTAQAEEMKEGALRVL |
Ga0310917_107608621 | 3300031833 | Soil | RRPSKFIVLGDNMKSAINMAWEHGGADFQSRFDKSTGQTQQMKEGALRVL |
Ga0306923_106864522 | 3300031910 | Soil | MKSAINMAWEHGGADFQSRFDKSTGQAQQMKEGALRVL |
Ga0310910_103325341 | 3300031946 | Soil | KSRNIMAGNMKATINMAWEHGGADFQSRFDKSTGEAQQMKEGALRVL |
Ga0310910_107002891 | 3300031946 | Soil | IVLAGNMKSAINMAREHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0307470_100584865 | 3300032174 | Hardwood Forest Soil | RAAINKAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0307471_1000153145 | 3300032180 | Hardwood Forest Soil | MKSAIKMAWEHGGTDFQSRFDKSTGQAQEMKEGALRVL |
Ga0307471_1001856611 | 3300032180 | Hardwood Forest Soil | MRAAINKAWEHGGADFQSRFDKSTAQAQEMKEGALRVL |
Ga0307471_1011016822 | 3300032180 | Hardwood Forest Soil | MKSAIKMAWEHGGADFQSRFDKSTGQALEMKSDALRVL |
⦗Top⦘ |