Basic Information | |
---|---|
Family ID | F018232 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 236 |
Average Sequence Length | 41 residues |
Representative Sequence | EPGTAVGDLQALDKNHDLYSDFDVLDDLQVQQDVNANP |
Number of Associated Samples | 203 |
Number of Associated Scaffolds | 236 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.75 % |
% of genes near scaffold ends (potentially truncated) | 94.92 % |
% of genes from short scaffolds (< 2000 bps) | 86.44 % |
Associated GOLD sequencing projects | 189 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.831 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.593 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.763 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.119 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 236 Family Scaffolds |
---|---|---|
PF11304 | DUF3106 | 76.69 |
PF01619 | Pro_dh | 2.54 |
PF13371 | TPR_9 | 1.69 |
PF14579 | HHH_6 | 1.27 |
PF13419 | HAD_2 | 0.42 |
PF10604 | Polyketide_cyc2 | 0.42 |
PF00069 | Pkinase | 0.42 |
PF13424 | TPR_12 | 0.42 |
PF08002 | DUF1697 | 0.42 |
PF05726 | Pirin_C | 0.42 |
PF00672 | HAMP | 0.42 |
PF00248 | Aldo_ket_red | 0.42 |
PF13664 | DUF4149 | 0.42 |
PF01740 | STAS | 0.42 |
PF01431 | Peptidase_M13 | 0.42 |
PF07238 | PilZ | 0.42 |
PF03544 | TonB_C | 0.42 |
PF07992 | Pyr_redox_2 | 0.42 |
PF08281 | Sigma70_r4_2 | 0.42 |
PF00581 | Rhodanese | 0.42 |
COG ID | Name | Functional Category | % Frequency in 236 Family Scaffolds |
---|---|---|---|
COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 2.54 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.69 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.42 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.83 % |
Unclassified | root | N/A | 10.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001471|JGI12712J15308_10182530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300001593|JGI12635J15846_10514822 | Not Available | 704 | Open in IMG/M |
3300004082|Ga0062384_100775752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300004092|Ga0062389_103456303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300004479|Ga0062595_102070353 | Not Available | 552 | Open in IMG/M |
3300005167|Ga0066672_10150751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1458 | Open in IMG/M |
3300005177|Ga0066690_10392615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
3300005334|Ga0068869_100376769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1162 | Open in IMG/M |
3300005467|Ga0070706_101772956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300005537|Ga0070730_10647253 | Not Available | 672 | Open in IMG/M |
3300005587|Ga0066654_10644490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300005607|Ga0070740_10343065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300005921|Ga0070766_10795911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300005921|Ga0070766_10980520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300005921|Ga0070766_11263500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300006031|Ga0066651_10087816 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300006041|Ga0075023_100410852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300006046|Ga0066652_100577685 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300006050|Ga0075028_100277784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
3300006050|Ga0075028_100471344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300006173|Ga0070716_101653596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300006175|Ga0070712_100012659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 5369 | Open in IMG/M |
3300006175|Ga0070712_100341231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1223 | Open in IMG/M |
3300006791|Ga0066653_10153081 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300006806|Ga0079220_11138555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300006854|Ga0075425_101522557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300006854|Ga0075425_101978624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300009038|Ga0099829_10744905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
3300009088|Ga0099830_11064217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300009174|Ga0105241_10712463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
3300009177|Ga0105248_11238794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
3300009521|Ga0116222_1020192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. | 3024 | Open in IMG/M |
3300009525|Ga0116220_10513330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300009545|Ga0105237_12499224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi | 527 | Open in IMG/M |
3300009624|Ga0116105_1023938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
3300009624|Ga0116105_1098146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300009633|Ga0116129_1052158 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300009698|Ga0116216_10465224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300009826|Ga0123355_11348351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
3300010043|Ga0126380_11189596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300010049|Ga0123356_10116437 | All Organisms → cellular organisms → Bacteria | 2591 | Open in IMG/M |
3300010143|Ga0126322_1171629 | Not Available | 629 | Open in IMG/M |
3300010326|Ga0134065_10468328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300010358|Ga0126370_11869569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300010371|Ga0134125_10035716 | All Organisms → cellular organisms → Bacteria | 5542 | Open in IMG/M |
3300010371|Ga0134125_10175567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2387 | Open in IMG/M |
3300010379|Ga0136449_100090170 | All Organisms → cellular organisms → Bacteria | 6383 | Open in IMG/M |
3300010379|Ga0136449_103403934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300011075|Ga0138555_1151097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300011076|Ga0138574_1016439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300011086|Ga0138564_1204859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300011110|Ga0138578_1290236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300011270|Ga0137391_10615340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300012189|Ga0137388_11216915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300012198|Ga0137364_11158503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300012200|Ga0137382_10192417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1399 | Open in IMG/M |
3300012203|Ga0137399_10828487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300012357|Ga0137384_10806245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300012363|Ga0137390_11975758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300012917|Ga0137395_10428458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300012918|Ga0137396_10989552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300012930|Ga0137407_10917551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300012987|Ga0164307_10465016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
3300013102|Ga0157371_10686087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300014169|Ga0181531_10071426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2048 | Open in IMG/M |
3300014169|Ga0181531_10464682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
3300014200|Ga0181526_10343252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 950 | Open in IMG/M |
3300014489|Ga0182018_10165462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
3300014501|Ga0182024_11191283 | Not Available | 892 | Open in IMG/M |
3300014657|Ga0181522_10029261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3035 | Open in IMG/M |
3300014658|Ga0181519_10075594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2203 | Open in IMG/M |
3300014968|Ga0157379_10284152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1506 | Open in IMG/M |
3300014968|Ga0157379_10765178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 910 | Open in IMG/M |
3300014969|Ga0157376_12477973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300015054|Ga0137420_1496653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1492 | Open in IMG/M |
3300015245|Ga0137409_10737415 | Not Available | 820 | Open in IMG/M |
3300016445|Ga0182038_11526933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300016702|Ga0181511_1495517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300017822|Ga0187802_10013257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2714 | Open in IMG/M |
3300017823|Ga0187818_10000506 | All Organisms → cellular organisms → Bacteria | 14210 | Open in IMG/M |
3300017927|Ga0187824_10208311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300017927|Ga0187824_10313838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300017934|Ga0187803_10189583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300017936|Ga0187821_10148854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
3300017955|Ga0187817_10198329 | Not Available | 1279 | Open in IMG/M |
3300017955|Ga0187817_10339115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300017966|Ga0187776_11252600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300017970|Ga0187783_10016034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5533 | Open in IMG/M |
3300017970|Ga0187783_10206787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1441 | Open in IMG/M |
3300017973|Ga0187780_10828931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300017975|Ga0187782_10894612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300017994|Ga0187822_10154027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300017995|Ga0187816_10372438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300018009|Ga0187884_10215152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300018038|Ga0187855_10177047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1265 | Open in IMG/M |
3300018062|Ga0187784_10716209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
3300018085|Ga0187772_10043921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2720 | Open in IMG/M |
3300018085|Ga0187772_11361267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300018086|Ga0187769_10454707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
3300018086|Ga0187769_11309309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300018090|Ga0187770_10214118 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300018090|Ga0187770_10878542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300018090|Ga0187770_11286159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300018431|Ga0066655_10929647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300018433|Ga0066667_10505864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
3300019187|Ga0184584_121003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300019275|Ga0187798_1207501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300019284|Ga0187797_1135743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300019786|Ga0182025_1324743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1459 | Open in IMG/M |
3300019879|Ga0193723_1044415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
3300019879|Ga0193723_1196351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300020021|Ga0193726_1014448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4132 | Open in IMG/M |
3300020580|Ga0210403_10103622 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
3300020580|Ga0210403_11163292 | Not Available | 596 | Open in IMG/M |
3300020580|Ga0210403_11316989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300020581|Ga0210399_11054432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300020582|Ga0210395_10352266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
3300020583|Ga0210401_11054345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300021046|Ga0215015_10513750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300021170|Ga0210400_10117320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2121 | Open in IMG/M |
3300021171|Ga0210405_10737597 | Not Available | 759 | Open in IMG/M |
3300021344|Ga0193719_10362771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300021402|Ga0210385_10062405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2519 | Open in IMG/M |
3300021420|Ga0210394_10323485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1354 | Open in IMG/M |
3300021420|Ga0210394_11197448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300021439|Ga0213879_10112237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300021474|Ga0210390_10672597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
3300021474|Ga0210390_11277034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300021478|Ga0210402_10369245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
3300021479|Ga0210410_10440930 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300021860|Ga0213851_1146467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300021861|Ga0213853_11593924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300022515|Ga0224546_1009551 | Not Available | 738 | Open in IMG/M |
3300022533|Ga0242662_10068005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300022712|Ga0242653_1104978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300022715|Ga0242678_1013738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300022721|Ga0242666_1106441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300022726|Ga0242654_10405621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300022731|Ga0224563_1016606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300022756|Ga0222622_10857309 | Not Available | 665 | Open in IMG/M |
3300023536|Ga0247552_103180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300023547|Ga0247554_103759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300025913|Ga0207695_10053167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4237 | Open in IMG/M |
3300025915|Ga0207693_10831089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
3300025942|Ga0207689_11247032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300026298|Ga0209236_1145738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1008 | Open in IMG/M |
3300026301|Ga0209238_1155298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300026324|Ga0209470_1278988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300026325|Ga0209152_10088399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
3300026334|Ga0209377_1258102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300026335|Ga0209804_1299078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300026542|Ga0209805_1014515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4190 | Open in IMG/M |
3300027559|Ga0209222_1035167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 966 | Open in IMG/M |
3300027565|Ga0209219_1089994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300027570|Ga0208043_1187437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300027590|Ga0209116_1118715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300027684|Ga0209626_1031085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1303 | Open in IMG/M |
3300027829|Ga0209773_10230294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300027842|Ga0209580_10124673 | Not Available | 1257 | Open in IMG/M |
3300027842|Ga0209580_10372009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300027842|Ga0209580_10405519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300027846|Ga0209180_10167881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1266 | Open in IMG/M |
3300027846|Ga0209180_10686601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300027857|Ga0209166_10176001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1159 | Open in IMG/M |
3300027862|Ga0209701_10020291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4332 | Open in IMG/M |
3300027867|Ga0209167_10178814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
3300027869|Ga0209579_10460040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300027875|Ga0209283_10320380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
3300027882|Ga0209590_10185962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1307 | Open in IMG/M |
3300027889|Ga0209380_10850010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300027894|Ga0209068_10339923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300027898|Ga0209067_10034731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2570 | Open in IMG/M |
3300027905|Ga0209415_10317020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
3300027910|Ga0209583_10443536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300027986|Ga0209168_10326863 | Not Available | 751 | Open in IMG/M |
3300028666|Ga0265336_10153536 | Not Available | 685 | Open in IMG/M |
3300028759|Ga0302224_10016686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2686 | Open in IMG/M |
3300028798|Ga0302222_10056684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1584 | Open in IMG/M |
3300028828|Ga0307312_10658428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300028884|Ga0307308_10623649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300028906|Ga0308309_11516794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300028909|Ga0302200_10232202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300029943|Ga0311340_11580749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300029954|Ga0311331_10920111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
3300029954|Ga0311331_11303025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300029990|Ga0311336_11940686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300030000|Ga0311337_10975961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300030042|Ga0302300_1234504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300030053|Ga0302177_10541018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300030058|Ga0302179_10387637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300030494|Ga0310037_10252765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300030525|Ga0210273_1011064 | Not Available | 528 | Open in IMG/M |
3300030706|Ga0310039_10170349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300030730|Ga0307482_1142797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300030738|Ga0265462_10623389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
3300030740|Ga0265460_12911179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300030923|Ga0138296_1266274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300031122|Ga0170822_15294764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300031234|Ga0302325_10544454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1734 | Open in IMG/M |
3300031236|Ga0302324_102235876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300031250|Ga0265331_10374478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300031715|Ga0307476_10243145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1313 | Open in IMG/M |
3300031718|Ga0307474_10407826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1058 | Open in IMG/M |
3300031718|Ga0307474_11048067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300031719|Ga0306917_10443977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1016 | Open in IMG/M |
3300031744|Ga0306918_10076837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2312 | Open in IMG/M |
3300031823|Ga0307478_10154838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1821 | Open in IMG/M |
3300031823|Ga0307478_10296704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1323 | Open in IMG/M |
3300031823|Ga0307478_10889526 | Not Available | 745 | Open in IMG/M |
3300031947|Ga0310909_11099066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300031962|Ga0307479_11940995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300031996|Ga0308176_12804037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300032180|Ga0307471_103062298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300032180|Ga0307471_103293034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300032515|Ga0348332_10421093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300032515|Ga0348332_12534312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
3300032770|Ga0335085_12199535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300032783|Ga0335079_11094266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300032805|Ga0335078_10647028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1323 | Open in IMG/M |
3300032828|Ga0335080_11677087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300032892|Ga0335081_10149740 | All Organisms → cellular organisms → Bacteria | 3339 | Open in IMG/M |
3300032898|Ga0335072_10444487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1370 | Open in IMG/M |
3300032955|Ga0335076_10960771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
3300033158|Ga0335077_10270514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1873 | Open in IMG/M |
3300033158|Ga0335077_10967462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
3300033158|Ga0335077_12083464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300033412|Ga0310810_11324431 | Not Available | 563 | Open in IMG/M |
3300033755|Ga0371489_0245092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
3300033888|Ga0334792_007374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4670 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.47% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.51% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.51% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.24% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.24% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.66% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.39% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.39% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.54% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.54% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.12% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.27% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.27% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.27% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.27% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.27% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.85% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.85% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.85% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.42% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.42% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.42% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019187 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030525 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12712J15308_101825301 | 3300001471 | Forest Soil | GTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVVANP* |
JGI12635J15846_105148221 | 3300001593 | Forest Soil | GTAVGDLQALDNSELYSDFEILDDLQAQQDADANP* |
Ga0062384_1007757522 | 3300004082 | Bog Forest Soil | IEPQATPEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVVANP* |
Ga0062389_1034563032 | 3300004092 | Bog Forest Soil | RAMVAEPGTAVGDLQALDKNGELYSDFEILDDLQAQQDAGANP* |
Ga0062595_1020703532 | 3300004479 | Soil | VTAEPGTAVGDLQALEKNQTLYSDFEVLDDLEVQQDVTANP* |
Ga0066672_101507513 | 3300005167 | Soil | PAEPGTAVGDLQALDKNHDLYADFDVLDDLEVQDDVRANP* |
Ga0066690_103926151 | 3300005177 | Soil | VALEKLEPGTAVGDLQALDKNHELYADFDVLDDLEVQQDVTANP* |
Ga0068869_1003767691 | 3300005334 | Miscanthus Rhizosphere | IAVVAPGTAVGDLQALDKNDDMYANFDELDDLQVQPDVTANP* |
Ga0070706_1017729561 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DGGVPHGQGRSAPIAEPGTAVGDLQALDKNHELYSDFDVLDDLEVQHDVTANP* |
Ga0070730_106472531 | 3300005537 | Surface Soil | IPGTAVSDLSALEKNHDLYSDFDLLDDLQVQPDVVENQ* |
Ga0066654_106444901 | 3300005587 | Soil | MADNAAPGTAVSDLQTLDKNHDLYANFDLLDDLDLQQDVTANP* |
Ga0070740_103430651 | 3300005607 | Surface Soil | KPATEAAKIIEPGSAVSDLQALDKNDELFSDFDVLDDLQVQQDVTANP* |
Ga0070763_102497103 | 3300005610 | Soil | EGEVAAVIAEPGSAVSDLQSLEKNHDLYSDFEVLDDLDLQQNVTANPAE* |
Ga0070764_107279832 | 3300005712 | Soil | LGIRDDGRVATMVAEPGSAVGDLSAMDKNSELYSDFDVLDDLQVQQDVNANP* |
Ga0070766_107959111 | 3300005921 | Soil | GPRAMMVAEPGTAVGDLQALDKNNELYSDFELLDDLQVQQDVDANP* |
Ga0070766_109805202 | 3300005921 | Soil | VAVVDSAEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQKDVVANP* |
Ga0070766_112635002 | 3300005921 | Soil | EAQEPGTAVSDLQALEKNHDLYSNFDLLDDMELQHDVTENP* |
Ga0066651_100878161 | 3300006031 | Soil | QAPAEPGTAVGDLQALEKNQNLYSDFEVLDDLEVQQDVTANP* |
Ga0075023_1004108521 | 3300006041 | Watersheds | PLALAEPGTAVGDLQALEKNQSLYSDFDVLDDLEVQQDVTANP* |
Ga0066652_1005776853 | 3300006046 | Soil | QVADVTQPGSAVSDLQTLDKNHDLYADFDLLDDLDLQQDVTANP* |
Ga0075028_1002777842 | 3300006050 | Watersheds | GTAVGDLQSLDKNTDLYSDADVLDDLDVQQDNTANP* |
Ga0075028_1004713442 | 3300006050 | Watersheds | TTASVVTEPGSAVSDLSALDKNHDLYSDFDVLDDLQVQDDVTANP* |
Ga0070716_1016535962 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LQTLEKNNEMYADFELLDDLDLQQNVVDNSQNADN* |
Ga0070712_1000126597 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DLETLDKNHDMYADFELLDDLDVQKDVPANPQNAD* |
Ga0070712_1003412313 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GPGSAVSDLSTLDKNHDLYADFELLDDLDLQQDVQANP* |
Ga0066653_101530811 | 3300006791 | Soil | ASVPAEPGTAVGDLQALDKNHDLYSDFDVLDDLTVQQDVTANP* |
Ga0079220_111385551 | 3300006806 | Agricultural Soil | GTAVGDLQALEKNQNLYSDFEVLDDLEVQQDVTANP* |
Ga0075425_1015225572 | 3300006854 | Populus Rhizosphere | EPGTAVGDLQALEKNQNLYSDFEVLDDLEVQQDVTANP* |
Ga0075425_1019786242 | 3300006854 | Populus Rhizosphere | TQTTVAAEPGTAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP* |
Ga0099829_107449051 | 3300009038 | Vadose Zone Soil | RDGGVPHGQGTSAPIAEPGTAVGDLQALDKNHELYSDFDVLDDLEVQHDVTANP* |
Ga0099830_110642171 | 3300009088 | Vadose Zone Soil | GQGTSAPIAEPGTAVGDLQALDKNHELYSDFDVLDDLEVQHDVTANP* |
Ga0105241_107124633 | 3300009174 | Corn Rhizosphere | AVGDLQALDKNHDLYSDFDVLDDLQVQQDVNANP* |
Ga0105248_112387941 | 3300009177 | Switchgrass Rhizosphere | SPGTAVSDLQQLDKNNDLYSEFDVLDDLQVQPDVTANP* |
Ga0116222_10201921 | 3300009521 | Peatlands Soil | PRAMVAEPGTAVGDLQALDKNSELYSDFEILDDLQAQQDVTANP* |
Ga0116218_10804641 | 3300009522 | Peatlands Soil | VSDRGPIAAVVEPGTAVGDLQALDKNGELYSDFDVLDDLQVQQDVTANP* |
Ga0116220_105133301 | 3300009525 | Peatlands Soil | RAMVAEPGTAVGDLQALDKNGDLYSDFEILDDLQAQQDVDANP* |
Ga0105237_124992242 | 3300009545 | Corn Rhizosphere | DVATSVQPGTAVGDLQTLDQNAELYSDFDVLDDLQVQPDVTANP* |
Ga0116105_10239383 | 3300009624 | Peatland | MVAEPGTAVGDLQALDKNNELYSDFELLDDLQVQKDVDANP* |
Ga0116105_10981461 | 3300009624 | Peatland | DAGPGTAVSDLQALENNHDMYSDFEMLDDLAVQQDVEANP* |
Ga0116129_10521583 | 3300009633 | Peatland | QAEPGSAVGDLQALDKNHDLYSDFDLLDDLQVQHNVVANP* |
Ga0116216_104652242 | 3300009698 | Peatlands Soil | GTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVTANP* |
Ga0123355_113483512 | 3300009826 | Termite Gut | APGSAVSDLQTLENNHDMYADFDLLDELDVQQNVVANP* |
Ga0126380_111895962 | 3300010043 | Tropical Forest Soil | VGDLQTLDKNDDMYANFELLDDLDLQQNVDATPQTSDN* |
Ga0123356_101164371 | 3300010049 | Termite Gut | PPAPGSAVSDLQTLENNHDMYADFDLLDELDVQQNVVANP* |
Ga0126322_11716292 | 3300010143 | Soil | APQTMADNASPGTAVGDLQTLDKNHDLYANFDLLDDLELQQDVTANP* |
Ga0134065_104683281 | 3300010326 | Grasslands Soil | DPGSAVGDLQTLDNNHDLYANFDLLDDMDLQQDVTANP* |
Ga0126370_118695692 | 3300010358 | Tropical Forest Soil | AVSDLETLDKNHDMYADFELLDDLDVQKDVPANPQNAD* |
Ga0134125_100357161 | 3300010371 | Terrestrial Soil | VVEPGTAVGDLQALDKNHDVYADSDLLDDLQVQEDVNANP* |
Ga0134125_101755671 | 3300010371 | Terrestrial Soil | PVVVEPGTAVGDLQALDKNHDLYSDFDVLDDLQVQSNVVANP* |
Ga0136449_1000901707 | 3300010379 | Peatlands Soil | GTAVGDLQALDRNHDLYSDFEILDDLQAQQDVDANP* |
Ga0136449_1034039342 | 3300010379 | Peatlands Soil | AVDSQSTEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQQDVVANP* |
Ga0134126_119355881 | 3300010396 | Terrestrial Soil | TGHAPQGGPVAVEPGTAVGDLQALDKNHDLYSDFDVLDDLQVQSNVVANP* |
Ga0138555_11510972 | 3300011075 | Peatlands Soil | EPGTAVGDLQALDKNSELYSDFEILDDLQAQQDVTANP* |
Ga0138574_10164391 | 3300011076 | Peatlands Soil | AVGDLQALDKNNELYSDFELLDDLQVQQDVDANP* |
Ga0138564_12048592 | 3300011086 | Peatlands Soil | AVSDLKALEDNHDMYSDFEMLDDLDVQQDVVANP* |
Ga0138578_12902362 | 3300011110 | Peatlands Soil | EPGTAVGDLQALDKNNELYSDFELLDDLQVQQDVDANP* |
Ga0137391_106153402 | 3300011270 | Vadose Zone Soil | MDIQSAMTEPGTAVGDLQALDRNHELYSDFELLDDLEVQHDVVANP* |
Ga0137388_112169152 | 3300012189 | Vadose Zone Soil | PVAQIEPGTAVGDLQALDKNHELYSDFDVLDDLEVQHDVTANP* |
Ga0137364_111585031 | 3300012198 | Vadose Zone Soil | TAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP* |
Ga0137382_101924173 | 3300012200 | Vadose Zone Soil | AAEPGTAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP* |
Ga0137399_108284872 | 3300012203 | Vadose Zone Soil | EPGTAVGDLQALDRNHELYSDFELLDELEVQHDVVANP* |
Ga0137384_108062451 | 3300012357 | Vadose Zone Soil | GAGQIAGGQVEPGTAVGDLQALDKNHDLYSDFDVLDDLQVQQDVNANP* |
Ga0137390_119757581 | 3300012363 | Vadose Zone Soil | VTLFRRDGGVPHGQGTSAPIAEPGTAVGDLQALDKNHELYSDFDVLDDLEVQHDVTANP* |
Ga0137395_104284581 | 3300012917 | Vadose Zone Soil | HGPQQIASVPAEPGTAVGDLQALDKNHDLYSDFDVLDDLTVQQDVTANP* |
Ga0137396_109895521 | 3300012918 | Vadose Zone Soil | ALPGTAVGDLQALDKNHELYADFDVLDDLEVQGNVTANP* |
Ga0137407_109175512 | 3300012930 | Vadose Zone Soil | PGTPVGDLQALDKNDDMYANFDELDDLQVQSDVTANP* |
Ga0137410_109458782 | 3300012944 | Vadose Zone Soil | GTTTTAAVMAEPGSAVSDLQALDSNPDLYSDFDVLDDLQVQQDVNANP* |
Ga0164307_104650163 | 3300012987 | Soil | PGTPVGDLNALDKNHDLLTDFEVLDDLQVQHDVTP* |
Ga0157371_106860872 | 3300013102 | Corn Rhizosphere | IAAAPGTAVGDLQALDRNDDMYANFDELDDLQVQSDVTANP* |
Ga0181531_100714261 | 3300014169 | Bog | EPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVVANP* |
Ga0181531_104646822 | 3300014169 | Bog | EGPRALMVAEPGTAVGDLQALDKNNELYSDFELLDDLQVQKDVDANP* |
Ga0181526_103432521 | 3300014200 | Bog | PGSAVSDLNDLEKNHDLYTDFELLDDLDLQQDVKANP* |
Ga0182018_101654621 | 3300014489 | Palsa | DGPSAMVAAPGTAVGDLQALDKNSELYSDFEILDDLQAQQDVDANP* |
Ga0182024_111912831 | 3300014501 | Permafrost | PGTAVGDLQALDKNSDLYSDFEILDDLQAQQDVDANP* |
Ga0181522_100292611 | 3300014657 | Bog | PAEPGTAVSDLQSLEKNHDLYSDFDLLDDLQVQHDVVANP* |
Ga0181519_100755944 | 3300014658 | Bog | GTGPGSAVGDLQTLEKNHDMYSDFELLDDLDLQQDVAANP* |
Ga0157379_102841523 | 3300014968 | Switchgrass Rhizosphere | PIIAAAPGTAVGDLQALDRNDDMYANFDELDDLQVQSDVTANP* |
Ga0157379_107651783 | 3300014968 | Switchgrass Rhizosphere | VSTEPGTAVGDLQALDKNHDLYSDFDVLDDLQVQQDVNANP* |
Ga0157376_124779732 | 3300014969 | Miscanthus Rhizosphere | PAVGSAVSDLQTLDKNHDLYADFDLLDDLDLQQDVVATP* |
Ga0137420_14966535 | 3300015054 | Vadose Zone Soil | QPPEPGTAVGDLQALDRNHELYADFDLLDDLEVQQDVTANF* |
Ga0137409_107374152 | 3300015245 | Vadose Zone Soil | PGTAVGDLQALDKNHDLLLDFDELDDLQVQSEVTANP* |
Ga0182038_115269331 | 3300016445 | Soil | LRSEPGTAVGDLQALDKNHDLYADFDLLDDVQVQQNVTANP |
Ga0181511_14955171 | 3300016702 | Peatland | PIAEADAGPGTAVSDLQTLENNHDMYSDFETLDDLDLQQDVAANQ |
Ga0187802_100132571 | 3300017822 | Freshwater Sediment | TAVSDLQSLENNNELYADFELLDDLDVQQDVVANP |
Ga0187818_1000050613 | 3300017823 | Freshwater Sediment | PRAMVAEPGTAEGDLQALDKNSELYSDFEILDDLQAQQDVNANP |
Ga0187824_102083111 | 3300017927 | Freshwater Sediment | DNAAPGTAVGDLQILDKNHDLYANFDLLDDMDLQQDVTANP |
Ga0187824_103138381 | 3300017927 | Freshwater Sediment | VTDASNIAAPPGSAVSDLQSLDKNHELYSDFELLDDLDVQQNVTANP |
Ga0187801_100798021 | 3300017933 | Freshwater Sediment | GKSVSDGGTLAAIVEPGTAVGDLQALDKNGELYSDFDVLDDLQVQQDVTANP |
Ga0187803_101895832 | 3300017934 | Freshwater Sediment | DGPRAMVAEPGTAVGDLQALDKNSELYSDFEILDDLQAQQDVNANP |
Ga0187821_101488541 | 3300017936 | Freshwater Sediment | SNIAAPPGSAVSDLQSLDKNHESYSDFELLDDLDVQQNVTANP |
Ga0187817_101983291 | 3300017955 | Freshwater Sediment | PEGPRAMVAAPGTAVGDLQALDKNGDLYSDFEVLDDLQAQQDVDQNP |
Ga0187817_103391151 | 3300017955 | Freshwater Sediment | PGTAVSDLQALDKNHDLYSDFDLLDDLEVQHDVTANP |
Ga0187776_112526002 | 3300017966 | Tropical Peatland | VMAEPGTAVYDLQALDKNSELYSDFDVLDDLQVQHDVSANQ |
Ga0187783_100160341 | 3300017970 | Tropical Peatland | LPGTAVGDLQALDKNSDLYSDFELLDDLQVQQDVSANP |
Ga0187783_102067873 | 3300017970 | Tropical Peatland | PGSAVSDLQTLDKNHDMYADFELLDDLDVQQDVVANP |
Ga0187780_108289312 | 3300017973 | Tropical Peatland | VGPGSAVSDLQDMEKNHDMYSDFELLDDLEVQQNVVASPQNAD |
Ga0187782_108946121 | 3300017975 | Tropical Peatland | VIDVGPGTAVSDLKALDANHEMYSDFDLLDELEVQQDVVANP |
Ga0187822_101540271 | 3300017994 | Freshwater Sediment | VTDASNIAAPPGSAVSDLQSLDKNHELYSDFELLDDLDVQQNVMANP |
Ga0187816_103724381 | 3300017995 | Freshwater Sediment | MADYTPAIIEPGTAVGDLQALDKNNELYSDFDVLDDLQVQADVNANP |
Ga0187884_102151521 | 3300018009 | Peatland | EVAVVDSAEPGTAVSDLQALEKNHDLYADFDLLDDLEVQQDVKANP |
Ga0187855_101770472 | 3300018038 | Peatland | MAPPEPGTAVGDLQALEKNHDLYSDFEVLDDLDLQQDVVANP |
Ga0187784_107162092 | 3300018062 | Tropical Peatland | MIPGTAVSDLSALDKNHDLYSDFDLLDDMQVQPDVVENP |
Ga0187772_100439211 | 3300018085 | Tropical Peatland | PGPDVANINEPGTAVSDLQSLDKDSELYSDFDLLDDLSVQQDVVANP |
Ga0187772_113612671 | 3300018085 | Tropical Peatland | EPGTAVGDLSALDKNNDLYSDFELLDDLQVQQNVTANP |
Ga0187769_104547072 | 3300018086 | Tropical Peatland | GTAVGDLQALDKNSELYSDFELLDDLRVQQDVTANP |
Ga0187769_113093091 | 3300018086 | Tropical Peatland | SEVAEPGTAVGDLQALEKNHELYSDFDLLDDLDLQQDVVANP |
Ga0187770_102141181 | 3300018090 | Tropical Peatland | GSAVSDLQALENNHELYSDFELLDDLDLQQDVVANP |
Ga0187770_108785421 | 3300018090 | Tropical Peatland | TAVGDLQALDKNSELYSDFELLDDMTVQQDVNANP |
Ga0187770_112861592 | 3300018090 | Tropical Peatland | MTEAPEPGTAVGDLQALETNQELYSDFELLDDLAVQQDVVANP |
Ga0066655_109296472 | 3300018431 | Grasslands Soil | ASVPAEPGTAVGDLQALDKNHDLYSDFDVLDDLTVQQDVTANP |
Ga0066667_105058643 | 3300018433 | Grasslands Soil | QVADVTQPGSAVSDLQTLDKNHDLYADFDLLDDLDLQQDVTANP |
Ga0184584_1210032 | 3300019187 | Soil | PTAEGPRAMVAEPGTAVGDLQALDKNNELYSDFEILDDLQAQQDVDVNP |
Ga0187798_12075011 | 3300019275 | Peatland | PGTAVGDLQALDKNSELYSDFELLDDMTVQQDVNANP |
Ga0187797_11357431 | 3300019284 | Peatland | GTAVSDLQALEKNHELYSDFELLDDLDLQQDVVANP |
Ga0182025_13247432 | 3300019786 | Permafrost | VVAVIDSTEPGSAVGDLQALEKNHDLYADFDLLDDLEVQHDVVANP |
Ga0193723_10444153 | 3300019879 | Soil | SVVAEPGSAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP |
Ga0193723_11963511 | 3300019879 | Soil | GGGTGTPAPSQVAVAEPGTAVGDLQALEKNQNLYSDFEVLDDLEVQQDVTANP |
Ga0193726_10144481 | 3300020021 | Soil | EPGTAVGDLQALDNNLDLYSNFDVLDDLEVQPDVTANP |
Ga0210403_101036223 | 3300020580 | Soil | GPTAMAAEPGTAVGDLQALDKNHDLYSEFEILDDLQAQQDVDANP |
Ga0210403_111632921 | 3300020580 | Soil | MAAAPGTAVGDLQALDKNSDLYSDFEILDDLQAQQDVDVNP |
Ga0210403_113169891 | 3300020580 | Soil | AAILEPPAAGTAVSDLQTLDKNHDLYADFDLLDDLDLQQDVVANP |
Ga0210399_110544321 | 3300020581 | Soil | VGTAVSDLQTLEKNHEMYSDFELLDDLDLQQDVEANP |
Ga0210395_103522661 | 3300020582 | Soil | SAVSDLQDLEQNHDLYSNYEVLDDLDLQQDVVANP |
Ga0210401_110543452 | 3300020583 | Soil | NSEPGTAPGTAVSDLQALEKNHDMYSDFDLLDDLELQQNVAANP |
Ga0215015_105137502 | 3300021046 | Soil | AMTEPGTAVGDLQALDRNHELYSDFELLDDLEVQHDVVANP |
Ga0210400_101173201 | 3300021170 | Soil | PGTAVSDLQALEKNHDLYSDFDLLDDLEVQKDVVANP |
Ga0210405_107375971 | 3300021171 | Soil | PAEPGTAVGDLQALEKNQNLYSDFDVLDDVAVQPDVTANP |
Ga0193719_103627712 | 3300021344 | Soil | VTRAGEPGTAVGDLQALDKNQELYSDFDVLDDLQVQQDVNANP |
Ga0210385_100624054 | 3300021402 | Soil | GTAVSDLQTLDKNHDMYSDFDLLDDLDLQQNVAANP |
Ga0210394_103234853 | 3300021420 | Soil | GSAVGDLSAMDKNSELYSDFDVLDDLQVQQDVNANP |
Ga0210394_111974482 | 3300021420 | Soil | GGPGTAVSDLQTLEKNHDMYSDFEMLDDLDVQQDVVANQ |
Ga0213879_101122371 | 3300021439 | Bulk Soil | VAMAPPGTAVGDLQALDKNGELYSDFELLDDMSVQSDVSANP |
Ga0210390_106725972 | 3300021474 | Soil | SADKPGTAVGDLQALDKNQNLYSDFEVLDDLEVQQDVTANP |
Ga0210390_112770341 | 3300021474 | Soil | PGSAVSDLQSLEKNHDLYSDFEVLDDLDLQQNVTANPAE |
Ga0210402_103692451 | 3300021478 | Soil | VQSAVEPGTAVGDLQALDKNQNLYSDFEVLDDLEVQQDVTANP |
Ga0210410_104409303 | 3300021479 | Soil | GSAVSDLQTLEKNHDMYSDFEMLDDLDVQQDVVANQ |
Ga0213851_11464671 | 3300021860 | Watersheds | PGTAVSDLQALDKNHDLYSDFELLDDLDVQQDVVANP |
Ga0213853_115939241 | 3300021861 | Watersheds | GTAVSDLQALERNHDLYSDFELLDELDVQQDVVANP |
Ga0224546_10095513 | 3300022515 | Soil | AEPGMAVSDLQALEKNHDLYADFDLLDDLELQHDVVENP |
Ga0242662_100680051 | 3300022533 | Soil | PGQPVAEVGTAVSDLQTLEKNHEMYSDFELLDDLDLQQDVAANP |
Ga0242653_11049782 | 3300022712 | Soil | MDSAPGTAVSDLQTLDKNHDMYSDFDLLDDLDLQQNVAANP |
Ga0242678_10137382 | 3300022715 | Soil | WADAGPGTAVSDLQALEKNNEMYADFDMLDDLSVQQDVAANP |
Ga0242666_11064411 | 3300022721 | Soil | NHGDGQVATMVAEPGSAVGDLNALDKNSELYSDFDVLDDLQVQQDVNANP |
Ga0242654_104056211 | 3300022726 | Soil | TAVSDLQALEKNHDMYSDFDLLDDLELQQNVAANP |
Ga0224563_10166061 | 3300022731 | Soil | EATRALLVAEPGTAVGDLQALDKNNELYSDFELLDDLQVQKDVDANP |
Ga0222622_108573091 | 3300022756 | Groundwater Sediment | DTPGTAVGDLQALDNNDDLYANFDVLDDLQVQADVTATP |
Ga0247552_1031802 | 3300023536 | Soil | DAAAQSEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVSANP |
Ga0247554_1037591 | 3300023547 | Soil | AQSEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVSANP |
Ga0207695_100531677 | 3300025913 | Corn Rhizosphere | NADPGTAVSDLQTLDKNHDLYANFDLLDDMDLQQDVTANP |
Ga0207693_108310892 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GPGSAVSDLSTLDKNHDLYADFELLDDLDLQQDVQANP |
Ga0207689_112470322 | 3300025942 | Miscanthus Rhizosphere | EPGTAVGDLQALDKNHDLYSDFDVLDDLQVQQDVNANP |
Ga0209236_11457381 | 3300026298 | Grasslands Soil | TAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP |
Ga0209238_11552981 | 3300026301 | Grasslands Soil | QTTVAAEPGTAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP |
Ga0209470_12789881 | 3300026324 | Soil | TPVGDLQALEKNHELYSDFDLLDDLQVQQDVNSNP |
Ga0209152_100883991 | 3300026325 | Soil | KLEPGTAVGDLQALDKNHELYADFDVLDDLEVQQDVTANP |
Ga0209377_12581021 | 3300026334 | Soil | VAAEPGTAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP |
Ga0209804_12990781 | 3300026335 | Soil | TSAQGISPPWSTPAEPGTAVGDLQALDKNHDLYADFDVLDDLEVQDDVRANP |
Ga0209805_10145151 | 3300026542 | Soil | VGDLQQLDKNHDLYSDFDVLDDLAAQQQEDQTANP |
Ga0209222_10351671 | 3300027559 | Forest Soil | DTAQPAEPGTAVSDLQSLDKNHDLYSDFDLLDDLTVQHDVVANP |
Ga0209219_10899941 | 3300027565 | Forest Soil | IYRGGSGPVAAVPGTAVSDLQALDKNHDLYSDFDVLDDLEVQQNVTANP |
Ga0208043_11874371 | 3300027570 | Peatlands Soil | NSTPEGPRAMVAEPGTAVGDLQALDKNNELYSDFEILDDLQAQQDVDVNP |
Ga0209116_11187152 | 3300027590 | Forest Soil | QSEPGTAVSDLQALDKNHDLYSDFDLLDDLEVQHDVVANP |
Ga0209626_10310851 | 3300027684 | Forest Soil | TPQSTGPGTAVSDLQSLEKNHDLYSDFDLLDDLEVQHDVTANP |
Ga0209773_102302941 | 3300027829 | Bog Forest Soil | DALSSAEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVTANP |
Ga0209580_101246731 | 3300027842 | Surface Soil | AGRNPSPDGTRAMAAPGTAVGDLQALDKNGDLYSDFEILDDLQAQQDMDANP |
Ga0209580_103720091 | 3300027842 | Surface Soil | PGTAVSDLEALDKNHDLYADFELLDDLDVQQDVVANP |
Ga0209580_104055191 | 3300027842 | Surface Soil | LQPFQPGTAVSDLQSLEKNDDLYADFELLDDLEVQSDVTANP |
Ga0209180_101678811 | 3300027846 | Vadose Zone Soil | TQSTEPGTAVSDLQALDKNLDLYADFDLLDDLEVQQDVTANP |
Ga0209180_106866012 | 3300027846 | Vadose Zone Soil | PGTAVGDLQALDKNHELYSDFDVLDDLEVQHDVTANP |
Ga0209693_102085433 | 3300027855 | Soil | EGEVAAVIAEPGSAVSDLQSLEKNHDLYSDFEVLDDLDLQQNVTANPAE |
Ga0209166_101760013 | 3300027857 | Surface Soil | GPGTAVSDLTALDKNHDMYADFEMLDDLDVQQDVVANP |
Ga0209701_100202911 | 3300027862 | Vadose Zone Soil | GQGTSAPIAEPGTAVGDLQALDKNHELYSDFDVLDDLEVQHDVTANP |
Ga0209167_101788143 | 3300027867 | Surface Soil | SAEPGTAVSDLQSLEKNHDLYSDFDLLDDLEVQHDVTANP |
Ga0209579_104600402 | 3300027869 | Surface Soil | GTAVGDLQALDKNHDLYADFDLLDDVQVQQNVVANP |
Ga0209283_103203802 | 3300027875 | Vadose Zone Soil | QGTSAPIAEPGTAVGDLQALDKNHELYSDFDVLDDLEVQHDVTANP |
Ga0209590_101859623 | 3300027882 | Vadose Zone Soil | TTITEPALGTAESDLQTLENNHDLYADFDLLDDMELQQDVVANP |
Ga0209380_108500101 | 3300027889 | Soil | EAQEPGTAVSDLQALEKNHDLYSNFDLLDDMELQHDVTENP |
Ga0209068_103399232 | 3300027894 | Watersheds | VEPGTAVGDLQALDRNNELYSDFELLDDLQVQQDVDANP |
Ga0209067_100347314 | 3300027898 | Watersheds | VAEPGTAVGDLQALENNHELYSDFELLDDLDVQQDVVANP |
Ga0209415_103170202 | 3300027905 | Peatlands Soil | PGTAVSDLQALENNHDMYSDFEMLDDLDVQQDVVANP |
Ga0209583_104435361 | 3300027910 | Watersheds | PLALAEPGTAVGDLQALEKNQSLYSDFDVLDDLEVQQDVTANP |
Ga0209168_103268631 | 3300027986 | Surface Soil | DGTRAMAAPGTAVGDLQALDKNGDLYSDFEILDDLQAQQDMDANP |
Ga0265336_101535361 | 3300028666 | Rhizosphere | PPVPGLPAQPGTAVSDLQALEKNNEMYADFDVLDDLQVQNDVTANP |
Ga0302224_100166865 | 3300028759 | Palsa | DSQGQVAEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQKDVQANP |
Ga0302222_100566841 | 3300028798 | Palsa | TEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVVANP |
Ga0307312_106584281 | 3300028828 | Soil | EPGSAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP |
Ga0307308_106236492 | 3300028884 | Soil | VVAEPGSAVGDLQALDKNHELYSDFDVLDDLQVQQDVNANP |
Ga0308309_115167941 | 3300028906 | Soil | PGTAVSDLQALEKNHDLYSDFDLLDDLTVQNDVQANP |
Ga0302200_102322021 | 3300028909 | Bog | PQVSPEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVQANP |
Ga0311340_115807491 | 3300029943 | Palsa | PQTQAAEPGTAVSDLQALEKNHDLYADFDLLDDLELQHDVVENP |
Ga0311331_109201111 | 3300029954 | Bog | MQAAEPGTAVGDLQALEKNHDLYSDFELLDDVEVQHSVVENP |
Ga0311331_113030252 | 3300029954 | Bog | IESPTAAAEPGTAVSDLQSLEKNHDLYSDFDLLDDLEVQHDVTANP |
Ga0311336_119406862 | 3300029990 | Fen | AEPAPGTAVGDLQSLDKNHELLSDFDVLDDLQVKQDATANP |
Ga0311337_109759611 | 3300030000 | Fen | GTAVGDLQSLDKNHELLSDFDVLDDLQVKQDATANP |
Ga0302300_12345042 | 3300030042 | Palsa | GQVAEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQKDVQANP |
Ga0302177_105410181 | 3300030053 | Palsa | IMDTQPQTEPSTGVSDLQALENNHDLYSDFELLDDLETQQNVVANP |
Ga0302179_103876371 | 3300030058 | Palsa | TAVSDLQSLEKNHDLYSDFDLLDDLEVQHDVVANP |
Ga0310037_102527651 | 3300030494 | Peatlands Soil | GTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVTANP |
Ga0210273_10110642 | 3300030525 | Soil | AEGSAVGDLQSLENNHDMYSDFELLDAPDAQQDVVANP |
Ga0310039_101703491 | 3300030706 | Peatlands Soil | GQEATITEPAEPGTAVSDLQALEKNHDLYSDFELLDDLDVQQDVVANP |
Ga0307482_11427971 | 3300030730 | Hardwood Forest Soil | TEPGTAVSDLQALDKNDDLYADFDLLDDLEVQQDVTANP |
Ga0265462_106233891 | 3300030738 | Soil | RGTAVSDLQALENNHDLYSDFDLLDDLEVQHDVVANP |
Ga0265460_129111791 | 3300030740 | Soil | VQSAEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVVANP |
Ga0138296_12662741 | 3300030923 | Soil | GSAVSDLQALEKNHELYADFELLDDLQVQDDVLANP |
Ga0170822_152947642 | 3300031122 | Forest Soil | GTAVSDLQTLDKNHDLYAGFDLLDDLDLQQDVVANP |
Ga0302325_105444541 | 3300031234 | Palsa | STGVSDLQALENNHDLYSDFELLDDLETQQNVVANP |
Ga0302324_1022358761 | 3300031236 | Palsa | VVADSAPAEPGTAVSDLQSLEKNHDLYSDFDLLDDLQVQHDVVANP |
Ga0265331_103744781 | 3300031250 | Rhizosphere | APGTAVGDLQSLDKNHELLSDFDVLDDLQVKQDATANP |
Ga0307476_102431451 | 3300031715 | Hardwood Forest Soil | TAVSDLQTLEKNHDMYSDFELLDDLDVQQNVVATPQNAD |
Ga0307474_104078261 | 3300031718 | Hardwood Forest Soil | QASVTAPAGTAVSDLQTLDNNHEMYADFDLLDDLELQQNVAANP |
Ga0307474_110480671 | 3300031718 | Hardwood Forest Soil | VAEPGTAVGDLQALDKNNELYSDFELLDDLQVQKDVDANP |
Ga0306917_104439773 | 3300031719 | Soil | AALPGSAVSDLQALDKNSDLYSDFELLDDLQVQHDVSANP |
Ga0306918_100768371 | 3300031744 | Soil | AALPGSAVSDLQALDKNSELYSDFELLDDLQVQQDVSANP |
Ga0307478_101548383 | 3300031823 | Hardwood Forest Soil | IQPGSAVGDLQALDKNHELYSDFELLDDLEVQQDVVANP |
Ga0307478_102967041 | 3300031823 | Hardwood Forest Soil | PGTAVSDLQTLDKNHDMYSDFDLLDDLDLQQNVAANP |
Ga0307478_108895261 | 3300031823 | Hardwood Forest Soil | GRNPATAGPSAMMAAPGTAVGDLQALDKNGELFSDFEILDDLQAQQDVNANP |
Ga0310909_110990662 | 3300031947 | Soil | VSDLSTLEKNHDLYANFELLDDLDLQQDVAATSQNAE |
Ga0307479_119409951 | 3300031962 | Hardwood Forest Soil | GGSQPIAAVPGTAVSDLQALDKNHDLYSDFDVLDDLEVQQNVTANP |
Ga0308176_128040371 | 3300031996 | Soil | AQNADPGSAVGDLQTLDNNHDLYANFDLLDDMDLQQDVTANP |
Ga0307471_1030622982 | 3300032180 | Hardwood Forest Soil | TAVGDLQALEKNQNLYSDFELLDDLEVQQDVTANP |
Ga0307471_1032930342 | 3300032180 | Hardwood Forest Soil | MVIEPGTAVGDLQALDRNNELYSDFELLDDLQVQQDVDANP |
Ga0348332_104210931 | 3300032515 | Plant Litter | TAVSDLQALEKNHDLYSDFDLLDDLQVQHDVVANP |
Ga0348332_125343123 | 3300032515 | Plant Litter | AVVEPQTASEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQHDVQANP |
Ga0335085_121995352 | 3300032770 | Soil | SAVSDLQTLDKNHDMYAEFDMLDDLDVQQNVVANP |
Ga0335079_110942662 | 3300032783 | Soil | NPLAQVEPGTAVGDLQALDKNDEMYANFDILDDLQVQQNVTANP |
Ga0335078_106470283 | 3300032805 | Soil | EPATAVSDLQALDKNHDLYSDFELLDDLQVQQNVVANQ |
Ga0335080_116770872 | 3300032828 | Soil | GIVAPPGSAVSDLQALDKNHDMYSDFDLLDDLDVQQDVVANP |
Ga0335081_101497405 | 3300032892 | Soil | PFVQEIEPGTAVGDLSQLDKNHDLYSDFDLLDDLQVQQDVTANP |
Ga0335072_104444873 | 3300032898 | Soil | DDRAENVQPGTAVSDLQSLDKNTDLYSDSDLLDDLQVQQDVTANP |
Ga0335076_109607711 | 3300032955 | Soil | GSAVGDLTAMDKNSELYSDFDVLDDLQAQQDVNANP |
Ga0335077_102705143 | 3300033158 | Soil | ATVAEPGTAVSDLQALDQNHDVYTDSDLLDDLQVQQSVTANP |
Ga0335077_109674622 | 3300033158 | Soil | GPGTAVSDLQSLEKNHDLYSDFELLDELDVQQDVVANP |
Ga0335077_120834642 | 3300033158 | Soil | APPGSAVSDLQTLDKNHDMYSDFDLLDDLDVQQNVVANP |
Ga0310810_113244312 | 3300033412 | Soil | IAQAEPGTAVGDLQALDKNDDLYSSFDVLDDLQVQDGSAHP |
Ga0371489_0245092_3_122 | 3300033755 | Peat Soil | AEPGTAVSDLQALEKNHDLYSDFDLLDDLEVQQDVVANP |
Ga0334792_007374_3_116 | 3300033888 | Soil | PGTAVSDLQTLEKNHEMYSDFELLDDLDLQQDVVANP |
⦗Top⦘ |