Basic Information | |
---|---|
Family ID | F018604 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 234 |
Average Sequence Length | 39 residues |
Representative Sequence | MKVVVIIPAAGLGTRMASPPSGKGKKAGPSKQFTELGGTP |
Number of Associated Samples | 204 |
Number of Associated Scaffolds | 234 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 9.40 % |
% of genes near scaffold ends (potentially truncated) | 99.57 % |
% of genes from short scaffolds (< 2000 bps) | 88.46 % |
Associated GOLD sequencing projects | 193 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.197 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.256 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.231 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.291 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 234 Family Scaffolds |
---|---|---|
PF01938 | TRAM | 37.18 |
PF06094 | GGACT | 2.99 |
PF01171 | ATP_bind_3 | 2.56 |
PF00903 | Glyoxalase | 1.71 |
PF10417 | 1-cysPrx_C | 1.28 |
PF14885 | GHL15 | 0.85 |
PF04342 | DMT_6 | 0.85 |
PF01850 | PIN | 0.85 |
PF00654 | Voltage_CLC | 0.43 |
PF03725 | RNase_PH_C | 0.43 |
PF12826 | HHH_2 | 0.43 |
PF01712 | dNK | 0.43 |
PF07676 | PD40 | 0.43 |
PF01066 | CDP-OH_P_transf | 0.43 |
PF00069 | Pkinase | 0.43 |
PF00781 | DAGK_cat | 0.43 |
PF05187 | ETF_QO | 0.43 |
PF10431 | ClpB_D2-small | 0.43 |
PF04014 | MazE_antitoxin | 0.43 |
PF03331 | LpxC | 0.43 |
PF00005 | ABC_tran | 0.43 |
PF00872 | Transposase_mut | 0.43 |
PF01740 | STAS | 0.43 |
PF09364 | XFP_N | 0.43 |
PF01138 | RNase_PH | 0.43 |
PF02470 | MlaD | 0.43 |
PF00107 | ADH_zinc_N | 0.43 |
PF13183 | Fer4_8 | 0.43 |
PF04138 | GtrA | 0.43 |
PF03364 | Polyketide_cyc | 0.43 |
PF04041 | Glyco_hydro_130 | 0.43 |
COG ID | Name | Functional Category | % Frequency in 234 Family Scaffolds |
---|---|---|---|
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 2.56 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 2.56 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 2.56 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 2.56 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 2.56 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 2.56 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.71 |
COG3169 | Uncharacterized membrane protein, DMT/DUF486 family | Function unknown [S] | 0.85 |
COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 0.85 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.85 |
COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.85 |
COG2440 | Ferredoxin-like protein FixX | Energy production and conversion [C] | 0.43 |
COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.43 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.43 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.43 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.43 |
COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 0.43 |
COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.43 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.43 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.20 % |
Unclassified | root | N/A | 18.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004080|Ga0062385_10858873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 599 | Open in IMG/M |
3300004092|Ga0062389_101469045 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300004092|Ga0062389_104620671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 518 | Open in IMG/M |
3300004152|Ga0062386_101453863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 571 | Open in IMG/M |
3300005174|Ga0066680_10117942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1639 | Open in IMG/M |
3300005435|Ga0070714_101832349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 592 | Open in IMG/M |
3300005529|Ga0070741_10022624 | All Organisms → cellular organisms → Bacteria | 9623 | Open in IMG/M |
3300005529|Ga0070741_10254568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1670 | Open in IMG/M |
3300005529|Ga0070741_11455740 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005532|Ga0070739_10123352 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
3300005536|Ga0070697_101174717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 684 | Open in IMG/M |
3300005542|Ga0070732_10594223 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005542|Ga0070732_10787257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 580 | Open in IMG/M |
3300005586|Ga0066691_10329963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
3300005602|Ga0070762_10223640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1160 | Open in IMG/M |
3300005602|Ga0070762_10580117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 743 | Open in IMG/M |
3300005610|Ga0070763_10047338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2033 | Open in IMG/M |
3300005610|Ga0070763_10098438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1471 | Open in IMG/M |
3300005921|Ga0070766_10543647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 776 | Open in IMG/M |
3300005983|Ga0081540_1356549 | Not Available | 500 | Open in IMG/M |
3300006028|Ga0070717_10037213 | All Organisms → cellular organisms → Bacteria | 3951 | Open in IMG/M |
3300006032|Ga0066696_10613954 | Not Available | 705 | Open in IMG/M |
3300006162|Ga0075030_100063138 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
3300006162|Ga0075030_101527678 | Not Available | 522 | Open in IMG/M |
3300006172|Ga0075018_10423982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 681 | Open in IMG/M |
3300006237|Ga0097621_102245821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 522 | Open in IMG/M |
3300006800|Ga0066660_11689746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
3300006804|Ga0079221_10897725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 650 | Open in IMG/M |
3300006804|Ga0079221_10987758 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300006854|Ga0075425_101100124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 905 | Open in IMG/M |
3300006881|Ga0068865_100004197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8683 | Open in IMG/M |
3300006881|Ga0068865_100325673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1237 | Open in IMG/M |
3300006914|Ga0075436_100655383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 776 | Open in IMG/M |
3300006954|Ga0079219_10545260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 829 | Open in IMG/M |
3300009089|Ga0099828_10679328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 925 | Open in IMG/M |
3300009089|Ga0099828_11475080 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300009177|Ga0105248_10025757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 6542 | Open in IMG/M |
3300009523|Ga0116221_1151279 | Not Available | 1011 | Open in IMG/M |
3300009645|Ga0116106_1303172 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300009646|Ga0116132_1219835 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300009660|Ga0105854_1199071 | Not Available | 665 | Open in IMG/M |
3300009700|Ga0116217_10996482 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009792|Ga0126374_10092995 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
3300009824|Ga0116219_10009625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6385 | Open in IMG/M |
3300009839|Ga0116223_10208716 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300010043|Ga0126380_11997916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 530 | Open in IMG/M |
3300010322|Ga0134084_10474857 | Not Available | 502 | Open in IMG/M |
3300010343|Ga0074044_10695501 | Not Available | 664 | Open in IMG/M |
3300010358|Ga0126370_12527969 | Not Available | 512 | Open in IMG/M |
3300010360|Ga0126372_10332318 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300010361|Ga0126378_10573781 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300010376|Ga0126381_103313837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300010379|Ga0136449_100977697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1366 | Open in IMG/M |
3300010379|Ga0136449_103215009 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300010397|Ga0134124_10183818 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
3300010399|Ga0134127_10505254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
3300010866|Ga0126344_1092738 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
3300011000|Ga0138513_100058900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300012089|Ga0153924_1137955 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300012096|Ga0137389_10466359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
3300012096|Ga0137389_10704320 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300012198|Ga0137364_10092039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2118 | Open in IMG/M |
3300012359|Ga0137385_11434491 | Not Available | 554 | Open in IMG/M |
3300012363|Ga0137390_10663010 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300012502|Ga0157347_1074128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300012683|Ga0137398_10242613 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300012685|Ga0137397_10511073 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300012923|Ga0137359_10347704 | Not Available | 1318 | Open in IMG/M |
3300012929|Ga0137404_11419228 | Not Available | 641 | Open in IMG/M |
3300013100|Ga0157373_11432406 | Not Available | 526 | Open in IMG/M |
3300013306|Ga0163162_10927965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
3300013307|Ga0157372_10478222 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300013307|Ga0157372_11159652 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300013308|Ga0157375_13137435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300014314|Ga0075316_1036350 | Not Available | 1027 | Open in IMG/M |
3300014491|Ga0182014_10101277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1734 | Open in IMG/M |
3300014655|Ga0181516_10436744 | Not Available | 670 | Open in IMG/M |
3300015054|Ga0137420_1293118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
3300015242|Ga0137412_10516462 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300015242|Ga0137412_10987341 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 604 | Open in IMG/M |
3300015264|Ga0137403_10989821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
3300015371|Ga0132258_11053893 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
3300017924|Ga0187820_1167918 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300017925|Ga0187856_1200304 | Not Available | 724 | Open in IMG/M |
3300017927|Ga0187824_10064963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
3300017940|Ga0187853_10549731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
3300017943|Ga0187819_10432763 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300017955|Ga0187817_10902134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 565 | Open in IMG/M |
3300017961|Ga0187778_10987252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300017972|Ga0187781_11396048 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300017973|Ga0187780_10019751 | All Organisms → cellular organisms → Bacteria | 4846 | Open in IMG/M |
3300017973|Ga0187780_10926039 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300017975|Ga0187782_10903041 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300017994|Ga0187822_10241174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300017998|Ga0187870_1146604 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300017999|Ga0187767_10194512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300018019|Ga0187874_10137821 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300018023|Ga0187889_10318650 | Not Available | 685 | Open in IMG/M |
3300018028|Ga0184608_10533893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 500 | Open in IMG/M |
3300018035|Ga0187875_10640728 | Not Available | 559 | Open in IMG/M |
3300018043|Ga0187887_10941555 | Not Available | 511 | Open in IMG/M |
3300018062|Ga0187784_10961678 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300018062|Ga0187784_10989678 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300018062|Ga0187784_11225386 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300018077|Ga0184633_10253157 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300018077|Ga0184633_10354337 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300018085|Ga0187772_10060073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2361 | Open in IMG/M |
3300018085|Ga0187772_10672018 | Not Available | 741 | Open in IMG/M |
3300018433|Ga0066667_10261680 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300018468|Ga0066662_10205311 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300018482|Ga0066669_10674212 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300019786|Ga0182025_1019296 | Not Available | 525 | Open in IMG/M |
3300019865|Ga0193748_1005116 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300019888|Ga0193751_1003393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9370 | Open in IMG/M |
3300020199|Ga0179592_10461871 | Not Available | 547 | Open in IMG/M |
3300020222|Ga0194125_10270495 | Not Available | 1148 | Open in IMG/M |
3300020579|Ga0210407_11382352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 523 | Open in IMG/M |
3300020580|Ga0210403_10085207 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
3300020580|Ga0210403_10584538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
3300020580|Ga0210403_10919306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300020582|Ga0210395_11225120 | Not Available | 551 | Open in IMG/M |
3300021178|Ga0210408_10540988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
3300021178|Ga0210408_10732124 | Not Available | 777 | Open in IMG/M |
3300021181|Ga0210388_10160781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1954 | Open in IMG/M |
3300021181|Ga0210388_11348692 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300021265|Ga0213906_103427 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300021358|Ga0213873_10222648 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300021403|Ga0210397_10428738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
3300021405|Ga0210387_10903953 | Not Available | 777 | Open in IMG/M |
3300021406|Ga0210386_10420060 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300021420|Ga0210394_10457204 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300021477|Ga0210398_11402970 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300021478|Ga0210402_11004860 | Not Available | 761 | Open in IMG/M |
3300021559|Ga0210409_10191106 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
3300021858|Ga0213852_1504602 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300022510|Ga0242652_1009851 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300022521|Ga0224541_1005247 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
3300022531|Ga0242660_1048564 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300022730|Ga0224570_100726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2635 | Open in IMG/M |
3300024176|Ga0224565_1014677 | Not Available | 840 | Open in IMG/M |
3300024288|Ga0179589_10280247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 746 | Open in IMG/M |
3300025414|Ga0208935_1017958 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300025500|Ga0208686_1076089 | Not Available | 741 | Open in IMG/M |
3300025576|Ga0208820_1148715 | Not Available | 528 | Open in IMG/M |
3300025612|Ga0208691_1082524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 725 | Open in IMG/M |
3300025905|Ga0207685_10631715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300025929|Ga0207664_10204528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1706 | Open in IMG/M |
3300025939|Ga0207665_10145319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1694 | Open in IMG/M |
3300025982|Ga0208139_1036223 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300026116|Ga0207674_10208191 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
3300026291|Ga0209890_10040762 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
3300026309|Ga0209055_1231520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300026318|Ga0209471_1115924 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300026528|Ga0209378_1250613 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300026550|Ga0209474_10091157 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
3300026557|Ga0179587_10411734 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300027034|Ga0209730_1002495 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300027383|Ga0209213_1058121 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300027432|Ga0209421_1072757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300027432|Ga0209421_1080919 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300027548|Ga0209523_1044147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
3300027587|Ga0209220_1015320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2043 | Open in IMG/M |
3300027609|Ga0209221_1109042 | Not Available | 708 | Open in IMG/M |
3300027619|Ga0209330_1000312 | All Organisms → cellular organisms → Bacteria | 22627 | Open in IMG/M |
3300027676|Ga0209333_1004293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5291 | Open in IMG/M |
3300027676|Ga0209333_1127963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300027725|Ga0209178_1271926 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300027738|Ga0208989_10142165 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300027812|Ga0209656_10055513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2215 | Open in IMG/M |
3300027825|Ga0209039_10349745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 574 | Open in IMG/M |
3300027829|Ga0209773_10469390 | Not Available | 519 | Open in IMG/M |
3300027842|Ga0209580_10160865 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300027875|Ga0209283_10057093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2497 | Open in IMG/M |
3300027879|Ga0209169_10276752 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300027884|Ga0209275_10634367 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300027894|Ga0209068_10349890 | Not Available | 836 | Open in IMG/M |
3300027898|Ga0209067_10004646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7690 | Open in IMG/M |
3300027898|Ga0209067_10397830 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300027898|Ga0209067_10891226 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300027903|Ga0209488_10753540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 694 | Open in IMG/M |
3300027915|Ga0209069_10832104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
3300028010|Ga0265358_102517 | Not Available | 622 | Open in IMG/M |
3300028036|Ga0265355_1009310 | Not Available | 794 | Open in IMG/M |
3300028037|Ga0265349_1016057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 668 | Open in IMG/M |
3300028560|Ga0302144_10242756 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300028743|Ga0302262_10218649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300028748|Ga0302156_10136732 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300028906|Ga0308309_10894597 | Not Available | 771 | Open in IMG/M |
3300029918|Ga0302143_1084165 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300029920|Ga0302142_1180757 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300029951|Ga0311371_11150917 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300029982|Ga0302277_1127556 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300030043|Ga0302306_10272081 | Not Available | 650 | Open in IMG/M |
3300030043|Ga0302306_10348620 | Not Available | 567 | Open in IMG/M |
3300030494|Ga0310037_10182557 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300030507|Ga0302192_10267147 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300030507|Ga0302192_10285665 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300030509|Ga0302183_10178483 | Not Available | 832 | Open in IMG/M |
3300030518|Ga0302275_10260057 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300030618|Ga0311354_10492194 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300030677|Ga0302317_10396493 | Not Available | 609 | Open in IMG/M |
3300030879|Ga0265765_1057591 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300030916|Ga0075386_11965584 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300030991|Ga0073994_10071152 | Not Available | 711 | Open in IMG/M |
3300031231|Ga0170824_120404401 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300031236|Ga0302324_100203206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3158 | Open in IMG/M |
3300031258|Ga0302318_10343899 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300031525|Ga0302326_11258635 | Not Available | 1012 | Open in IMG/M |
3300031711|Ga0265314_10528623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 617 | Open in IMG/M |
3300031715|Ga0307476_10681933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300031718|Ga0307474_11076316 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300031751|Ga0318494_10273077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
3300031753|Ga0307477_10664709 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300031820|Ga0307473_10060308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1850 | Open in IMG/M |
3300031912|Ga0306921_10113152 | All Organisms → cellular organisms → Bacteria | 3156 | Open in IMG/M |
3300031941|Ga0310912_10039505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3264 | Open in IMG/M |
3300031962|Ga0307479_10390966 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300031996|Ga0308176_10828880 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300032055|Ga0318575_10260998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
3300032089|Ga0318525_10441136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 667 | Open in IMG/M |
3300032160|Ga0311301_12400118 | Not Available | 595 | Open in IMG/M |
3300032180|Ga0307471_102447785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300032515|Ga0348332_10841621 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300032783|Ga0335079_10074452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3864 | Open in IMG/M |
3300032805|Ga0335078_10211515 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
3300032805|Ga0335078_10872896 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300032892|Ga0335081_12107092 | Not Available | 597 | Open in IMG/M |
3300032893|Ga0335069_11552871 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300032898|Ga0335072_10150183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2860 | Open in IMG/M |
3300032954|Ga0335083_11145630 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300033158|Ga0335077_12216589 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300033433|Ga0326726_11771539 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300033977|Ga0314861_0201602 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300034090|Ga0326723_0612366 | Not Available | 505 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.26% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.55% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.70% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.70% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.85% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.42% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.42% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.99% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.99% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.99% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.14% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.28% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.28% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.28% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.43% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.43% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.43% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.43% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.43% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.43% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.43% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.43% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.43% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.43% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.43% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.43% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.43% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.43% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.43% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.43% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.43% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.43% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.43% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021265 | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Shaw_3 | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025982 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Host-Associated | Open in IMG/M |
3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062385_108588732 | 3300004080 | Bog Forest Soil | MKVVVIIPAAGLGTRMAPMPVGATGKQKNAPPSKQFTELGGTPILI |
Ga0062389_1014690453 | 3300004092 | Bog Forest Soil | MKVVVIIPAAGLGTRMSPAAGAKGKAAPAVPSKQSKQFTELGGTPI |
Ga0062389_1046206711 | 3300004092 | Bog Forest Soil | MKVIVIIPAAGLGTRMAPMPSAMDAKTKKPHPSKQFSELAGTPIL |
Ga0062386_1014538631 | 3300004152 | Bog Forest Soil | MKVVVIIPAAGLGTRMGPMPGARSKAKQAALSKQFTELGGTPILLRT |
Ga0066680_101179421 | 3300005174 | Soil | MKVIVIIPAAGLGTRMAPVPGKTAKGKKPPPSKQFTELAGTPI |
Ga0070714_1018323491 | 3300005435 | Agricultural Soil | MKVIVIIPAAGLGTRMASGPAGAKGTLKGTPPSKQFTELGGTPIL |
Ga0070741_1002262412 | 3300005529 | Surface Soil | MKVIVIIPAAGLGTRMGPVSSAKAAKSKKAQASKQFTE |
Ga0070741_102545682 | 3300005529 | Surface Soil | MSVIVIIPAAGLGTRMAAASGTRPPVSKQFAELGGVP |
Ga0070741_114557401 | 3300005529 | Surface Soil | MKVIVVIPAAGLGTRMTSAPSSKGKKPTASKQFTQLGGTP |
Ga0070739_101233522 | 3300005532 | Surface Soil | MKVTVIIPAAGLGTRMATTPGSVPASPKQFAEIRG |
Ga0070697_1011747171 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVFVIVPAAGLGTRMAPPSAAKSKRKAPTKQFKELGGVP |
Ga0070732_105942232 | 3300005542 | Surface Soil | MKVIVIIPAAGLGTRMAPMPSALDAKTKKPHPSKQFTELAGTPILI |
Ga0070732_107872571 | 3300005542 | Surface Soil | MKVTVVIPAAGLGTRMAPAAKAKKPAATKQFAELQGKPI |
Ga0066691_103299631 | 3300005586 | Soil | VIIPAAGLGTRMAPVPSAQDKGKKCAPSKQFTDLGGKP |
Ga0070762_102236401 | 3300005602 | Soil | MKVIVIIPAAGLGTRMASKTSAQRPQHKTQPSKQFTELAGTPI |
Ga0070762_105801172 | 3300005602 | Soil | MKVFVIIPAAGLGTRMAPPSPLTGSSAGSRKAGPTKQFKELGGV |
Ga0070763_100473383 | 3300005610 | Soil | MKVLVIIPAAGLGTRMGPMPVGAIGKQKRALPSKQFTE |
Ga0070763_100984381 | 3300005610 | Soil | MKVIVIIPAAGLGTRMASKTSAQRPQHKTQPSKQFTELAGTPIL |
Ga0070766_105436472 | 3300005921 | Soil | MKVVVIIPAAGLGTRMSAVSGGPKSKSKQFFELQGTP |
Ga0081540_13565492 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKVFVIIPAAGLGTRMIPAAGSKGKKPVASKQFAELGGIPI |
Ga0070717_100372131 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVVVIIPAAGLGTRMAPIPAGGKSKQKKTPPSKQFTELGG |
Ga0066696_106139542 | 3300006032 | Soil | MKVVAIIPAAGLGTRMASAPESKGKKPAASKQFTELKGT |
Ga0075030_1000631385 | 3300006162 | Watersheds | MKVVVIIPAAGLGTRMAPAHSALDAKEKKPHPSKQFTELAGTPIL |
Ga0075030_1015276781 | 3300006162 | Watersheds | MKVVVIIPAAGLGTRMAPVPSAADAKKKPHPSKQFTELA |
Ga0075018_104239821 | 3300006172 | Watersheds | MKVLVIIPAAGLGTRMTPAPDAKSKKPAASKQFSEIGGTPILVHT |
Ga0097621_1022458211 | 3300006237 | Miscanthus Rhizosphere | LQPAMKVVVIIPAAGLGTRMSPASDAKSKKPAASKQFFKIGGTPILI |
Ga0066660_116897462 | 3300006800 | Soil | MKVFAIIPAAGLGTRMAAGKRSGQATPSKQFTEVGGVP |
Ga0079221_108977251 | 3300006804 | Agricultural Soil | MKVVVIIPAAGLGTRMAAQSGARPRQATKQFAEIAGKP |
Ga0079221_109877582 | 3300006804 | Agricultural Soil | MRVVVIIPAAGLGTRMAAYSGARTGQPTKQFAEIAGKGA |
Ga0075425_1011001241 | 3300006854 | Populus Rhizosphere | MKVLAIIPAAGLGTRMASAPASKGKKQVASKQFTEL |
Ga0068865_1000041971 | 3300006881 | Miscanthus Rhizosphere | MKVIVIIPAAGLGTRMSSAGGAKRSKPSATKQFAE |
Ga0068865_1003256733 | 3300006881 | Miscanthus Rhizosphere | MKVVVIIPAAGLGTRMAPASDARNKKPTASKQFSEIG |
Ga0075436_1006553831 | 3300006914 | Populus Rhizosphere | MKVIVIIPAAGLGTRMAPVPSGKTAKGKNPHPSKQFTDLAGTPI |
Ga0079219_105452602 | 3300006954 | Agricultural Soil | MNVIVIIPAAGLGTRMAAASGARIAPGASKQFAELHG |
Ga0099828_106793282 | 3300009089 | Vadose Zone Soil | MNVFVIIPAAGLGTRMSAGAKKGSRPSKQFTELAG |
Ga0099828_114750801 | 3300009089 | Vadose Zone Soil | MKVVVIIPAAGLGTRMAPASDATGKKHAASKQFFE |
Ga0105248_100257578 | 3300009177 | Switchgrass Rhizosphere | MKVVVIIPAAGLGTRMAPASDARNKKPTASKQFSEIGGT |
Ga0116221_11512791 | 3300009523 | Peatlands Soil | MKVFVIVPAAGLGTRMAPPSAAKSKKKAPTKQFKELGG |
Ga0116106_13031721 | 3300009645 | Peatland | MKVFVIVPAAGLGTRMAPPSAEKARRKAPTKQFKELGG |
Ga0116132_12198352 | 3300009646 | Peatland | MKVFVIVPAAGLGTRMAPPSAAPSAEKARRKAPTKQFKELGG |
Ga0105854_11990711 | 3300009660 | Permafrost Soil | MKVFVIIPAAGLGTRMGAAPAGQTRARSKQFLELDGV |
Ga0116217_109964822 | 3300009700 | Peatlands Soil | MKVFVIIPAAGLGTRMAPASGRIRRESPSKQFKELGGAPILVRT |
Ga0126374_100929951 | 3300009792 | Tropical Forest Soil | MNVIVIIPAAGLGTRMAPAGKKAAASKQFFEIDGVP |
Ga0116219_100096251 | 3300009824 | Peatlands Soil | MKVVVIIPAAGLGTRMAPMPSAPIPSARNAKTKKPIPSKQFTELGGTP |
Ga0116223_102087161 | 3300009839 | Peatlands Soil | MKVIVIIPAAGMGTRMAPMPSALDTKTKKPHPSKQFS |
Ga0126380_119979162 | 3300010043 | Tropical Forest Soil | MKVIVIIPAAGLGTRMAPVPSATDAKLKKAHPSKQFTELAGTPILI |
Ga0134084_104748571 | 3300010322 | Grasslands Soil | MRVFVIIPAAGLGTRMSAASGATRGSQPTKQFAEIGGAPI |
Ga0074044_106955011 | 3300010343 | Bog Forest Soil | MKVFVIVPAAGLGTRMAASSAAPLPGKVRKKAPTKQFKE |
Ga0126370_125279691 | 3300010358 | Tropical Forest Soil | MNVSAIIPAAGLGTRMAAAGPTKARKSTPSKQFTDLAG |
Ga0126372_103323181 | 3300010360 | Tropical Forest Soil | MKVFVIIPAAGLGTRMAPVSTAKSRRKTPSKQFKELGG |
Ga0126378_105737812 | 3300010361 | Tropical Forest Soil | MKVFVIIPAAGFGTRMAPVSVAKDAKKPVPSKQFTDLKGT |
Ga0126381_1033138371 | 3300010376 | Tropical Forest Soil | MKVIVIIPAAGLGTRMMAGPGDKARKPAATKQFAELQGV |
Ga0136449_1009776971 | 3300010379 | Peatlands Soil | MKVVVIIPAAGLGTRMSPMPSAMISSNKDAKTRKPHPSK |
Ga0136449_1032150091 | 3300010379 | Peatlands Soil | MKVFVIVPAAGLGTRMAPPSPAKARKKTPSKQFKELGGVPIL |
Ga0134124_101838184 | 3300010397 | Terrestrial Soil | MKVLVIIPAAGLGTRMAQASDAKSKKPAASKQFSEI |
Ga0134127_105052541 | 3300010399 | Terrestrial Soil | MKVIVIIPAAGLGTRMSSAGGSKRSKPSATKQFAELDGV |
Ga0126344_10927381 | 3300010866 | Boreal Forest Soil | MKVIVIIPAAGLGTRMAPMPSALDAKTKTKRPHPSKQFTDLAGTP |
Ga0138513_1000589002 | 3300011000 | Soil | MKVTVIIPAAGLGTRMASPSRAKSKGASPSKQFTELKGT |
Ga0153924_11379551 | 3300012089 | Attine Ant Fungus Gardens | MKVVVIIPAAGLGTRMAPMPVGAKGKPKKAPPSKQFTELGGTPI |
Ga0137389_104663593 | 3300012096 | Vadose Zone Soil | VAPVYWQTAMKVIVIIPAAGLGTRMAPMPGGAKGKQRKGPPSKQ |
Ga0137389_107043201 | 3300012096 | Vadose Zone Soil | MKVSVIIPAAGLGTRMATAPAAKGRKSAPSKQFTELD |
Ga0137364_100920394 | 3300012198 | Vadose Zone Soil | MKVFVIVPAAGLGTRMIQPSAAKAKKKAPSKQFKELGGIPILV |
Ga0137385_114344911 | 3300012359 | Vadose Zone Soil | MKVFVIVPAAGLGTRMGPPSVAKTKKRAPSKQFKELGGIPIL |
Ga0137390_106630101 | 3300012363 | Vadose Zone Soil | MKVIVIIPAAGLGTRMAPVSAGAKGKQKASPSKQFTELGGT |
Ga0157347_10741281 | 3300012502 | Arabidopsis Rhizosphere | MKVSVIIPAAGLGTRMAAAARDKKPAASKQFADLAGT |
Ga0137398_102426131 | 3300012683 | Vadose Zone Soil | MKVTVIIPAAGLGTRMAPAGKKGAPSKQFFEISGVP |
Ga0137397_105110732 | 3300012685 | Vadose Zone Soil | MKVFVIVPAAGLGTRMAPPSAAKSRKTLASKQFKELGGV |
Ga0137359_103477041 | 3300012923 | Vadose Zone Soil | MKVFVIIPAAGLGTRMAPADTKTKTAKNAKVPKQFTQL |
Ga0137404_114192281 | 3300012929 | Vadose Zone Soil | MKVFVIIPAAGLGTRMAPADTKAKTAKNAKVSKQFTQLGD |
Ga0157373_114324062 | 3300013100 | Corn Rhizosphere | MKIVVIIPAAGLGTRMAPVPSAKAGKPAASKQFVALLG |
Ga0163162_109279651 | 3300013306 | Switchgrass Rhizosphere | MKVIVIIPAAGLGTRMSSAGGAKRSKPSATKQFAEL |
Ga0157372_104782221 | 3300013307 | Corn Rhizosphere | MKVIVIIPAAGLGTRMAPVPSGKAGKGKNPHPSKQFTDLAGT |
Ga0157372_111596521 | 3300013307 | Corn Rhizosphere | MKVIVIIPAAGLGTRMAPVPSGKAAKGKNPHPSKQFTDLAGTPILI |
Ga0157375_131374351 | 3300013308 | Miscanthus Rhizosphere | MKVIVIIPAAGLGTRMSSAGGAKRSKPSATKQFAELAGVP |
Ga0075316_10363501 | 3300014314 | Natural And Restored Wetlands | MKVIVIIPAAGLGTRMAAPAKGPRAAPSKQFTEIGGVPI |
Ga0182014_101012771 | 3300014491 | Bog | MKVFVIVPAAGLGTRMAPPSTAKSKKKAPTKQFKEL |
Ga0181516_104367441 | 3300014655 | Bog | MKVFVIIPAAGLGTRMGVAHAGKAPLRSKQFLELQGVPI |
Ga0137420_12931182 | 3300015054 | Vadose Zone Soil | MKVVVIIPAAGMGTRMAPARGAQRKKSSPSKQFTELGGTP |
Ga0137412_105164621 | 3300015242 | Vadose Zone Soil | MKVIVIIPAAGLGTRMAPSAGDKGKQKKAPPSKQFTELGGTPI |
Ga0137412_109873412 | 3300015242 | Vadose Zone Soil | MKVVVIIPAAGLGTRMAPMPRAKDAKTKKPHPSKQFTDLGGTP |
Ga0137403_109898212 | 3300015264 | Vadose Zone Soil | MKVFVIVPAAGLGTRMAPPSAAKAKKRAPSKQFKEL |
Ga0132258_110538931 | 3300015371 | Arabidopsis Rhizosphere | MKVIVIIPAAGLGTRMAPMPSAKDAKTKKPHPSKQFTDLAG |
Ga0187820_11679181 | 3300017924 | Freshwater Sediment | MKVLVIIPAAGLGTRMAPMPSAMDPKSKKAHSTKQFTELAGTPI |
Ga0187856_12003042 | 3300017925 | Peatland | MKVFVIVPAAGLGTRMAPPSAAKSKKKAPSKQFKELGG |
Ga0187824_100649632 | 3300017927 | Freshwater Sediment | MKVVVIIPAAGLGTRMASPSLTKSSKTPTKQFTELGGTPI |
Ga0187853_105497312 | 3300017940 | Peatland | MKVFVIVPAAGLGTRMAPLSPGKIRKESPSKQFKDLGGVPILVRTL |
Ga0187819_104327631 | 3300017943 | Freshwater Sediment | MKVFVIVPAAGLGTRMAPPSGAKSAERSRKKAPTKQFKELGGVPIL |
Ga0187817_109021342 | 3300017955 | Freshwater Sediment | MKVVVIIPAAGLGTRMASAPGTKLKKPAATKQFTELGGTP |
Ga0187778_109872522 | 3300017961 | Tropical Peatland | MKVVVIIPAAGLGTRMSTPAAARGAKPAPSKQFTDLAGT |
Ga0187781_113960481 | 3300017972 | Tropical Peatland | MKVFVIVPAAGLGTRMVPPSGAKAAERSRKKAPTKQ |
Ga0187780_100197516 | 3300017973 | Tropical Peatland | MKVVVIIPAAGLGTRMASALGGKGKKQGASKQFTE |
Ga0187780_109260391 | 3300017973 | Tropical Peatland | MKVFVIVPAAGLGTLMAPPSAAKSRKKAPTKQFKELGGVPILV |
Ga0187782_109030412 | 3300017975 | Tropical Peatland | MKVFVIIPAAGLGTRMAPVPSAMDAKSKKTQPTKQFTELAGT |
Ga0187822_102411741 | 3300017994 | Freshwater Sediment | MKVVVIIPAAGLGTRMLPGGSAKAKSPSKQFTELGGTPILI |
Ga0187870_11466042 | 3300017998 | Peatland | MKVVVIIPAAGLGTRMAPMPVGAPGKQKKRLPSKQFTELGG |
Ga0187767_101945121 | 3300017999 | Tropical Peatland | MKVVVIIPAAGLGTRMASAPSGKKPAASKQFAELVGTPIV |
Ga0187874_101378213 | 3300018019 | Peatland | MKVIVIIPAAGLGTRMAPMPSAMDAKTKRPHPSKQFNELAG |
Ga0187889_103186501 | 3300018023 | Peatland | MKVFVIVPAAGLGTRMAPLSAAKSKEKAPSKQFKE |
Ga0184608_105338931 | 3300018028 | Groundwater Sediment | MKVVVIIPAAGLGTRMASVPSAKGRNATPSKQFTELGG |
Ga0187875_106407281 | 3300018035 | Peatland | MKVIVIIPAAGLGTRMASSTATAQGRARSKQFAQLE |
Ga0187887_109415552 | 3300018043 | Peatland | MKVMVIIPAAGLGTRMASSTATAQGRARSKQFAQL |
Ga0187784_109616782 | 3300018062 | Tropical Peatland | MKVFVIVPAAGLGTRMAPPSGAKAAERSRKKAPTKQFKELGGVPIL |
Ga0187784_109896782 | 3300018062 | Tropical Peatland | MKVVVIIPAAGLGTRMAPVPSVKDAKTAPPAKQFT |
Ga0187784_112253862 | 3300018062 | Tropical Peatland | MKVVVIIPAAGLGKRMAPVHSAAGAGSKDAKSSPPAKQFFELAGT |
Ga0184633_102531572 | 3300018077 | Groundwater Sediment | MKVFVIIPAAGLGTRMAPPAKAGRKPGASKQFTELGGVPIL |
Ga0184633_103543372 | 3300018077 | Groundwater Sediment | MKVFVIIPAAGLGTRMAPPAKAGRKPGASKQFTELGGVPILI |
Ga0187772_100600734 | 3300018085 | Tropical Peatland | MKVIVIIPAAGLGTRMAPVPAAPVPGAKDAKEKKDAKDKKPHPSKQFTELAG |
Ga0187772_106720181 | 3300018085 | Tropical Peatland | MKVVVIIPAAGLGTRMAPVSSAKDAKDKKPHPSKQFTELAGTPI |
Ga0066667_102616801 | 3300018433 | Grasslands Soil | MKVVVIIPAAGLGTRMASPPSGKGKKAGPSKQFTELGGTPVLI |
Ga0066662_102053111 | 3300018468 | Grasslands Soil | MKVVVIIPAAGLGTRMASPPSGKGKKAGPSKQFTELGGTP |
Ga0066669_106742122 | 3300018482 | Grasslands Soil | MKVVAIIPAAGLGTRMASAPESKGKKPVASKQFTELGG |
Ga0182025_10192961 | 3300019786 | Permafrost | MKVVVIIPAAGLGTRMAAMPVGAKGKQKARSSKSTEPGG |
Ga0193748_10051161 | 3300019865 | Soil | MKVVVIIPAAGLGTRMASVSSVKGKKAAPSKQFTE |
Ga0193751_10033931 | 3300019888 | Soil | MKVFVIVPAAGLGTRMAPHSPAKSKRKSPTKQFKELGGV |
Ga0179592_104618712 | 3300020199 | Vadose Zone Soil | MKVFVILPAAGLGTRMGPLAAPGKKSAPSKQFTELD |
Ga0194125_102704951 | 3300020222 | Freshwater Lake | MKVSVIIPAAGLGTRMIRPAAAGDPPPAVARKQFLLLDGEP |
Ga0210407_113823522 | 3300020579 | Soil | MKVVVIIPAAGLGTRMASSPGARGKKPAASKQFTELG |
Ga0210403_100852074 | 3300020580 | Soil | MKVVVIIPAAGLGTRMASAASTKNKKPAASKQFTEL |
Ga0210403_105845381 | 3300020580 | Soil | MKVVVIIPAAGLGTRMAAAGSTRAKMASPSKQFTQLGG |
Ga0210403_109193061 | 3300020580 | Soil | MKIVVIIPAAGLGTRMVAPQATKHSKPAPRKQFVELRGSPVL |
Ga0210395_112251202 | 3300020582 | Soil | MKVVVIIPAAGLGTRMGPMPVGDKAKTKTLSKQFTELAGIQIMI |
Ga0210408_105409881 | 3300021178 | Soil | MKVVVIIPAAGLGTRMAKAGARPGQATKQFAEIAGKP |
Ga0210408_107321241 | 3300021178 | Soil | MKVVVIIPAAGLGTRMVSVSDARSKKPAASKQFSEIGGTP |
Ga0210388_101607813 | 3300021181 | Soil | MKVFVIVPAAGLGTRMAVPSTASSAAKPRKKAPTKQFKELGGVPILVH |
Ga0210388_113486921 | 3300021181 | Soil | MKVVLIIPAAGLGTRMAPVAGATKASKAPPSKQFT |
Ga0213906_1034271 | 3300021265 | Soil | MKVIVIIPAAGLGTRMSAAAAKKGKKSPAPTKQFAEL |
Ga0213873_102226482 | 3300021358 | Rhizosphere | MKVVVIIPAAGLGTRMASAPAGGKKPAASKQFAELGGI |
Ga0210397_104287383 | 3300021403 | Soil | MKVIVIIPAAGLGTRMAPMPSAMDAKTKKPHPSKQFNDLAGTPIL |
Ga0210387_109039532 | 3300021405 | Soil | MKVIVIVPAAGLGTRMASAPRTKGKKPASTKQFTEL |
Ga0210386_104200602 | 3300021406 | Soil | MKVVVIIPAAGLGTRMAPVPSAMDSKSKKPHPSKQFTEL |
Ga0210394_104572041 | 3300021420 | Soil | MKVIVIVPAAGLGTRMASAPRTKGKKPASTKQFTELGGGAI |
Ga0210398_114029702 | 3300021477 | Soil | MKVIVIIPAAGLGTRMSPMPSAMISSNKDAKTKKPHPSKQFTDLAGT |
Ga0210402_110048601 | 3300021478 | Soil | MKVVVIIPAAGLGTRMLPASDAKSKKPSASKQFSELGGTPI |
Ga0210409_101911061 | 3300021559 | Soil | MKVIAIIPAAGLGTRMASAPSAKGKKPGATKQFTELGG |
Ga0213852_15046022 | 3300021858 | Watersheds | MKVVVIIPAAGLGTRMAPVSSAKDTKPHLSKQFTELAGTPIL |
Ga0242652_10098512 | 3300022510 | Soil | MKVVVIIPAAGLGTRMAPVSSAKDSKPHLTKQFTELAGTP |
Ga0224541_10052472 | 3300022521 | Soil | MKVFVIVPAAGLGTRMAPPSVAASRKKASSKQFKELGGM |
Ga0242660_10485641 | 3300022531 | Soil | MKVVVIIPAAGLGTRMAPVSSAKDSKPHLTKQFTELAGTPIL |
Ga0224570_1007261 | 3300022730 | Rhizosphere | MKVIVIIPAAGLGTRMGPMPRARSKAMQPVLSKQFTELGGTPIL |
Ga0224565_10146772 | 3300024176 | Plant Litter | MKVAVIIPAAGLGTRMSPVPVGAKPAKAPPSKQFTEL |
Ga0179589_102802471 | 3300024288 | Vadose Zone Soil | LQPAMKVVVIIPAAGLGTRMTSVSDARSKKPAASKQFSEIGGTPIL |
Ga0208935_10179583 | 3300025414 | Peatland | MKVVVIIPAAGLGTRMAPMPVGKGKQKKAPPSKQF |
Ga0208686_10760892 | 3300025500 | Peatland | MKVIVIIPAAGLGTRMAPMLVGAKDKQKKAPPSKQFTELGGT |
Ga0208820_11487151 | 3300025576 | Peatland | MKVFVIVPAAGLGTRMAPPSAAKSKKKAPSKQFKEL |
Ga0208691_10825241 | 3300025612 | Peatland | MKVVVIIPAAGLGTRMAPMPVGKGKQKKAPPSKQFTELGGTP |
Ga0207685_106317152 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVTVIIPAAGLGTRMASPSRAKSKGASPSKQFTE |
Ga0207664_102045281 | 3300025929 | Agricultural Soil | MKVTVIVPAAGLGTRMASAAKDKKPTASKQFAELKGKP |
Ga0207665_101453193 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVIAIIPAAGLGTRMSFAPGTKMKKAAPSKQFTELGGTPILLH |
Ga0208139_10362231 | 3300025982 | Rice Paddy Soil | MKVIVIIPAAGLGTRMGSVSATAQGKAPSKQFLTIAG |
Ga0207674_102081913 | 3300026116 | Corn Rhizosphere | MKVIVIIPAAGLGTRMAPVPSGKTAKGKNPHPSKQFTEL |
Ga0209890_100407622 | 3300026291 | Soil | MKVIVIIPAAGLGTRMAPMPSALDAKTKKAHPSKQFTELA |
Ga0209055_12315201 | 3300026309 | Soil | MKVIVIIPAAGLGTRMASAPAGKAAKPAASKQFLELDGTP |
Ga0209471_11159242 | 3300026318 | Soil | MKVFVIVPAAGLGTRMAPHSAAKSRKKSLTKQFKELGG |
Ga0209378_12506132 | 3300026528 | Soil | MKVVVIIPAAGLGTRMASPPSGKGKKAGPSKQFTELGGTPV |
Ga0209474_100911573 | 3300026550 | Soil | MKVFVIIPAAGLGTRMAGPSAKAKSPKSAKVPKQLTEVGDAPILIHTL |
Ga0179587_104117341 | 3300026557 | Vadose Zone Soil | MKVIVIIPAAGLGTRMAPMLSALDHKTKKPHPSKQFTDLGGTPI |
Ga0209730_10024951 | 3300027034 | Forest Soil | MKVFVIIPAAGLGTRMAPVSSAKDSKPHLSKQFTELAG |
Ga0209213_10581212 | 3300027383 | Forest Soil | MKVFVIVPAAGLGTRMGSPSSTKARKRAPSKQFKELGGVPIL |
Ga0209421_10727571 | 3300027432 | Forest Soil | MKVFVIVPAAGLGTRMSPPSSAKSRKKAPTKQFKELGGVPILV |
Ga0209421_10809192 | 3300027432 | Forest Soil | MKVVVIIPAAGLGTRMAPMPAGAKGKQKKAPPSKQ |
Ga0209523_10441471 | 3300027548 | Forest Soil | MKVIVIIPAAGLGTRMAPIPSALDAKTRKPHPSKQFTDL |
Ga0209220_10153203 | 3300027587 | Forest Soil | MKVFVIVPAAGLGTRMAPHSPAKSKRKSPTKQFKE |
Ga0209221_11090421 | 3300027609 | Forest Soil | MKVVVIIPAAGLGTRMAPPAAAKSKKKAPSKQFRQ |
Ga0209330_10003121 | 3300027619 | Forest Soil | MKVVVIIPAAGLGTRMALMPPGNKGKPKTPSKQFSELGGTP |
Ga0209333_10042936 | 3300027676 | Forest Soil | MKVFVIVPAAGLGTRMGPPSPAKLRKKTPSKQFKE |
Ga0209333_11279631 | 3300027676 | Forest Soil | VIIPAAGLGTRMAPVPVGAKGKQKKAPPSKQFTELGGT |
Ga0209178_12719261 | 3300027725 | Agricultural Soil | MRVVVIIPAAGLGTRMVGAPPPGRSAAASKLPSPSKQFTE |
Ga0208989_101421651 | 3300027738 | Forest Soil | MKVVVIIPAAGLGTRMAPVPSAQDKGKKSLPSKQFTDLGGEP |
Ga0209656_100555133 | 3300027812 | Bog Forest Soil | MKVFVIVPAAGLGTRMAPPSAAKSKKKAPSKQFKELGGVPILV |
Ga0209039_103497451 | 3300027825 | Bog Forest Soil | MKVVVIIPAAGLGTRMAPMPGAKDKQKKTPPSKQFTELGGTPILI |
Ga0209773_104693902 | 3300027829 | Bog Forest Soil | MKVFVIVPAAGLGTRMAPAAAAKPKKKSPTKAGDRAL |
Ga0209580_101608651 | 3300027842 | Surface Soil | MKVVVIIPAAGLGTRMSPMPSAKDAKEKKAHPSKQFTELG |
Ga0209283_100570931 | 3300027875 | Vadose Zone Soil | MKVIVIIPAAGLGTRMAPVPGKTAKGKKSPPSKQFTELAGTPI |
Ga0209169_102767521 | 3300027879 | Soil | MKVFVIIPAAGLGTRMAPMPSAKDASSGKAHPSKQ |
Ga0209275_106343671 | 3300027884 | Soil | MKVVVIIPAAGLGTRMAPVPVGAKGKQKKAPPSKQF |
Ga0209068_103498902 | 3300027894 | Watersheds | MKVFIILPAAGLGTRMAPMVAPGKKSAPSKQFTELAGTPIL |
Ga0209067_1000464610 | 3300027898 | Watersheds | MKVIVIIPAAGLGTRMSPMPTAKEVKEKKPHSSKQFTDLAGTPILI |
Ga0209067_103978302 | 3300027898 | Watersheds | MKVFVIVPAAGLGTRMAPVSTARAHKKSPSKQFKELGGVP |
Ga0209067_108912262 | 3300027898 | Watersheds | MKVIVIIPAAGLGTRMAPMPSAMDAKTKKPHPSKQFNDLAGTPI |
Ga0209488_107535401 | 3300027903 | Vadose Zone Soil | MKVTVIIPAAGLGTRMAPAGKKGAPSKQFFEISGTP |
Ga0209069_108321042 | 3300027915 | Watersheds | MKVFVIVPAAGLGTRMAPPSAAKSRKKAPTKQFKELGG |
Ga0265358_1025172 | 3300028010 | Rhizosphere | MKVIVIVPAAGLGTRMASAPQTKGKKPASTKQFTEL |
Ga0265355_10093101 | 3300028036 | Rhizosphere | MKVIVIIPAAGLGTRMSPVPGAKSKATQAAPSKQFT |
Ga0265349_10160571 | 3300028037 | Soil | MKVIVIIPAAGLGTRMAPVPTGDKKRKVPSKQFTDLGGT |
Ga0302144_102427561 | 3300028560 | Bog | MKVVVIIPAAGLGTRMAPMPVGAQGKQKKTPPSKQF |
Ga0302262_102186491 | 3300028743 | Fen | MKVFVIVPAAGLGTRMAPVTTDKKKSPSKQFKQLGG |
Ga0302156_101367321 | 3300028748 | Bog | MKVVVIIPAAGLGTRMAPMPVGDKSKQKAHPSKQFTELG |
Ga0308309_108945972 | 3300028906 | Soil | MKVVVIIPAAGLGTRMLPASDAKSKKPSASKQFSELGGTPILI |
Ga0302143_10841651 | 3300029918 | Bog | MKVFVIIPAAGLGTRMASPAPTKAHKKSPSKQFKEL |
Ga0302142_11807572 | 3300029920 | Bog | MKVVVIIPAAGLGTRMAAVPSGTQKHKTPPSKQFTELGGTPI |
Ga0311371_111509172 | 3300029951 | Palsa | MKVVVIIPAAGLGTRMAPVPVGAKGKQKKAPPSKQ |
Ga0302277_11275561 | 3300029982 | Bog | MKVIVIIPAAGLGTRMAPVPVGAKGDKKSPSKQFTELGGTPML |
Ga0302306_102720811 | 3300030043 | Palsa | MKVIVIIPAAGLGTRMAPIPTGTKDRKKTAPSKQF |
Ga0302306_103486202 | 3300030043 | Palsa | MKVVVIIPAAGLGTRMAPVPSAPISTSGAAAARKPHPSKQ |
Ga0310037_101825571 | 3300030494 | Peatlands Soil | MKVFVIVPAAGLGTRMAPPPGAKPAERSRKRAPTKQFK |
Ga0302192_102671472 | 3300030507 | Bog | MKVFVIIPAAGLGTRMASPSPTKSSKKSPSKQFKEL |
Ga0302192_102856651 | 3300030507 | Bog | MKVVVIIPAAGLGTRMAPMPVGAQGKQKKTPPSKQFTE |
Ga0302183_101784832 | 3300030509 | Palsa | MKVIVIIPAAGLGTRMGPMPGAKSKAGQPVPSKQFTELGGTP |
Ga0302275_102600572 | 3300030518 | Bog | MKVFVIIPAAGLGTRMASPSSAKSSKKSPSKQFKELDGVP |
Ga0311354_104921941 | 3300030618 | Palsa | MKVFVIVPAAGLGTRMAPPSAAASRKKAPTKQFKELGG |
Ga0302317_103964931 | 3300030677 | Palsa | MKVVVIIPAAGLGTRMAPMPTGDKGKPKALSKQFTELGG |
Ga0265765_10575911 | 3300030879 | Soil | MKVVVIIPAAGLGTRMAPVGHQKNSPPSKQFTERGGGP |
Ga0075386_119655842 | 3300030916 | Soil | MKVIVIIPAAGLGTRMTQAPDAKSKKPAASKQFSE |
Ga0073994_100711521 | 3300030991 | Soil | MKVVVIIPAAGLGTRMAPVPSAQDKGKKSAPSKQFTDLGGEPIL |
Ga0170824_1204044011 | 3300031231 | Forest Soil | MKVFVIVPAAGLGTRMAPHSVAKPRKKQPPTKQFKE |
Ga0302324_1002032064 | 3300031236 | Palsa | MKVVVIIPAAGLGTRMAPVPVGAKGKQKKAPPSKQFT |
Ga0302318_103438992 | 3300031258 | Bog | MKVFVIIPAAGLGTRMGVAHVGQTPPRSKQFLELA |
Ga0302326_112586351 | 3300031525 | Palsa | MKVVVIIPAAGLGTRMAPLAAAKSKKKAPSKQFQQLD |
Ga0265314_105286232 | 3300031711 | Rhizosphere | MKVVVIIPAAGLGTRMSSASSSLKSKSKQFFELQGTP |
Ga0307476_106819331 | 3300031715 | Hardwood Forest Soil | MKVIVIIPAAGLGTRMAPVPSARDKGKKSAPSKQFT |
Ga0307474_110763162 | 3300031718 | Hardwood Forest Soil | MKVVVIIPAAGLGTRMTSAPSAKTKKLAPSKQFTELGGTPIL |
Ga0318494_102730772 | 3300031751 | Soil | MKVVVIIPAAGLGTRMLPAGSAKTKSPSKQFTELGGVPIL |
Ga0307477_106647091 | 3300031753 | Hardwood Forest Soil | MKVVVIIPAAGLGTRMAPMPVGAKGKQKKVPPSKQFTELGG |
Ga0307473_100603083 | 3300031820 | Hardwood Forest Soil | MKVIVIIPAAGLGTRMAPVPSAQAKGKKSAPSKQFTD |
Ga0306921_101131521 | 3300031912 | Soil | MKVVVIIPAAGLGTRMASAPGGKGKKQAASKQFTEIAGTP |
Ga0310912_100395053 | 3300031941 | Soil | MKVVVIIPAAGLGTRMLPAGSAKTKSPSKQFTELGGVPI |
Ga0307479_103909661 | 3300031962 | Hardwood Forest Soil | MKVVVIIPAAGLGTRMGPVPVGAKGKSKKAPPMKQFTELGGT |
Ga0308176_108288801 | 3300031996 | Soil | MKVIVIIPAAGLGTRMAPVPSGKTAKGKNPHPSKQFTELA |
Ga0318575_102609982 | 3300032055 | Soil | MKVIVIIPAAGLGTRMAAATAAKKRKPAPSKQFTELGGVP |
Ga0318525_104411362 | 3300032089 | Soil | MKVIVIIPAAGLGTRMTSAPPAKSKVPVPSKQFTELK |
Ga0311301_124001181 | 3300032160 | Peatlands Soil | MKVVVIIPAAGLGTRMAPMPSAPIPSAGNAKTKTKTKKPIPSK |
Ga0307471_1024477851 | 3300032180 | Hardwood Forest Soil | MKVVVIIPAAGLGTRMSSASGAKPRKAAPSKQFTELGGT |
Ga0348332_108416212 | 3300032515 | Plant Litter | MKVVVIIPAAGLGTRMAPVPAGATGKPKKAPPPKQFTELGGTPIL |
Ga0335079_100744521 | 3300032783 | Soil | MKVFVIIPAAGLGTRMAPPAPVRRQKEQTKKDAPSKQFQ |
Ga0335078_102115151 | 3300032805 | Soil | MKVIVIIPAAGLGTRMAPMPSALDAKTKKPHPSKQF |
Ga0335078_108728961 | 3300032805 | Soil | MKVVVIIPAAGLGTRMAPVLSAKSAKSKKAPPSKQFTELGG |
Ga0335081_121070922 | 3300032892 | Soil | MKVVVIIPAAGLGTRMAPMPSAIISGNKDAKTKKPHPSKQFTEL |
Ga0335069_115528712 | 3300032893 | Soil | MKVVVIIPAAGLGTRMAGASKRAAPSKQFTEINGVP |
Ga0335072_101501831 | 3300032898 | Soil | MKVVVIIPAAGLGTRMAPVPSAKDVAGKKTPPSKQFTELGG |
Ga0335083_111456301 | 3300032954 | Soil | MKVVVIIPAAGLGTRMAPVPSAMDAKTKKPHPSKQFTDLGGTPILIH |
Ga0335077_122165892 | 3300033158 | Soil | MKVIVIIPAAGLGTRMSAISGGPRSKSKQFFELQGT |
Ga0326726_117715392 | 3300033433 | Peat Soil | MKVFVIVPAAGLGTRMASPSAARPRKKALSKQFKELGGVP |
Ga0314861_0201602_805_939 | 3300033977 | Peatland | MKVFVIVPAAGLGTRMAPVSSAKARKKTPTKQFKELGGVPILVHT |
Ga0326723_0612366_373_504 | 3300034090 | Peat Soil | MKVFVIVPAAGLGTRMAPLSAAKIRKKSPSKQFKELGGVPILVR |
⦗Top⦘ |