NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018604

Metagenome / Metatranscriptome Family F018604

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018604
Family Type Metagenome / Metatranscriptome
Number of Sequences 234
Average Sequence Length 39 residues
Representative Sequence MKVVVIIPAAGLGTRMASPPSGKGKKAGPSKQFTELGGTP
Number of Associated Samples 204
Number of Associated Scaffolds 234

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.40 %
% of genes near scaffold ends (potentially truncated) 99.57 %
% of genes from short scaffolds (< 2000 bps) 88.46 %
Associated GOLD sequencing projects 193
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.197 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.256 % of family members)
Environment Ontology (ENVO) Unclassified
(19.231 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.291 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 234 Family Scaffolds
PF01938TRAM 37.18
PF06094GGACT 2.99
PF01171ATP_bind_3 2.56
PF00903Glyoxalase 1.71
PF104171-cysPrx_C 1.28
PF14885GHL15 0.85
PF04342DMT_6 0.85
PF01850PIN 0.85
PF00654Voltage_CLC 0.43
PF03725RNase_PH_C 0.43
PF12826HHH_2 0.43
PF01712dNK 0.43
PF07676PD40 0.43
PF01066CDP-OH_P_transf 0.43
PF00069Pkinase 0.43
PF00781DAGK_cat 0.43
PF05187ETF_QO 0.43
PF10431ClpB_D2-small 0.43
PF04014MazE_antitoxin 0.43
PF03331LpxC 0.43
PF00005ABC_tran 0.43
PF00872Transposase_mut 0.43
PF01740STAS 0.43
PF09364XFP_N 0.43
PF01138RNase_PH 0.43
PF02470MlaD 0.43
PF00107ADH_zinc_N 0.43
PF13183Fer4_8 0.43
PF04138GtrA 0.43
PF03364Polyketide_cyc 0.43
PF04041Glyco_hydro_130 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 234 Family Scaffolds
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 2.56
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 2.56
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 2.56
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 2.56
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 2.56
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 2.56
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.71
COG3169Uncharacterized membrane protein, DMT/DUF486 familyFunction unknown [S] 0.85
COG2123Exosome complex RNA-binding protein Rrp42, RNase PH superfamilyIntracellular trafficking, secretion, and vesicular transport [U] 0.85
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 0.85
COG1185Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)Translation, ribosomal structure and biogenesis [J] 0.85
COG0689Ribonuclease PHTranslation, ribosomal structure and biogenesis [J] 0.85
COG2440Ferredoxin-like protein FixXEnergy production and conversion [C] 0.43
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 0.43
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.43
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.43
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.43
COG1428Deoxyadenosine/deoxycytidine kinaseNucleotide transport and metabolism [F] 0.43
COG0774UDP-3-O-acyl-N-acetylglucosamine deacetylaseCell wall/membrane/envelope biogenesis [M] 0.43
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.43
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.43
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.20 %
UnclassifiedrootN/A18.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004080|Ga0062385_10858873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter599Open in IMG/M
3300004092|Ga0062389_101469045All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300004092|Ga0062389_104620671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83518Open in IMG/M
3300004152|Ga0062386_101453863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae571Open in IMG/M
3300005174|Ga0066680_10117942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1639Open in IMG/M
3300005435|Ga0070714_101832349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium592Open in IMG/M
3300005529|Ga0070741_10022624All Organisms → cellular organisms → Bacteria9623Open in IMG/M
3300005529|Ga0070741_10254568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1670Open in IMG/M
3300005529|Ga0070741_11455740All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005532|Ga0070739_10123352All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300005536|Ga0070697_101174717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae684Open in IMG/M
3300005542|Ga0070732_10594223All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005542|Ga0070732_10787257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae580Open in IMG/M
3300005586|Ga0066691_10329963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium902Open in IMG/M
3300005602|Ga0070762_10223640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1160Open in IMG/M
3300005602|Ga0070762_10580117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae743Open in IMG/M
3300005610|Ga0070763_10047338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2033Open in IMG/M
3300005610|Ga0070763_10098438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1471Open in IMG/M
3300005921|Ga0070766_10543647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter776Open in IMG/M
3300005983|Ga0081540_1356549Not Available500Open in IMG/M
3300006028|Ga0070717_10037213All Organisms → cellular organisms → Bacteria3951Open in IMG/M
3300006032|Ga0066696_10613954Not Available705Open in IMG/M
3300006162|Ga0075030_100063138All Organisms → cellular organisms → Bacteria3067Open in IMG/M
3300006162|Ga0075030_101527678Not Available522Open in IMG/M
3300006172|Ga0075018_10423982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium681Open in IMG/M
3300006237|Ga0097621_102245821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium522Open in IMG/M
3300006800|Ga0066660_11689746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae504Open in IMG/M
3300006804|Ga0079221_10897725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium650Open in IMG/M
3300006804|Ga0079221_10987758All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300006854|Ga0075425_101100124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium905Open in IMG/M
3300006881|Ga0068865_100004197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8683Open in IMG/M
3300006881|Ga0068865_100325673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1237Open in IMG/M
3300006914|Ga0075436_100655383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae776Open in IMG/M
3300006954|Ga0079219_10545260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae829Open in IMG/M
3300009089|Ga0099828_10679328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117925Open in IMG/M
3300009089|Ga0099828_11475080All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300009177|Ga0105248_10025757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium6542Open in IMG/M
3300009523|Ga0116221_1151279Not Available1011Open in IMG/M
3300009645|Ga0116106_1303172All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300009646|Ga0116132_1219835All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300009660|Ga0105854_1199071Not Available665Open in IMG/M
3300009700|Ga0116217_10996482All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009792|Ga0126374_10092995All Organisms → cellular organisms → Bacteria1687Open in IMG/M
3300009824|Ga0116219_10009625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6385Open in IMG/M
3300009839|Ga0116223_10208716All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300010043|Ga0126380_11997916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium530Open in IMG/M
3300010322|Ga0134084_10474857Not Available502Open in IMG/M
3300010343|Ga0074044_10695501Not Available664Open in IMG/M
3300010358|Ga0126370_12527969Not Available512Open in IMG/M
3300010360|Ga0126372_10332318All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300010361|Ga0126378_10573781All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300010376|Ga0126381_103313837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300010379|Ga0136449_100977697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1366Open in IMG/M
3300010379|Ga0136449_103215009All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300010397|Ga0134124_10183818All Organisms → cellular organisms → Bacteria1887Open in IMG/M
3300010399|Ga0134127_10505254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300010866|Ga0126344_1092738All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300011000|Ga0138513_100058900All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300012089|Ga0153924_1137955All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012096|Ga0137389_10466359All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1082Open in IMG/M
3300012096|Ga0137389_10704320All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300012198|Ga0137364_10092039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2118Open in IMG/M
3300012359|Ga0137385_11434491Not Available554Open in IMG/M
3300012363|Ga0137390_10663010All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300012502|Ga0157347_1074128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300012683|Ga0137398_10242613All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300012685|Ga0137397_10511073All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300012923|Ga0137359_10347704Not Available1318Open in IMG/M
3300012929|Ga0137404_11419228Not Available641Open in IMG/M
3300013100|Ga0157373_11432406Not Available526Open in IMG/M
3300013306|Ga0163162_10927965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium982Open in IMG/M
3300013307|Ga0157372_10478222All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300013307|Ga0157372_11159652All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300013308|Ga0157375_13137435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300014314|Ga0075316_1036350Not Available1027Open in IMG/M
3300014491|Ga0182014_10101277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1734Open in IMG/M
3300014655|Ga0181516_10436744Not Available670Open in IMG/M
3300015054|Ga0137420_1293118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium987Open in IMG/M
3300015242|Ga0137412_10516462All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300015242|Ga0137412_10987341All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales604Open in IMG/M
3300015264|Ga0137403_10989821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300015371|Ga0132258_11053893All Organisms → cellular organisms → Bacteria2055Open in IMG/M
3300017924|Ga0187820_1167918All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300017925|Ga0187856_1200304Not Available724Open in IMG/M
3300017927|Ga0187824_10064963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1139Open in IMG/M
3300017940|Ga0187853_10549731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae500Open in IMG/M
3300017943|Ga0187819_10432763All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300017955|Ga0187817_10902134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium565Open in IMG/M
3300017961|Ga0187778_10987252All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300017972|Ga0187781_11396048All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300017973|Ga0187780_10019751All Organisms → cellular organisms → Bacteria4846Open in IMG/M
3300017973|Ga0187780_10926039All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300017975|Ga0187782_10903041All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300017994|Ga0187822_10241174All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300017998|Ga0187870_1146604All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300017999|Ga0187767_10194512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300018019|Ga0187874_10137821All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300018023|Ga0187889_10318650Not Available685Open in IMG/M
3300018028|Ga0184608_10533893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium500Open in IMG/M
3300018035|Ga0187875_10640728Not Available559Open in IMG/M
3300018043|Ga0187887_10941555Not Available511Open in IMG/M
3300018062|Ga0187784_10961678All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300018062|Ga0187784_10989678All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300018062|Ga0187784_11225386All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300018077|Ga0184633_10253157All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300018077|Ga0184633_10354337All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300018085|Ga0187772_10060073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2361Open in IMG/M
3300018085|Ga0187772_10672018Not Available741Open in IMG/M
3300018433|Ga0066667_10261680All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300018468|Ga0066662_10205311All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300018482|Ga0066669_10674212All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300019786|Ga0182025_1019296Not Available525Open in IMG/M
3300019865|Ga0193748_1005116All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300019888|Ga0193751_1003393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9370Open in IMG/M
3300020199|Ga0179592_10461871Not Available547Open in IMG/M
3300020222|Ga0194125_10270495Not Available1148Open in IMG/M
3300020579|Ga0210407_11382352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium523Open in IMG/M
3300020580|Ga0210403_10085207All Organisms → cellular organisms → Bacteria2551Open in IMG/M
3300020580|Ga0210403_10584538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium903Open in IMG/M
3300020580|Ga0210403_10919306All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300020582|Ga0210395_11225120Not Available551Open in IMG/M
3300021178|Ga0210408_10540988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium925Open in IMG/M
3300021178|Ga0210408_10732124Not Available777Open in IMG/M
3300021181|Ga0210388_10160781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1954Open in IMG/M
3300021181|Ga0210388_11348692All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300021265|Ga0213906_103427All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300021358|Ga0213873_10222648All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300021403|Ga0210397_10428738All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium992Open in IMG/M
3300021405|Ga0210387_10903953Not Available777Open in IMG/M
3300021406|Ga0210386_10420060All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300021420|Ga0210394_10457204All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300021477|Ga0210398_11402970All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300021478|Ga0210402_11004860Not Available761Open in IMG/M
3300021559|Ga0210409_10191106All Organisms → cellular organisms → Bacteria1867Open in IMG/M
3300021858|Ga0213852_1504602All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300022510|Ga0242652_1009851All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300022521|Ga0224541_1005247All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300022531|Ga0242660_1048564All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300022730|Ga0224570_100726All Organisms → cellular organisms → Bacteria → Acidobacteria2635Open in IMG/M
3300024176|Ga0224565_1014677Not Available840Open in IMG/M
3300024288|Ga0179589_10280247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium746Open in IMG/M
3300025414|Ga0208935_1017958All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300025500|Ga0208686_1076089Not Available741Open in IMG/M
3300025576|Ga0208820_1148715Not Available528Open in IMG/M
3300025612|Ga0208691_1082524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae725Open in IMG/M
3300025905|Ga0207685_10631715All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300025929|Ga0207664_10204528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1706Open in IMG/M
3300025939|Ga0207665_10145319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1694Open in IMG/M
3300025982|Ga0208139_1036223All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300026116|Ga0207674_10208191All Organisms → cellular organisms → Bacteria1905Open in IMG/M
3300026291|Ga0209890_10040762All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300026309|Ga0209055_1231520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300026318|Ga0209471_1115924All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300026528|Ga0209378_1250613All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300026550|Ga0209474_10091157All Organisms → cellular organisms → Bacteria2072Open in IMG/M
3300026557|Ga0179587_10411734All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300027034|Ga0209730_1002495All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300027383|Ga0209213_1058121All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300027432|Ga0209421_1072757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300027432|Ga0209421_1080919All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300027548|Ga0209523_1044147All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300027587|Ga0209220_1015320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2043Open in IMG/M
3300027609|Ga0209221_1109042Not Available708Open in IMG/M
3300027619|Ga0209330_1000312All Organisms → cellular organisms → Bacteria22627Open in IMG/M
3300027676|Ga0209333_1004293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5291Open in IMG/M
3300027676|Ga0209333_1127963All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300027725|Ga0209178_1271926All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300027738|Ga0208989_10142165All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300027812|Ga0209656_10055513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2215Open in IMG/M
3300027825|Ga0209039_10349745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae574Open in IMG/M
3300027829|Ga0209773_10469390Not Available519Open in IMG/M
3300027842|Ga0209580_10160865All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300027875|Ga0209283_10057093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2497Open in IMG/M
3300027879|Ga0209169_10276752All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300027884|Ga0209275_10634367All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300027894|Ga0209068_10349890Not Available836Open in IMG/M
3300027898|Ga0209067_10004646All Organisms → cellular organisms → Bacteria → Acidobacteria7690Open in IMG/M
3300027898|Ga0209067_10397830All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300027898|Ga0209067_10891226All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300027903|Ga0209488_10753540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117694Open in IMG/M
3300027915|Ga0209069_10832104All Organisms → cellular organisms → Bacteria → Proteobacteria554Open in IMG/M
3300028010|Ga0265358_102517Not Available622Open in IMG/M
3300028036|Ga0265355_1009310Not Available794Open in IMG/M
3300028037|Ga0265349_1016057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium668Open in IMG/M
3300028560|Ga0302144_10242756All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300028743|Ga0302262_10218649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300028748|Ga0302156_10136732All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300028906|Ga0308309_10894597Not Available771Open in IMG/M
3300029918|Ga0302143_1084165All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300029920|Ga0302142_1180757All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300029951|Ga0311371_11150917All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300029982|Ga0302277_1127556All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300030043|Ga0302306_10272081Not Available650Open in IMG/M
3300030043|Ga0302306_10348620Not Available567Open in IMG/M
3300030494|Ga0310037_10182557All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300030507|Ga0302192_10267147All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300030507|Ga0302192_10285665All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300030509|Ga0302183_10178483Not Available832Open in IMG/M
3300030518|Ga0302275_10260057All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300030618|Ga0311354_10492194All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300030677|Ga0302317_10396493Not Available609Open in IMG/M
3300030879|Ga0265765_1057591All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300030916|Ga0075386_11965584All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300030991|Ga0073994_10071152Not Available711Open in IMG/M
3300031231|Ga0170824_120404401All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300031236|Ga0302324_100203206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3158Open in IMG/M
3300031258|Ga0302318_10343899All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300031525|Ga0302326_11258635Not Available1012Open in IMG/M
3300031711|Ga0265314_10528623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345617Open in IMG/M
3300031715|Ga0307476_10681933All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300031718|Ga0307474_11076316All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300031751|Ga0318494_10273077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium972Open in IMG/M
3300031753|Ga0307477_10664709All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300031820|Ga0307473_10060308All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1850Open in IMG/M
3300031912|Ga0306921_10113152All Organisms → cellular organisms → Bacteria3156Open in IMG/M
3300031941|Ga0310912_10039505All Organisms → cellular organisms → Bacteria → Acidobacteria3264Open in IMG/M
3300031962|Ga0307479_10390966All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300031996|Ga0308176_10828880All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300032055|Ga0318575_10260998All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium875Open in IMG/M
3300032089|Ga0318525_10441136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium667Open in IMG/M
3300032160|Ga0311301_12400118Not Available595Open in IMG/M
3300032180|Ga0307471_102447785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium660Open in IMG/M
3300032515|Ga0348332_10841621All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300032783|Ga0335079_10074452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3864Open in IMG/M
3300032805|Ga0335078_10211515All Organisms → cellular organisms → Bacteria2681Open in IMG/M
3300032805|Ga0335078_10872896All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300032892|Ga0335081_12107092Not Available597Open in IMG/M
3300032893|Ga0335069_11552871All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300032898|Ga0335072_10150183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2860Open in IMG/M
3300032954|Ga0335083_11145630All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300033158|Ga0335077_12216589All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300033433|Ga0326726_11771539All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300033977|Ga0314861_0201602All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300034090|Ga0326723_0612366Not Available505Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.26%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.70%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.70%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.42%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.42%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.99%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.99%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.99%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.14%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.28%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.28%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.85%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.43%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.43%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.43%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.43%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.43%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.43%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.43%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.43%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.43%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.43%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.43%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.43%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.43%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.43%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.43%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.43%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.43%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.43%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.43%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.43%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012089Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaGHost-AssociatedOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019865Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021265Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Shaw_3EnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022730Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2Host-AssociatedOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025982Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027034Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028010Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6Host-AssociatedOpen in IMG/M
3300028036Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2Host-AssociatedOpen in IMG/M
3300028037Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062385_1085887323300004080Bog Forest SoilMKVVVIIPAAGLGTRMAPMPVGATGKQKNAPPSKQFTELGGTPILI
Ga0062389_10146904533300004092Bog Forest SoilMKVVVIIPAAGLGTRMSPAAGAKGKAAPAVPSKQSKQFTELGGTPI
Ga0062389_10462067113300004092Bog Forest SoilMKVIVIIPAAGLGTRMAPMPSAMDAKTKKPHPSKQFSELAGTPIL
Ga0062386_10145386313300004152Bog Forest SoilMKVVVIIPAAGLGTRMGPMPGARSKAKQAALSKQFTELGGTPILLRT
Ga0066680_1011794213300005174SoilMKVIVIIPAAGLGTRMAPVPGKTAKGKKPPPSKQFTELAGTPI
Ga0070714_10183234913300005435Agricultural SoilMKVIVIIPAAGLGTRMASGPAGAKGTLKGTPPSKQFTELGGTPIL
Ga0070741_10022624123300005529Surface SoilMKVIVIIPAAGLGTRMGPVSSAKAAKSKKAQASKQFTE
Ga0070741_1025456823300005529Surface SoilMSVIVIIPAAGLGTRMAAASGTRPPVSKQFAELGGVP
Ga0070741_1145574013300005529Surface SoilMKVIVVIPAAGLGTRMTSAPSSKGKKPTASKQFTQLGGTP
Ga0070739_1012335223300005532Surface SoilMKVTVIIPAAGLGTRMATTPGSVPASPKQFAEIRG
Ga0070697_10117471713300005536Corn, Switchgrass And Miscanthus RhizosphereMKVFVIVPAAGLGTRMAPPSAAKSKRKAPTKQFKELGGVP
Ga0070732_1059422323300005542Surface SoilMKVIVIIPAAGLGTRMAPMPSALDAKTKKPHPSKQFTELAGTPILI
Ga0070732_1078725713300005542Surface SoilMKVTVVIPAAGLGTRMAPAAKAKKPAATKQFAELQGKPI
Ga0066691_1032996313300005586SoilVIIPAAGLGTRMAPVPSAQDKGKKCAPSKQFTDLGGKP
Ga0070762_1022364013300005602SoilMKVIVIIPAAGLGTRMASKTSAQRPQHKTQPSKQFTELAGTPI
Ga0070762_1058011723300005602SoilMKVFVIIPAAGLGTRMAPPSPLTGSSAGSRKAGPTKQFKELGGV
Ga0070763_1004733833300005610SoilMKVLVIIPAAGLGTRMGPMPVGAIGKQKRALPSKQFTE
Ga0070763_1009843813300005610SoilMKVIVIIPAAGLGTRMASKTSAQRPQHKTQPSKQFTELAGTPIL
Ga0070766_1054364723300005921SoilMKVVVIIPAAGLGTRMSAVSGGPKSKSKQFFELQGTP
Ga0081540_135654923300005983Tabebuia Heterophylla RhizosphereMKVFVIIPAAGLGTRMIPAAGSKGKKPVASKQFAELGGIPI
Ga0070717_1003721313300006028Corn, Switchgrass And Miscanthus RhizosphereMKVVVIIPAAGLGTRMAPIPAGGKSKQKKTPPSKQFTELGG
Ga0066696_1061395423300006032SoilMKVVAIIPAAGLGTRMASAPESKGKKPAASKQFTELKGT
Ga0075030_10006313853300006162WatershedsMKVVVIIPAAGLGTRMAPAHSALDAKEKKPHPSKQFTELAGTPIL
Ga0075030_10152767813300006162WatershedsMKVVVIIPAAGLGTRMAPVPSAADAKKKPHPSKQFTELA
Ga0075018_1042398213300006172WatershedsMKVLVIIPAAGLGTRMTPAPDAKSKKPAASKQFSEIGGTPILVHT
Ga0097621_10224582113300006237Miscanthus RhizosphereLQPAMKVVVIIPAAGLGTRMSPASDAKSKKPAASKQFFKIGGTPILI
Ga0066660_1168974623300006800SoilMKVFAIIPAAGLGTRMAAGKRSGQATPSKQFTEVGGVP
Ga0079221_1089772513300006804Agricultural SoilMKVVVIIPAAGLGTRMAAQSGARPRQATKQFAEIAGKP
Ga0079221_1098775823300006804Agricultural SoilMRVVVIIPAAGLGTRMAAYSGARTGQPTKQFAEIAGKGA
Ga0075425_10110012413300006854Populus RhizosphereMKVLAIIPAAGLGTRMASAPASKGKKQVASKQFTEL
Ga0068865_10000419713300006881Miscanthus RhizosphereMKVIVIIPAAGLGTRMSSAGGAKRSKPSATKQFAE
Ga0068865_10032567333300006881Miscanthus RhizosphereMKVVVIIPAAGLGTRMAPASDARNKKPTASKQFSEIG
Ga0075436_10065538313300006914Populus RhizosphereMKVIVIIPAAGLGTRMAPVPSGKTAKGKNPHPSKQFTDLAGTPI
Ga0079219_1054526023300006954Agricultural SoilMNVIVIIPAAGLGTRMAAASGARIAPGASKQFAELHG
Ga0099828_1067932823300009089Vadose Zone SoilMNVFVIIPAAGLGTRMSAGAKKGSRPSKQFTELAG
Ga0099828_1147508013300009089Vadose Zone SoilMKVVVIIPAAGLGTRMAPASDATGKKHAASKQFFE
Ga0105248_1002575783300009177Switchgrass RhizosphereMKVVVIIPAAGLGTRMAPASDARNKKPTASKQFSEIGGT
Ga0116221_115127913300009523Peatlands SoilMKVFVIVPAAGLGTRMAPPSAAKSKKKAPTKQFKELGG
Ga0116106_130317213300009645PeatlandMKVFVIVPAAGLGTRMAPPSAEKARRKAPTKQFKELGG
Ga0116132_121983523300009646PeatlandMKVFVIVPAAGLGTRMAPPSAAPSAEKARRKAPTKQFKELGG
Ga0105854_119907113300009660Permafrost SoilMKVFVIIPAAGLGTRMGAAPAGQTRARSKQFLELDGV
Ga0116217_1099648223300009700Peatlands SoilMKVFVIIPAAGLGTRMAPASGRIRRESPSKQFKELGGAPILVRT
Ga0126374_1009299513300009792Tropical Forest SoilMNVIVIIPAAGLGTRMAPAGKKAAASKQFFEIDGVP
Ga0116219_1000962513300009824Peatlands SoilMKVVVIIPAAGLGTRMAPMPSAPIPSARNAKTKKPIPSKQFTELGGTP
Ga0116223_1020871613300009839Peatlands SoilMKVIVIIPAAGMGTRMAPMPSALDTKTKKPHPSKQFS
Ga0126380_1199791623300010043Tropical Forest SoilMKVIVIIPAAGLGTRMAPVPSATDAKLKKAHPSKQFTELAGTPILI
Ga0134084_1047485713300010322Grasslands SoilMRVFVIIPAAGLGTRMSAASGATRGSQPTKQFAEIGGAPI
Ga0074044_1069550113300010343Bog Forest SoilMKVFVIVPAAGLGTRMAASSAAPLPGKVRKKAPTKQFKE
Ga0126370_1252796913300010358Tropical Forest SoilMNVSAIIPAAGLGTRMAAAGPTKARKSTPSKQFTDLAG
Ga0126372_1033231813300010360Tropical Forest SoilMKVFVIIPAAGLGTRMAPVSTAKSRRKTPSKQFKELGG
Ga0126378_1057378123300010361Tropical Forest SoilMKVFVIIPAAGFGTRMAPVSVAKDAKKPVPSKQFTDLKGT
Ga0126381_10331383713300010376Tropical Forest SoilMKVIVIIPAAGLGTRMMAGPGDKARKPAATKQFAELQGV
Ga0136449_10097769713300010379Peatlands SoilMKVVVIIPAAGLGTRMSPMPSAMISSNKDAKTRKPHPSK
Ga0136449_10321500913300010379Peatlands SoilMKVFVIVPAAGLGTRMAPPSPAKARKKTPSKQFKELGGVPIL
Ga0134124_1018381843300010397Terrestrial SoilMKVLVIIPAAGLGTRMAQASDAKSKKPAASKQFSEI
Ga0134127_1050525413300010399Terrestrial SoilMKVIVIIPAAGLGTRMSSAGGSKRSKPSATKQFAELDGV
Ga0126344_109273813300010866Boreal Forest SoilMKVIVIIPAAGLGTRMAPMPSALDAKTKTKRPHPSKQFTDLAGTP
Ga0138513_10005890023300011000SoilMKVTVIIPAAGLGTRMASPSRAKSKGASPSKQFTELKGT
Ga0153924_113795513300012089Attine Ant Fungus GardensMKVVVIIPAAGLGTRMAPMPVGAKGKPKKAPPSKQFTELGGTPI
Ga0137389_1046635933300012096Vadose Zone SoilVAPVYWQTAMKVIVIIPAAGLGTRMAPMPGGAKGKQRKGPPSKQ
Ga0137389_1070432013300012096Vadose Zone SoilMKVSVIIPAAGLGTRMATAPAAKGRKSAPSKQFTELD
Ga0137364_1009203943300012198Vadose Zone SoilMKVFVIVPAAGLGTRMIQPSAAKAKKKAPSKQFKELGGIPILV
Ga0137385_1143449113300012359Vadose Zone SoilMKVFVIVPAAGLGTRMGPPSVAKTKKRAPSKQFKELGGIPIL
Ga0137390_1066301013300012363Vadose Zone SoilMKVIVIIPAAGLGTRMAPVSAGAKGKQKASPSKQFTELGGT
Ga0157347_107412813300012502Arabidopsis RhizosphereMKVSVIIPAAGLGTRMAAAARDKKPAASKQFADLAGT
Ga0137398_1024261313300012683Vadose Zone SoilMKVTVIIPAAGLGTRMAPAGKKGAPSKQFFEISGVP
Ga0137397_1051107323300012685Vadose Zone SoilMKVFVIVPAAGLGTRMAPPSAAKSRKTLASKQFKELGGV
Ga0137359_1034770413300012923Vadose Zone SoilMKVFVIIPAAGLGTRMAPADTKTKTAKNAKVPKQFTQL
Ga0137404_1141922813300012929Vadose Zone SoilMKVFVIIPAAGLGTRMAPADTKAKTAKNAKVSKQFTQLGD
Ga0157373_1143240623300013100Corn RhizosphereMKIVVIIPAAGLGTRMAPVPSAKAGKPAASKQFVALLG
Ga0163162_1092796513300013306Switchgrass RhizosphereMKVIVIIPAAGLGTRMSSAGGAKRSKPSATKQFAEL
Ga0157372_1047822213300013307Corn RhizosphereMKVIVIIPAAGLGTRMAPVPSGKAGKGKNPHPSKQFTDLAGT
Ga0157372_1115965213300013307Corn RhizosphereMKVIVIIPAAGLGTRMAPVPSGKAAKGKNPHPSKQFTDLAGTPILI
Ga0157375_1313743513300013308Miscanthus RhizosphereMKVIVIIPAAGLGTRMSSAGGAKRSKPSATKQFAELAGVP
Ga0075316_103635013300014314Natural And Restored WetlandsMKVIVIIPAAGLGTRMAAPAKGPRAAPSKQFTEIGGVPI
Ga0182014_1010127713300014491BogMKVFVIVPAAGLGTRMAPPSTAKSKKKAPTKQFKEL
Ga0181516_1043674413300014655BogMKVFVIIPAAGLGTRMGVAHAGKAPLRSKQFLELQGVPI
Ga0137420_129311823300015054Vadose Zone SoilMKVVVIIPAAGMGTRMAPARGAQRKKSSPSKQFTELGGTP
Ga0137412_1051646213300015242Vadose Zone SoilMKVIVIIPAAGLGTRMAPSAGDKGKQKKAPPSKQFTELGGTPI
Ga0137412_1098734123300015242Vadose Zone SoilMKVVVIIPAAGLGTRMAPMPRAKDAKTKKPHPSKQFTDLGGTP
Ga0137403_1098982123300015264Vadose Zone SoilMKVFVIVPAAGLGTRMAPPSAAKAKKRAPSKQFKEL
Ga0132258_1105389313300015371Arabidopsis RhizosphereMKVIVIIPAAGLGTRMAPMPSAKDAKTKKPHPSKQFTDLAG
Ga0187820_116791813300017924Freshwater SedimentMKVLVIIPAAGLGTRMAPMPSAMDPKSKKAHSTKQFTELAGTPI
Ga0187856_120030423300017925PeatlandMKVFVIVPAAGLGTRMAPPSAAKSKKKAPSKQFKELGG
Ga0187824_1006496323300017927Freshwater SedimentMKVVVIIPAAGLGTRMASPSLTKSSKTPTKQFTELGGTPI
Ga0187853_1054973123300017940PeatlandMKVFVIVPAAGLGTRMAPLSPGKIRKESPSKQFKDLGGVPILVRTL
Ga0187819_1043276313300017943Freshwater SedimentMKVFVIVPAAGLGTRMAPPSGAKSAERSRKKAPTKQFKELGGVPIL
Ga0187817_1090213423300017955Freshwater SedimentMKVVVIIPAAGLGTRMASAPGTKLKKPAATKQFTELGGTP
Ga0187778_1098725223300017961Tropical PeatlandMKVVVIIPAAGLGTRMSTPAAARGAKPAPSKQFTDLAGT
Ga0187781_1139604813300017972Tropical PeatlandMKVFVIVPAAGLGTRMVPPSGAKAAERSRKKAPTKQ
Ga0187780_1001975163300017973Tropical PeatlandMKVVVIIPAAGLGTRMASALGGKGKKQGASKQFTE
Ga0187780_1092603913300017973Tropical PeatlandMKVFVIVPAAGLGTLMAPPSAAKSRKKAPTKQFKELGGVPILV
Ga0187782_1090304123300017975Tropical PeatlandMKVFVIIPAAGLGTRMAPVPSAMDAKSKKTQPTKQFTELAGT
Ga0187822_1024117413300017994Freshwater SedimentMKVVVIIPAAGLGTRMLPGGSAKAKSPSKQFTELGGTPILI
Ga0187870_114660423300017998PeatlandMKVVVIIPAAGLGTRMAPMPVGAPGKQKKRLPSKQFTELGG
Ga0187767_1019451213300017999Tropical PeatlandMKVVVIIPAAGLGTRMASAPSGKKPAASKQFAELVGTPIV
Ga0187874_1013782133300018019PeatlandMKVIVIIPAAGLGTRMAPMPSAMDAKTKRPHPSKQFNELAG
Ga0187889_1031865013300018023PeatlandMKVFVIVPAAGLGTRMAPLSAAKSKEKAPSKQFKE
Ga0184608_1053389313300018028Groundwater SedimentMKVVVIIPAAGLGTRMASVPSAKGRNATPSKQFTELGG
Ga0187875_1064072813300018035PeatlandMKVIVIIPAAGLGTRMASSTATAQGRARSKQFAQLE
Ga0187887_1094155523300018043PeatlandMKVMVIIPAAGLGTRMASSTATAQGRARSKQFAQL
Ga0187784_1096167823300018062Tropical PeatlandMKVFVIVPAAGLGTRMAPPSGAKAAERSRKKAPTKQFKELGGVPIL
Ga0187784_1098967823300018062Tropical PeatlandMKVVVIIPAAGLGTRMAPVPSVKDAKTAPPAKQFT
Ga0187784_1122538623300018062Tropical PeatlandMKVVVIIPAAGLGKRMAPVHSAAGAGSKDAKSSPPAKQFFELAGT
Ga0184633_1025315723300018077Groundwater SedimentMKVFVIIPAAGLGTRMAPPAKAGRKPGASKQFTELGGVPIL
Ga0184633_1035433723300018077Groundwater SedimentMKVFVIIPAAGLGTRMAPPAKAGRKPGASKQFTELGGVPILI
Ga0187772_1006007343300018085Tropical PeatlandMKVIVIIPAAGLGTRMAPVPAAPVPGAKDAKEKKDAKDKKPHPSKQFTELAG
Ga0187772_1067201813300018085Tropical PeatlandMKVVVIIPAAGLGTRMAPVSSAKDAKDKKPHPSKQFTELAGTPI
Ga0066667_1026168013300018433Grasslands SoilMKVVVIIPAAGLGTRMASPPSGKGKKAGPSKQFTELGGTPVLI
Ga0066662_1020531113300018468Grasslands SoilMKVVVIIPAAGLGTRMASPPSGKGKKAGPSKQFTELGGTP
Ga0066669_1067421223300018482Grasslands SoilMKVVAIIPAAGLGTRMASAPESKGKKPVASKQFTELGG
Ga0182025_101929613300019786PermafrostMKVVVIIPAAGLGTRMAAMPVGAKGKQKARSSKSTEPGG
Ga0193748_100511613300019865SoilMKVVVIIPAAGLGTRMASVSSVKGKKAAPSKQFTE
Ga0193751_100339313300019888SoilMKVFVIVPAAGLGTRMAPHSPAKSKRKSPTKQFKELGGV
Ga0179592_1046187123300020199Vadose Zone SoilMKVFVILPAAGLGTRMGPLAAPGKKSAPSKQFTELD
Ga0194125_1027049513300020222Freshwater LakeMKVSVIIPAAGLGTRMIRPAAAGDPPPAVARKQFLLLDGEP
Ga0210407_1138235223300020579SoilMKVVVIIPAAGLGTRMASSPGARGKKPAASKQFTELG
Ga0210403_1008520743300020580SoilMKVVVIIPAAGLGTRMASAASTKNKKPAASKQFTEL
Ga0210403_1058453813300020580SoilMKVVVIIPAAGLGTRMAAAGSTRAKMASPSKQFTQLGG
Ga0210403_1091930613300020580SoilMKIVVIIPAAGLGTRMVAPQATKHSKPAPRKQFVELRGSPVL
Ga0210395_1122512023300020582SoilMKVVVIIPAAGLGTRMGPMPVGDKAKTKTLSKQFTELAGIQIMI
Ga0210408_1054098813300021178SoilMKVVVIIPAAGLGTRMAKAGARPGQATKQFAEIAGKP
Ga0210408_1073212413300021178SoilMKVVVIIPAAGLGTRMVSVSDARSKKPAASKQFSEIGGTP
Ga0210388_1016078133300021181SoilMKVFVIVPAAGLGTRMAVPSTASSAAKPRKKAPTKQFKELGGVPILVH
Ga0210388_1134869213300021181SoilMKVVLIIPAAGLGTRMAPVAGATKASKAPPSKQFT
Ga0213906_10342713300021265SoilMKVIVIIPAAGLGTRMSAAAAKKGKKSPAPTKQFAEL
Ga0213873_1022264823300021358RhizosphereMKVVVIIPAAGLGTRMASAPAGGKKPAASKQFAELGGI
Ga0210397_1042873833300021403SoilMKVIVIIPAAGLGTRMAPMPSAMDAKTKKPHPSKQFNDLAGTPIL
Ga0210387_1090395323300021405SoilMKVIVIVPAAGLGTRMASAPRTKGKKPASTKQFTEL
Ga0210386_1042006023300021406SoilMKVVVIIPAAGLGTRMAPVPSAMDSKSKKPHPSKQFTEL
Ga0210394_1045720413300021420SoilMKVIVIVPAAGLGTRMASAPRTKGKKPASTKQFTELGGGAI
Ga0210398_1140297023300021477SoilMKVIVIIPAAGLGTRMSPMPSAMISSNKDAKTKKPHPSKQFTDLAGT
Ga0210402_1100486013300021478SoilMKVVVIIPAAGLGTRMLPASDAKSKKPSASKQFSELGGTPI
Ga0210409_1019110613300021559SoilMKVIAIIPAAGLGTRMASAPSAKGKKPGATKQFTELGG
Ga0213852_150460223300021858WatershedsMKVVVIIPAAGLGTRMAPVSSAKDTKPHLSKQFTELAGTPIL
Ga0242652_100985123300022510SoilMKVVVIIPAAGLGTRMAPVSSAKDSKPHLTKQFTELAGTP
Ga0224541_100524723300022521SoilMKVFVIVPAAGLGTRMAPPSVAASRKKASSKQFKELGGM
Ga0242660_104856413300022531SoilMKVVVIIPAAGLGTRMAPVSSAKDSKPHLTKQFTELAGTPIL
Ga0224570_10072613300022730RhizosphereMKVIVIIPAAGLGTRMGPMPRARSKAMQPVLSKQFTELGGTPIL
Ga0224565_101467723300024176Plant LitterMKVAVIIPAAGLGTRMSPVPVGAKPAKAPPSKQFTEL
Ga0179589_1028024713300024288Vadose Zone SoilLQPAMKVVVIIPAAGLGTRMTSVSDARSKKPAASKQFSEIGGTPIL
Ga0208935_101795833300025414PeatlandMKVVVIIPAAGLGTRMAPMPVGKGKQKKAPPSKQF
Ga0208686_107608923300025500PeatlandMKVIVIIPAAGLGTRMAPMLVGAKDKQKKAPPSKQFTELGGT
Ga0208820_114871513300025576PeatlandMKVFVIVPAAGLGTRMAPPSAAKSKKKAPSKQFKEL
Ga0208691_108252413300025612PeatlandMKVVVIIPAAGLGTRMAPMPVGKGKQKKAPPSKQFTELGGTP
Ga0207685_1063171523300025905Corn, Switchgrass And Miscanthus RhizosphereMKVTVIIPAAGLGTRMASPSRAKSKGASPSKQFTE
Ga0207664_1020452813300025929Agricultural SoilMKVTVIVPAAGLGTRMASAAKDKKPTASKQFAELKGKP
Ga0207665_1014531933300025939Corn, Switchgrass And Miscanthus RhizosphereMKVIAIIPAAGLGTRMSFAPGTKMKKAAPSKQFTELGGTPILLH
Ga0208139_103622313300025982Rice Paddy SoilMKVIVIIPAAGLGTRMGSVSATAQGKAPSKQFLTIAG
Ga0207674_1020819133300026116Corn RhizosphereMKVIVIIPAAGLGTRMAPVPSGKTAKGKNPHPSKQFTEL
Ga0209890_1004076223300026291SoilMKVIVIIPAAGLGTRMAPMPSALDAKTKKAHPSKQFTELA
Ga0209055_123152013300026309SoilMKVIVIIPAAGLGTRMASAPAGKAAKPAASKQFLELDGTP
Ga0209471_111592423300026318SoilMKVFVIVPAAGLGTRMAPHSAAKSRKKSLTKQFKELGG
Ga0209378_125061323300026528SoilMKVVVIIPAAGLGTRMASPPSGKGKKAGPSKQFTELGGTPV
Ga0209474_1009115733300026550SoilMKVFVIIPAAGLGTRMAGPSAKAKSPKSAKVPKQLTEVGDAPILIHTL
Ga0179587_1041173413300026557Vadose Zone SoilMKVIVIIPAAGLGTRMAPMLSALDHKTKKPHPSKQFTDLGGTPI
Ga0209730_100249513300027034Forest SoilMKVFVIIPAAGLGTRMAPVSSAKDSKPHLSKQFTELAG
Ga0209213_105812123300027383Forest SoilMKVFVIVPAAGLGTRMGSPSSTKARKRAPSKQFKELGGVPIL
Ga0209421_107275713300027432Forest SoilMKVFVIVPAAGLGTRMSPPSSAKSRKKAPTKQFKELGGVPILV
Ga0209421_108091923300027432Forest SoilMKVVVIIPAAGLGTRMAPMPAGAKGKQKKAPPSKQ
Ga0209523_104414713300027548Forest SoilMKVIVIIPAAGLGTRMAPIPSALDAKTRKPHPSKQFTDL
Ga0209220_101532033300027587Forest SoilMKVFVIVPAAGLGTRMAPHSPAKSKRKSPTKQFKE
Ga0209221_110904213300027609Forest SoilMKVVVIIPAAGLGTRMAPPAAAKSKKKAPSKQFRQ
Ga0209330_100031213300027619Forest SoilMKVVVIIPAAGLGTRMALMPPGNKGKPKTPSKQFSELGGTP
Ga0209333_100429363300027676Forest SoilMKVFVIVPAAGLGTRMGPPSPAKLRKKTPSKQFKE
Ga0209333_112796313300027676Forest SoilVIIPAAGLGTRMAPVPVGAKGKQKKAPPSKQFTELGGT
Ga0209178_127192613300027725Agricultural SoilMRVVVIIPAAGLGTRMVGAPPPGRSAAASKLPSPSKQFTE
Ga0208989_1014216513300027738Forest SoilMKVVVIIPAAGLGTRMAPVPSAQDKGKKSLPSKQFTDLGGEP
Ga0209656_1005551333300027812Bog Forest SoilMKVFVIVPAAGLGTRMAPPSAAKSKKKAPSKQFKELGGVPILV
Ga0209039_1034974513300027825Bog Forest SoilMKVVVIIPAAGLGTRMAPMPGAKDKQKKTPPSKQFTELGGTPILI
Ga0209773_1046939023300027829Bog Forest SoilMKVFVIVPAAGLGTRMAPAAAAKPKKKSPTKAGDRAL
Ga0209580_1016086513300027842Surface SoilMKVVVIIPAAGLGTRMSPMPSAKDAKEKKAHPSKQFTELG
Ga0209283_1005709313300027875Vadose Zone SoilMKVIVIIPAAGLGTRMAPVPGKTAKGKKSPPSKQFTELAGTPI
Ga0209169_1027675213300027879SoilMKVFVIIPAAGLGTRMAPMPSAKDASSGKAHPSKQ
Ga0209275_1063436713300027884SoilMKVVVIIPAAGLGTRMAPVPVGAKGKQKKAPPSKQF
Ga0209068_1034989023300027894WatershedsMKVFIILPAAGLGTRMAPMVAPGKKSAPSKQFTELAGTPIL
Ga0209067_10004646103300027898WatershedsMKVIVIIPAAGLGTRMSPMPTAKEVKEKKPHSSKQFTDLAGTPILI
Ga0209067_1039783023300027898WatershedsMKVFVIVPAAGLGTRMAPVSTARAHKKSPSKQFKELGGVP
Ga0209067_1089122623300027898WatershedsMKVIVIIPAAGLGTRMAPMPSAMDAKTKKPHPSKQFNDLAGTPI
Ga0209488_1075354013300027903Vadose Zone SoilMKVTVIIPAAGLGTRMAPAGKKGAPSKQFFEISGTP
Ga0209069_1083210423300027915WatershedsMKVFVIVPAAGLGTRMAPPSAAKSRKKAPTKQFKELGG
Ga0265358_10251723300028010RhizosphereMKVIVIVPAAGLGTRMASAPQTKGKKPASTKQFTEL
Ga0265355_100931013300028036RhizosphereMKVIVIIPAAGLGTRMSPVPGAKSKATQAAPSKQFT
Ga0265349_101605713300028037SoilMKVIVIIPAAGLGTRMAPVPTGDKKRKVPSKQFTDLGGT
Ga0302144_1024275613300028560BogMKVVVIIPAAGLGTRMAPMPVGAQGKQKKTPPSKQF
Ga0302262_1021864913300028743FenMKVFVIVPAAGLGTRMAPVTTDKKKSPSKQFKQLGG
Ga0302156_1013673213300028748BogMKVVVIIPAAGLGTRMAPMPVGDKSKQKAHPSKQFTELG
Ga0308309_1089459723300028906SoilMKVVVIIPAAGLGTRMLPASDAKSKKPSASKQFSELGGTPILI
Ga0302143_108416513300029918BogMKVFVIIPAAGLGTRMASPAPTKAHKKSPSKQFKEL
Ga0302142_118075723300029920BogMKVVVIIPAAGLGTRMAAVPSGTQKHKTPPSKQFTELGGTPI
Ga0311371_1115091723300029951PalsaMKVVVIIPAAGLGTRMAPVPVGAKGKQKKAPPSKQ
Ga0302277_112755613300029982BogMKVIVIIPAAGLGTRMAPVPVGAKGDKKSPSKQFTELGGTPML
Ga0302306_1027208113300030043PalsaMKVIVIIPAAGLGTRMAPIPTGTKDRKKTAPSKQF
Ga0302306_1034862023300030043PalsaMKVVVIIPAAGLGTRMAPVPSAPISTSGAAAARKPHPSKQ
Ga0310037_1018255713300030494Peatlands SoilMKVFVIVPAAGLGTRMAPPPGAKPAERSRKRAPTKQFK
Ga0302192_1026714723300030507BogMKVFVIIPAAGLGTRMASPSPTKSSKKSPSKQFKEL
Ga0302192_1028566513300030507BogMKVVVIIPAAGLGTRMAPMPVGAQGKQKKTPPSKQFTE
Ga0302183_1017848323300030509PalsaMKVIVIIPAAGLGTRMGPMPGAKSKAGQPVPSKQFTELGGTP
Ga0302275_1026005723300030518BogMKVFVIIPAAGLGTRMASPSSAKSSKKSPSKQFKELDGVP
Ga0311354_1049219413300030618PalsaMKVFVIVPAAGLGTRMAPPSAAASRKKAPTKQFKELGG
Ga0302317_1039649313300030677PalsaMKVVVIIPAAGLGTRMAPMPTGDKGKPKALSKQFTELGG
Ga0265765_105759113300030879SoilMKVVVIIPAAGLGTRMAPVGHQKNSPPSKQFTERGGGP
Ga0075386_1196558423300030916SoilMKVIVIIPAAGLGTRMTQAPDAKSKKPAASKQFSE
Ga0073994_1007115213300030991SoilMKVVVIIPAAGLGTRMAPVPSAQDKGKKSAPSKQFTDLGGEPIL
Ga0170824_12040440113300031231Forest SoilMKVFVIVPAAGLGTRMAPHSVAKPRKKQPPTKQFKE
Ga0302324_10020320643300031236PalsaMKVVVIIPAAGLGTRMAPVPVGAKGKQKKAPPSKQFT
Ga0302318_1034389923300031258BogMKVFVIIPAAGLGTRMGVAHVGQTPPRSKQFLELA
Ga0302326_1125863513300031525PalsaMKVVVIIPAAGLGTRMAPLAAAKSKKKAPSKQFQQLD
Ga0265314_1052862323300031711RhizosphereMKVVVIIPAAGLGTRMSSASSSLKSKSKQFFELQGTP
Ga0307476_1068193313300031715Hardwood Forest SoilMKVIVIIPAAGLGTRMAPVPSARDKGKKSAPSKQFT
Ga0307474_1107631623300031718Hardwood Forest SoilMKVVVIIPAAGLGTRMTSAPSAKTKKLAPSKQFTELGGTPIL
Ga0318494_1027307723300031751SoilMKVVVIIPAAGLGTRMLPAGSAKTKSPSKQFTELGGVPIL
Ga0307477_1066470913300031753Hardwood Forest SoilMKVVVIIPAAGLGTRMAPMPVGAKGKQKKVPPSKQFTELGG
Ga0307473_1006030833300031820Hardwood Forest SoilMKVIVIIPAAGLGTRMAPVPSAQAKGKKSAPSKQFTD
Ga0306921_1011315213300031912SoilMKVVVIIPAAGLGTRMASAPGGKGKKQAASKQFTEIAGTP
Ga0310912_1003950533300031941SoilMKVVVIIPAAGLGTRMLPAGSAKTKSPSKQFTELGGVPI
Ga0307479_1039096613300031962Hardwood Forest SoilMKVVVIIPAAGLGTRMGPVPVGAKGKSKKAPPMKQFTELGGT
Ga0308176_1082888013300031996SoilMKVIVIIPAAGLGTRMAPVPSGKTAKGKNPHPSKQFTELA
Ga0318575_1026099823300032055SoilMKVIVIIPAAGLGTRMAAATAAKKRKPAPSKQFTELGGVP
Ga0318525_1044113623300032089SoilMKVIVIIPAAGLGTRMTSAPPAKSKVPVPSKQFTELK
Ga0311301_1240011813300032160Peatlands SoilMKVVVIIPAAGLGTRMAPMPSAPIPSAGNAKTKTKTKKPIPSK
Ga0307471_10244778513300032180Hardwood Forest SoilMKVVVIIPAAGLGTRMSSASGAKPRKAAPSKQFTELGGT
Ga0348332_1084162123300032515Plant LitterMKVVVIIPAAGLGTRMAPVPAGATGKPKKAPPPKQFTELGGTPIL
Ga0335079_1007445213300032783SoilMKVFVIIPAAGLGTRMAPPAPVRRQKEQTKKDAPSKQFQ
Ga0335078_1021151513300032805SoilMKVIVIIPAAGLGTRMAPMPSALDAKTKKPHPSKQF
Ga0335078_1087289613300032805SoilMKVVVIIPAAGLGTRMAPVLSAKSAKSKKAPPSKQFTELGG
Ga0335081_1210709223300032892SoilMKVVVIIPAAGLGTRMAPMPSAIISGNKDAKTKKPHPSKQFTEL
Ga0335069_1155287123300032893SoilMKVVVIIPAAGLGTRMAGASKRAAPSKQFTEINGVP
Ga0335072_1015018313300032898SoilMKVVVIIPAAGLGTRMAPVPSAKDVAGKKTPPSKQFTELGG
Ga0335083_1114563013300032954SoilMKVVVIIPAAGLGTRMAPVPSAMDAKTKKPHPSKQFTDLGGTPILIH
Ga0335077_1221658923300033158SoilMKVIVIIPAAGLGTRMSAISGGPRSKSKQFFELQGT
Ga0326726_1177153923300033433Peat SoilMKVFVIVPAAGLGTRMASPSAARPRKKALSKQFKELGGVP
Ga0314861_0201602_805_9393300033977PeatlandMKVFVIVPAAGLGTRMAPVSSAKARKKTPTKQFKELGGVPILVHT
Ga0326723_0612366_373_5043300034090Peat SoilMKVFVIVPAAGLGTRMAPLSAAKIRKKSPSKQFKELGGVPILVR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.