Metagenome / Metatranscriptome Family F018415

Basic Information
Family ID	F018415
Family Type	Metagenome / Metatranscriptome
Number of Sequences	235
Average Sequence Length	50 residues
Representative Sequence	VGLQDKSYFTPAPSPAFPGNQRLHLDDHIVRVGVNYKLPWNILDSFFKR
Number of Associated Samples	196
Number of Associated Scaffolds	235

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	4.26 %
% of genes near scaffold ends (potentially truncated)	93.62 %
% of genes from short scaffolds (< 2000 bps)	90.21 %
Associated GOLD sequencing projects	187
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.19

Most Common Taxonomy
Group	Bacteria (93.191 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.957 % of family members)
Environment Ontology (ENVO)	Unclassified (29.362 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (38.298 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 10.39% β-sheet: 0.00% Coil/Unstructured: 89.61%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 235 Family Scaffolds
PF03372	Exo_endo_phos	49.36
PF13533	Biotin_lipoyl_2	2.55
PF00589	Phage_integrase	2.13
PF16576	HlyD_D23	2.13
PF00920	ILVD_EDD	1.28
PF12700	HlyD_2	0.85
PF13546	DDE_5	0.85
PF14529	Exo_endo_phos_2	0.85
PF14696	Glyoxalase_5	0.43
PF05598	DUF772	0.43
PF06698	DUF1192	0.43
PF01027	Bax1-I	0.43
PF00873	ACR_tran	0.43
PF13460	NAD_binding_10	0.43
PF13531	SBP_bac_11	0.43
PF08238	Sel1	0.43
PF00933	Glyco_hydro_3	0.43

COG ID	Name	Functional Category	% Frequency in 235 Family Scaffolds
COG0129	Dihydroxyacid dehydratase/phosphogluconate dehydratase	Carbohydrate transport and metabolism [G]	2.55
COG1472	Periplasmic beta-glucosidase and related glycosidases	Carbohydrate transport and metabolism [G]	0.43

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.19 %
Unclassified	root	N/A	6.81 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.19 %
Unclassified	root	N/A	6.81 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.19 %
Unclassified	root	N/A	6.81 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	93.19 %
Unclassified	root	N/A	6.81 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	92.34 %
Unclassified	root	N/A	6.81 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	42.55 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	22.98 %
Unclassified	root	N/A	6.81 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.43 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	42.55 %
Unclassified	root	N/A	6.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.96 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	5.96 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2.13 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.85 %
Azospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae	0.43 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	42.55 %
Unclassified	root	N/A	6.81 %
Azorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium	5.11 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	1.70 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.85 %
Nitrospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum	0.43 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.43 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.43 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.43 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	42.55 %
Unclassified	root	N/A	6.81 %
unclassified Azorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium	5.11 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	1.70 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	0.85 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	0.43 %
Hyphomicrobium sulfonivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium sulfonivorans	0.43 %
Nitrospirillum amazonense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense	0.43 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.43 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	42.55 %
Unclassified	root	N/A	6.81 %
Azorhizobium sp. 32-67-21	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	5.11 %
Rhodoplanes sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.	1.28 %
Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	0.85 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	0.43 %
Nitrospirillum amazonense Y2	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense → Nitrospirillum amazonense Y2	0.43 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.43 %
Hyphomicrobium sulfonivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium sulfonivorans	0.43 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.43 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2044078019\|MiccSRB_F31IBB102FSYUI	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	507	Open in IMG/M
2170459022\|GZEQPF102GQPXF	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	518	Open in IMG/M
3300000709\|KanNP_Total_F14TBDRAFT_1024877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	508	Open in IMG/M
3300000837\|AP72_2010_repI_A100DRAFT_1014233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1120	Open in IMG/M
3300000891\|JGI10214J12806_10473150	Not Available	966	Open in IMG/M
3300000893\|AP72_2010_repI_A001DRAFT_1003043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3452	Open in IMG/M
3300000955\|JGI1027J12803_109387391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	3075	Open in IMG/M
3300002076\|JGI24749J21850_1048197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	632	Open in IMG/M
3300002911\|JGI25390J43892_10122614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	594	Open in IMG/M
3300004479\|Ga0062595_102635549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	505	Open in IMG/M
3300005093\|Ga0062594_100821649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	863	Open in IMG/M
3300005160\|Ga0066820_1013059	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	580	Open in IMG/M
3300005167\|Ga0066672_10593011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	718	Open in IMG/M
3300005332\|Ga0066388_103202167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	836	Open in IMG/M
3300005332\|Ga0066388_107392453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	551	Open in IMG/M
3300005363\|Ga0008090_10134241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	747	Open in IMG/M
3300005367\|Ga0070667_100495059	Not Available	1120	Open in IMG/M
3300005444\|Ga0070694_101034794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	683	Open in IMG/M
3300005455\|Ga0070663_100455535	Not Available	1055	Open in IMG/M
3300005544\|Ga0070686_100153543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1614	Open in IMG/M
3300005562\|Ga0058697_10544613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	599	Open in IMG/M
3300005564\|Ga0070664_100893921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	833	Open in IMG/M
3300005587\|Ga0066654_10806223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	533	Open in IMG/M
3300005614\|Ga0068856_100425513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1348	Open in IMG/M
3300005713\|Ga0066905_100071050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2240	Open in IMG/M
3300005713\|Ga0066905_100333317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1205	Open in IMG/M
3300005713\|Ga0066905_100650754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	898	Open in IMG/M
3300005764\|Ga0066903_101194155	Not Available	1412	Open in IMG/M
3300005764\|Ga0066903_102730699	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	958	Open in IMG/M
3300005841\|Ga0068863_100340652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1459	Open in IMG/M
3300005841\|Ga0068863_102203055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	561	Open in IMG/M
3300005843\|Ga0068860_101590117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	675	Open in IMG/M
3300006028\|Ga0070717_11621352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	586	Open in IMG/M
3300006058\|Ga0075432_10200756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	789	Open in IMG/M
3300006175\|Ga0070712_100768925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	825	Open in IMG/M
3300006573\|Ga0074055_11766832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	569	Open in IMG/M
3300006791\|Ga0066653_10413153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	690	Open in IMG/M
3300006794\|Ga0066658_10681682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	566	Open in IMG/M
3300006800\|Ga0066660_10920787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	710	Open in IMG/M
3300006806\|Ga0079220_10545175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium sulfonivorans	807	Open in IMG/M
3300006845\|Ga0075421_100241056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2221	Open in IMG/M
3300006853\|Ga0075420_100379693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1223	Open in IMG/M
3300006871\|Ga0075434_100651925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1071	Open in IMG/M
3300006871\|Ga0075434_101133333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	795	Open in IMG/M
3300006904\|Ga0075424_101541195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	705	Open in IMG/M
3300006904\|Ga0075424_102332233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	562	Open in IMG/M
3300006904\|Ga0075424_102783319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	510	Open in IMG/M
3300006939\|Ga0081244_1500636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	527	Open in IMG/M
3300007258\|Ga0099793_10565009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	568	Open in IMG/M
3300009100\|Ga0075418_12169155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	606	Open in IMG/M
3300009137\|Ga0066709_103731919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	553	Open in IMG/M
3300009143\|Ga0099792_10258751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1017	Open in IMG/M
3300009148\|Ga0105243_10165048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1913	Open in IMG/M
3300009177\|Ga0105248_11218803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	851	Open in IMG/M
3300010046\|Ga0126384_10002911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	10364	Open in IMG/M
3300010046\|Ga0126384_11680904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	600	Open in IMG/M
3300010046\|Ga0126384_12337557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	516	Open in IMG/M
3300010047\|Ga0126382_10665386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	868	Open in IMG/M
3300010047\|Ga0126382_12186867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	532	Open in IMG/M
3300010159\|Ga0099796_10231426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	761	Open in IMG/M
3300010166\|Ga0126306_10088609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2215	Open in IMG/M
3300010359\|Ga0126376_10531800	Not Available	1096	Open in IMG/M
3300010359\|Ga0126376_11880294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	638	Open in IMG/M
3300010360\|Ga0126372_10004939	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6395	Open in IMG/M
3300010360\|Ga0126372_11136424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	802	Open in IMG/M
3300010362\|Ga0126377_13007531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	544	Open in IMG/M
3300010371\|Ga0134125_11090466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	874	Open in IMG/M
3300010373\|Ga0134128_12047034	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	630	Open in IMG/M
3300010396\|Ga0134126_12295538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	588	Open in IMG/M
3300010398\|Ga0126383_10967373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	939	Open in IMG/M
3300010398\|Ga0126383_12329264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	621	Open in IMG/M
3300010399\|Ga0134127_10110508	All Organisms → cellular organisms → Bacteria → Proteobacteria	2427	Open in IMG/M
3300010399\|Ga0134127_12348644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	613	Open in IMG/M
3300010400\|Ga0134122_13378829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	502	Open in IMG/M
3300010863\|Ga0124850_1002420	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5471	Open in IMG/M
3300010937\|Ga0137776_1839128	Not Available	1777	Open in IMG/M
3300011271\|Ga0137393_10456462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1096	Open in IMG/M
3300012199\|Ga0137383_10197887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.	1473	Open in IMG/M
3300012200\|Ga0137382_10769411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	692	Open in IMG/M
3300012206\|Ga0137380_11617118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	532	Open in IMG/M
3300012207\|Ga0137381_10263832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1498	Open in IMG/M
3300012212\|Ga0150985_116805378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	560	Open in IMG/M
3300012285\|Ga0137370_10467245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	770	Open in IMG/M
3300012350\|Ga0137372_10023508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5734	Open in IMG/M
3300012355\|Ga0137369_10164221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.	1750	Open in IMG/M
3300012356\|Ga0137371_11401726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	512	Open in IMG/M
3300012363\|Ga0137390_12012784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	503	Open in IMG/M
3300012491\|Ga0157329_1025276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	585	Open in IMG/M
3300012683\|Ga0137398_10783591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	665	Open in IMG/M
3300012924\|Ga0137413_11445588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	557	Open in IMG/M
3300012930\|Ga0137407_10399151	Not Available	1273	Open in IMG/M
3300012930\|Ga0137407_10535655	Not Available	1096	Open in IMG/M
3300012930\|Ga0137407_11020205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	784	Open in IMG/M
3300012955\|Ga0164298_10252796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1064	Open in IMG/M
3300012971\|Ga0126369_11545440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	753	Open in IMG/M
3300012984\|Ga0164309_10403416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1020	Open in IMG/M
3300012986\|Ga0164304_10560124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	846	Open in IMG/M
3300012989\|Ga0164305_10048816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2463	Open in IMG/M
3300013297\|Ga0157378_11475195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	724	Open in IMG/M
3300013306\|Ga0163162_10802309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1059	Open in IMG/M
3300013306\|Ga0163162_12858498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	556	Open in IMG/M
3300014322\|Ga0075355_1178632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	579	Open in IMG/M
3300014325\|Ga0163163_12376562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	588	Open in IMG/M
3300014968\|Ga0157379_10848395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	864	Open in IMG/M
3300015264\|Ga0137403_11274337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	581	Open in IMG/M
3300015359\|Ga0134085_10086965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1287	Open in IMG/M
3300015372\|Ga0132256_101926947	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	698	Open in IMG/M
3300015373\|Ga0132257_101414637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	885	Open in IMG/M
3300015374\|Ga0132255_101250534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1119	Open in IMG/M
3300015374\|Ga0132255_102551129	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	781	Open in IMG/M
3300016270\|Ga0182036_10182187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1524	Open in IMG/M
3300016341\|Ga0182035_10181656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1647	Open in IMG/M
3300016387\|Ga0182040_10123224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1802	Open in IMG/M
3300016404\|Ga0182037_12121034	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	506	Open in IMG/M
3300016422\|Ga0182039_10431478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1125	Open in IMG/M
3300016422\|Ga0182039_10806851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	833	Open in IMG/M
3300017656\|Ga0134112_10308961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	637	Open in IMG/M
3300018075\|Ga0184632_10172579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	954	Open in IMG/M
3300018078\|Ga0184612_10121960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1364	Open in IMG/M
3300018433\|Ga0066667_11815120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	552	Open in IMG/M
3300018466\|Ga0190268_11170712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	634	Open in IMG/M
3300019263\|Ga0184647_1318883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	504	Open in IMG/M
3300020581\|Ga0210399_10969706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	686	Open in IMG/M
3300021086\|Ga0179596_10683588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	520	Open in IMG/M
3300021178\|Ga0210408_11436995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	518	Open in IMG/M
3300021405\|Ga0210387_11493883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	578	Open in IMG/M
3300021479\|Ga0210410_11060016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	700	Open in IMG/M
3300021510\|Ga0222621_1038384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	994	Open in IMG/M
3300021560\|Ga0126371_10400905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1513	Open in IMG/M
3300022694\|Ga0222623_10005807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4359	Open in IMG/M
3300022726\|Ga0242654_10141573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	795	Open in IMG/M
3300025899\|Ga0207642_10918505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	561	Open in IMG/M
3300025901\|Ga0207688_10001592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11966	Open in IMG/M
3300025915\|Ga0207693_10608162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	851	Open in IMG/M
3300025920\|Ga0207649_10484338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	939	Open in IMG/M
3300025924\|Ga0207694_10642820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	894	Open in IMG/M
3300025941\|Ga0207711_11204713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	699	Open in IMG/M
3300025981\|Ga0207640_10623764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	915	Open in IMG/M
3300025986\|Ga0207658_11227945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	685	Open in IMG/M
3300026041\|Ga0207639_10232359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1599	Open in IMG/M
3300026078\|Ga0207702_10483715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1205	Open in IMG/M
3300026306\|Ga0209468_1098221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	946	Open in IMG/M
3300026494\|Ga0257159_1021482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1055	Open in IMG/M
3300026550\|Ga0209474_10150562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1517	Open in IMG/M
3300027042\|Ga0207766_1038566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	535	Open in IMG/M
3300027680\|Ga0207826_1172953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	587	Open in IMG/M
3300027824\|Ga0209040_10185939	Not Available	1090	Open in IMG/M
3300027875\|Ga0209283_10320730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1020	Open in IMG/M
3300027880\|Ga0209481_10642431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	550	Open in IMG/M
3300027909\|Ga0209382_10385402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1563	Open in IMG/M
3300027909\|Ga0209382_11851701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	585	Open in IMG/M
3300027909\|Ga0209382_11855291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	584	Open in IMG/M
3300028536\|Ga0137415_11167537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	584	Open in IMG/M
3300028707\|Ga0307291_1004855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2873	Open in IMG/M
3300028719\|Ga0307301_10102513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	907	Open in IMG/M
3300028720\|Ga0307317_10149941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	782	Open in IMG/M
3300028720\|Ga0307317_10322915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	522	Open in IMG/M
3300028791\|Ga0307290_10243758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	658	Open in IMG/M
3300028807\|Ga0307305_10437804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	589	Open in IMG/M
3300028811\|Ga0307292_10365384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	610	Open in IMG/M
3300028881\|Ga0307277_10020941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2562	Open in IMG/M
3300028885\|Ga0307304_10164566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	932	Open in IMG/M
3300030988\|Ga0308183_1073841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	732	Open in IMG/M
3300031058\|Ga0308189_10273694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	648	Open in IMG/M
3300031152\|Ga0307501_10125987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	673	Open in IMG/M
3300031152\|Ga0307501_10250925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	527	Open in IMG/M
3300031231\|Ga0170824_123567382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3236	Open in IMG/M
3300031544\|Ga0318534_10276692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	967	Open in IMG/M
3300031544\|Ga0318534_10626360	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	610	Open in IMG/M
3300031548\|Ga0307408_101902702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	570	Open in IMG/M
3300031549\|Ga0318571_10319384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	588	Open in IMG/M
3300031561\|Ga0318528_10190859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1095	Open in IMG/M
3300031561\|Ga0318528_10612868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	583	Open in IMG/M
3300031564\|Ga0318573_10296420	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	865	Open in IMG/M
3300031564\|Ga0318573_10327985	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	820	Open in IMG/M
3300031573\|Ga0310915_10738727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	694	Open in IMG/M
3300031681\|Ga0318572_10297761	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	953	Open in IMG/M
3300031682\|Ga0318560_10186346	Not Available	1106	Open in IMG/M
3300031723\|Ga0318493_10374460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	776	Open in IMG/M
3300031736\|Ga0318501_10708008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	555	Open in IMG/M
3300031747\|Ga0318502_10708349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	608	Open in IMG/M
3300031765\|Ga0318554_10119980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1484	Open in IMG/M
3300031771\|Ga0318546_10711676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	706	Open in IMG/M
3300031771\|Ga0318546_11153857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	544	Open in IMG/M
3300031777\|Ga0318543_10119294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1144	Open in IMG/M
3300031777\|Ga0318543_10520130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	533	Open in IMG/M
3300031778\|Ga0318498_10486091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	544	Open in IMG/M
3300031779\|Ga0318566_10595174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	539	Open in IMG/M
3300031793\|Ga0318548_10253908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	864	Open in IMG/M
3300031793\|Ga0318548_10495067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300031819\|Ga0318568_10232384	Not Available	1140	Open in IMG/M
3300031832\|Ga0318499_10306238	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	613	Open in IMG/M
3300031833\|Ga0310917_10054279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2469	Open in IMG/M
3300031846\|Ga0318512_10109505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1305	Open in IMG/M
3300031846\|Ga0318512_10742058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	504	Open in IMG/M
3300031879\|Ga0306919_10000505	All Organisms → cellular organisms → Bacteria → Proteobacteria	17230	Open in IMG/M
3300031880\|Ga0318544_10308083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	615	Open in IMG/M
3300031893\|Ga0318536_10045345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2107	Open in IMG/M
3300031893\|Ga0318536_10348709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	749	Open in IMG/M
3300031894\|Ga0318522_10378246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	536	Open in IMG/M
3300031897\|Ga0318520_10346847	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	900	Open in IMG/M
3300031897\|Ga0318520_10392134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	848	Open in IMG/M
3300031910\|Ga0306923_11236547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	796	Open in IMG/M
3300031910\|Ga0306923_12277754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	541	Open in IMG/M
3300031941\|Ga0310912_10459555	Not Available	992	Open in IMG/M
3300031942\|Ga0310916_10432444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1120	Open in IMG/M
3300031945\|Ga0310913_10337738	Not Available	1065	Open in IMG/M
3300031954\|Ga0306926_10272918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2094	Open in IMG/M
3300031954\|Ga0306926_11191967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	895	Open in IMG/M
3300031981\|Ga0318531_10202373	Not Available	895	Open in IMG/M
3300032009\|Ga0318563_10353937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	795	Open in IMG/M
3300032010\|Ga0318569_10202984	Not Available	918	Open in IMG/M
3300032035\|Ga0310911_10592486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	643	Open in IMG/M
3300032039\|Ga0318559_10235166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	846	Open in IMG/M
3300032041\|Ga0318549_10248954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	799	Open in IMG/M
3300032051\|Ga0318532_10094888	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1050	Open in IMG/M
3300032051\|Ga0318532_10200981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	707	Open in IMG/M
3300032054\|Ga0318570_10580365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → unclassified Azorhizobium → Azorhizobium sp. 32-67-21	511	Open in IMG/M
3300032060\|Ga0318505_10079754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1455	Open in IMG/M
3300032065\|Ga0318513_10371253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	697	Open in IMG/M
3300032066\|Ga0318514_10337561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	798	Open in IMG/M
3300032066\|Ga0318514_10348258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	784	Open in IMG/M
3300032067\|Ga0318524_10602500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	578	Open in IMG/M
3300032068\|Ga0318553_10691594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	533	Open in IMG/M
3300032076\|Ga0306924_11957864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	605	Open in IMG/M
3300032090\|Ga0318518_10037170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2261	Open in IMG/M
3300032091\|Ga0318577_10603388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	521	Open in IMG/M
3300032094\|Ga0318540_10034093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2219	Open in IMG/M
3300032180\|Ga0307471_100300751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.	1691	Open in IMG/M
3300032180\|Ga0307471_103227080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	578	Open in IMG/M
3300032261\|Ga0306920_100388282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2076	Open in IMG/M
3300032261\|Ga0306920_102386081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	730	Open in IMG/M
3300033290\|Ga0318519_10360524	Not Available	861	Open in IMG/M
3300033811\|Ga0364924_025541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense → Nitrospirillum amazonense Y2	1186	Open in IMG/M
3300034150\|Ga0364933_064461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	912	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.85%
Host-Associated	Host-Associated	19.15%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	77.45%
Plants	Host-Associated → Plants	19.15%
Aquatic	Environmental → Aquatic	3.40%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	76.60%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.06%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.23%
Sediment	Environmental → Aquatic → Sediment	1.70%
Freshwater	Environmental → Aquatic → Freshwater	1.28%
Floodplain	Environmental → Terrestrial → Floodplain	0.85%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.43%
Roots	Host-Associated → Plants → Roots	0.43%
Phylloplane	Host-Associated → Plants → Phylloplane	0.43%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	69.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.51%
Loam	Environmental → Terrestrial → Soil → Loam	6.81%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.53%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.70%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.70%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.85%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.43%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.43%
Storm Water	Environmental → Aquatic → Freshwater → Storm Water	0.43%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.43%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.43%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.43%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.43%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	34.04%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	28.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.53%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.11%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.13%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.70%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.70%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.28%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.85%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.43%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.43%
Drainage Pipe Biofilm	Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm	0.43%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	0.43%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.43%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.43%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.43%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.43%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	25.96%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.66%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.96%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.53%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.26%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.83%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.55%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.70%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.70%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.28%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.28%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.28%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.28%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.28%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.85%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.85%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.85%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.85%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.85%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.43%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.43%
Concrete Drainage Pipe Biofilm	Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm	0.43%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment	0.43%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.43%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.43%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.43%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.43%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.43%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.43%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.43%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.43%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.43%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.43%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.43%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.43%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.43%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.43%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.43%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.43%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.43%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2044078019	Concrete drainage pipe biofilm microbial communities from Ohio, US, sample, 12383	Environmental	Open in IMG/M
2170459022	Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition)	Environmental	Open in IMG/M
3300000709	Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance	Environmental	Open in IMG/M
3300000837	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000893	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Host-Associated	Open in IMG/M
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005160	Soil and rhizosphere microbial communities from Laval, Canada - mgLMB	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006939	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010863	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)	Environmental	Open in IMG/M
3300010937	Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012491	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610	Host-Associated	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300019263	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300021510	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300022726	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026306	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)	Environmental	Open in IMG/M
3300026494	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027042	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes)	Environmental	Open in IMG/M
3300027680	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)	Environmental	Open in IMG/M
3300027824	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028707	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148	Environmental	Open in IMG/M
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028791	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028881	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300030988	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031549	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031681	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031723	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031747	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031819	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21	Environmental	Open in IMG/M
3300031832	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031846	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031880	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031894	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031981	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032010	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032041	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22	Environmental	Open in IMG/M
3300032051	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26	Environmental	Open in IMG/M
3300032054	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23	Environmental	Open in IMG/M
3300032060	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18	Environmental	Open in IMG/M
3300032065	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20	Environmental	Open in IMG/M
3300032066	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18	Environmental	Open in IMG/M
3300032067	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032090	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental	Open in IMG/M
3300034150	Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.19
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.19
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F018415

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign