NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F018110

Metagenome Family F018110

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018110
Family Type Metagenome
Number of Sequences 236
Average Sequence Length 42 residues
Representative Sequence MIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Number of Associated Samples 26
Number of Associated Scaffolds 235

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 78.81 %
% of genes near scaffold ends (potentially truncated) 24.15 %
% of genes from short scaffolds (< 2000 bps) 17.80 %
Associated GOLD sequencing projects 26
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (69.492 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(60.169 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(82.627 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.62%    β-sheet: 0.00%    Coil/Unstructured: 63.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 235 Family Scaffolds
PF03641Lysine_decarbox 4.26
PF00078RVT_1 4.26
PF02992Transposase_21 2.13
PF00665rve 2.13
PF03732Retrotrans_gag 2.13
PF08284RVP_2 2.13
PF14223Retrotran_gag_2 2.13
PF14111DUF4283 2.13
PF07727RVT_2 1.28
PF13960DUF4218 0.85
PF05691Raffinose_syn 0.43
PF01985CRS1_YhbY 0.43
PF13976gag_pre-integrs 0.43
PF08825E2_bind 0.43
PF13456RVT_3 0.43
PF14244Retrotran_gag_3 0.43
PF00067p450 0.43
PF00249Myb_DNA-binding 0.43
PF03000NPH3 0.43
PF14214Helitron_like_N 0.43
PF13963Transpos_assoc 0.43
PF00385Chromo 0.43
PF14380WAK_assoc 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 235 Family Scaffolds
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 4.26
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 2.13
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 2.13
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 2.13
COG4584TransposaseMobilome: prophages, transposons [X] 2.13
COG1534RNA-binding protein YhbYTranslation, ribosomal structure and biogenesis [J] 0.43
COG2124Cytochrome P450Defense mechanisms [V] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.78 %
UnclassifiedrootN/A18.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028786|Ga0307517_10010543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa12926Open in IMG/M
3300028786|Ga0307517_10012507Not Available11637Open in IMG/M
3300028786|Ga0307517_10015161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10265Open in IMG/M
3300028786|Ga0307517_10018856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8893Open in IMG/M
3300028786|Ga0307517_10023038All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae7768Open in IMG/M
3300028786|Ga0307517_10030133Not Available6372Open in IMG/M
3300028786|Ga0307517_10031275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6202Open in IMG/M
3300028786|Ga0307517_10035649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5627Open in IMG/M
3300028786|Ga0307517_10039313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5198Open in IMG/M
3300028786|Ga0307517_10041057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5012Open in IMG/M
3300028786|Ga0307517_10045190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4634Open in IMG/M
3300028786|Ga0307517_10049781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4278Open in IMG/M
3300028786|Ga0307517_10052637All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium4074Open in IMG/M
3300028786|Ga0307517_10054193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3972Open in IMG/M
3300028786|Ga0307517_10063673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3443Open in IMG/M
3300028786|Ga0307517_10064146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3419Open in IMG/M
3300028786|Ga0307517_10072144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3082Open in IMG/M
3300028786|Ga0307517_10080600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2785Open in IMG/M
3300028786|Ga0307517_10110422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2096Open in IMG/M
3300028786|Ga0307517_10110469All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb32095Open in IMG/M
3300028786|Ga0307517_10227438All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb31124Open in IMG/M
3300028786|Ga0307517_10292853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3918Open in IMG/M
3300028786|Ga0307517_10353249All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium797Open in IMG/M
3300028786|Ga0307517_10390410All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa740Open in IMG/M
3300028794|Ga0307515_10005156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta26565Open in IMG/M
3300028794|Ga0307515_10012614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa15884Open in IMG/M
3300028794|Ga0307515_10014156All Organisms → cellular organisms → Eukaryota → Viridiplantae14828Open in IMG/M
3300028794|Ga0307515_10022663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta11053Open in IMG/M
3300028794|Ga0307515_10024577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10490Open in IMG/M
3300028794|Ga0307515_10043772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix dunnii6945Open in IMG/M
3300028794|Ga0307515_10051135All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb36170Open in IMG/M
3300028794|Ga0307515_10056613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5693Open in IMG/M
3300028794|Ga0307515_10056818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5677Open in IMG/M
3300028794|Ga0307515_10056974Not Available5664Open in IMG/M
3300028794|Ga0307515_10112184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3173Open in IMG/M
3300028794|Ga0307515_10113918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3130Open in IMG/M
3300028794|Ga0307515_10138678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2623Open in IMG/M
3300028794|Ga0307515_10170722All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb32169Open in IMG/M
3300028794|Ga0307515_10188593Not Available1981Open in IMG/M
3300028794|Ga0307515_10190114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1966Open in IMG/M
3300028794|Ga0307515_10194438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1926Open in IMG/M
3300030521|Ga0307511_10016665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7075Open in IMG/M
3300030521|Ga0307511_10018726Not Available6603Open in IMG/M
3300030521|Ga0307511_10027804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5156Open in IMG/M
3300030521|Ga0307511_10057309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3031Open in IMG/M
3300030521|Ga0307511_10065252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2727Open in IMG/M
3300030521|Ga0307511_10084282All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb32207Open in IMG/M
3300030521|Ga0307511_10204794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1017Open in IMG/M
3300030521|Ga0307511_10241742All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3879Open in IMG/M
3300030521|Ga0307511_10260258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa823Open in IMG/M
3300030522|Ga0307512_10056493All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb33082Open in IMG/M
3300030522|Ga0307512_10074513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2491Open in IMG/M
3300030522|Ga0307512_10097931Not Available2003Open in IMG/M
3300030522|Ga0307512_10183655All Organisms → Viruses → Predicted Viral1169Open in IMG/M
3300030522|Ga0307512_10237909Not Available925Open in IMG/M
3300030522|Ga0307512_10284912All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa785Open in IMG/M
3300030522|Ga0307512_10388543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa592Open in IMG/M
3300031456|Ga0307513_10004187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta19296Open in IMG/M
3300031456|Ga0307513_10008654All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa12967Open in IMG/M
3300031456|Ga0307513_10012721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus10364Open in IMG/M
3300031456|Ga0307513_10014766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9496Open in IMG/M
3300031456|Ga0307513_10017196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8678Open in IMG/M
3300031456|Ga0307513_10029307All Organisms → cellular organisms → Bacteria6278Open in IMG/M
3300031456|Ga0307513_10049446Not Available4554Open in IMG/M
3300031456|Ga0307513_10055145All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4255Open in IMG/M
3300031456|Ga0307513_10058127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb34113Open in IMG/M
3300031456|Ga0307513_10060020All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4034Open in IMG/M
3300031456|Ga0307513_10064526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3858Open in IMG/M
3300031456|Ga0307513_10095320All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb33017Open in IMG/M
3300031456|Ga0307513_10097963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium2965Open in IMG/M
3300031456|Ga0307513_10103892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae2856Open in IMG/M
3300031456|Ga0307513_10107515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2792Open in IMG/M
3300031456|Ga0307513_10136164All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2391Open in IMG/M
3300031456|Ga0307513_10211907Not Available1767Open in IMG/M
3300031456|Ga0307513_10212085Not Available1766Open in IMG/M
3300031456|Ga0307513_10262274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1516Open in IMG/M
3300031456|Ga0307513_10626600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa783Open in IMG/M
3300031507|Ga0307509_10013562All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta9640Open in IMG/M
3300031507|Ga0307509_10024792All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae6712Open in IMG/M
3300031507|Ga0307509_10026060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6525Open in IMG/M
3300031507|Ga0307509_10026479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides6465Open in IMG/M
3300031507|Ga0307509_10052077Not Available4371Open in IMG/M
3300031507|Ga0307509_10066337Not Available3787Open in IMG/M
3300031507|Ga0307509_10081713Not Available3336Open in IMG/M
3300031507|Ga0307509_10166980All Organisms → Viruses → Predicted Viral2087Open in IMG/M
3300031507|Ga0307509_10216769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1731Open in IMG/M
3300031507|Ga0307509_10323601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1277Open in IMG/M
3300031507|Ga0307509_10373556All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb31141Open in IMG/M
3300031507|Ga0307509_10375029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1138Open in IMG/M
3300031507|Ga0307509_10464269All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb3957Open in IMG/M
3300031507|Ga0307509_10759834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa634Open in IMG/M
3300031616|Ga0307508_10005689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11805Open in IMG/M
3300031616|Ga0307508_10008495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9486Open in IMG/M
3300031616|Ga0307508_10020630All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5984Open in IMG/M
3300031616|Ga0307508_10025599All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb35347Open in IMG/M
3300031616|Ga0307508_10029083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae4995Open in IMG/M
3300031616|Ga0307508_10134722All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb32073Open in IMG/M
3300031616|Ga0307508_10201420Not Available1591Open in IMG/M
3300031616|Ga0307508_10426605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus917Open in IMG/M
3300031616|Ga0307508_10556384Not Available745Open in IMG/M
3300031649|Ga0307514_10015111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6380Open in IMG/M
3300031649|Ga0307514_10020052All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb35461Open in IMG/M
3300031649|Ga0307514_10022866All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5075Open in IMG/M
3300031649|Ga0307514_10036156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3926Open in IMG/M
3300031649|Ga0307514_10038183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3797Open in IMG/M
3300031649|Ga0307514_10038225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3795Open in IMG/M
3300031649|Ga0307514_10051512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3189Open in IMG/M
3300031649|Ga0307514_10055641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3039Open in IMG/M
3300031649|Ga0307514_10153026All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb31543Open in IMG/M
3300031730|Ga0307516_10005510Not Available15103Open in IMG/M
3300031730|Ga0307516_10048775All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb34165Open in IMG/M
3300031730|Ga0307516_10054092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3923Open in IMG/M
3300031730|Ga0307516_10065437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3510Open in IMG/M
3300031730|Ga0307516_10093715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides2828Open in IMG/M
3300031730|Ga0307516_10214857All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb31635Open in IMG/M
3300031730|Ga0307516_10385718All Organisms → Viruses → Predicted Viral1062Open in IMG/M
3300031730|Ga0307516_10410062Not Available1013Open in IMG/M
3300031838|Ga0307518_10113450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1928Open in IMG/M
3300031838|Ga0307518_10290628Not Available1002Open in IMG/M
3300031838|Ga0307518_10467174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa666Open in IMG/M
3300032354|Ga0325403_1000736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida24748Open in IMG/M
3300032354|Ga0325403_1003257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta14754Open in IMG/M
3300032354|Ga0325403_1003356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta14581Open in IMG/M
3300032354|Ga0325403_1004020All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida13585Open in IMG/M
3300032354|Ga0325403_1004145All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus13436Open in IMG/M
3300032354|Ga0325403_1004965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta12463Open in IMG/M
3300032354|Ga0325403_1006162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida11384Open in IMG/M
3300032354|Ga0325403_1006374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus11226Open in IMG/M
3300032354|Ga0325403_1006911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida10832Open in IMG/M
3300032354|Ga0325403_1007519Not Available10422Open in IMG/M
3300032354|Ga0325403_1009032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9515Open in IMG/M
3300032354|Ga0325403_1011782Not Available8290Open in IMG/M
3300032354|Ga0325403_1013720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7610Open in IMG/M
3300032354|Ga0325403_1022119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5696Open in IMG/M
3300032354|Ga0325403_1024237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae5340Open in IMG/M
3300032354|Ga0325403_1028051Not Available4804Open in IMG/M
3300032354|Ga0325403_1030708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae4500Open in IMG/M
3300032354|Ga0325403_1031655All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4393Open in IMG/M
3300032354|Ga0325403_1036228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3933Open in IMG/M
3300032354|Ga0325403_1036228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3933Open in IMG/M
3300032354|Ga0325403_1038665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3723Open in IMG/M
3300032354|Ga0325403_1040135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max3607Open in IMG/M
3300032354|Ga0325403_1040150All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3606Open in IMG/M
3300032354|Ga0325403_1044162All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3308Open in IMG/M
3300032354|Ga0325403_1046961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3121Open in IMG/M
3300032354|Ga0325403_1047663Not Available3076Open in IMG/M
3300032354|Ga0325403_1048049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3050Open in IMG/M
3300032354|Ga0325403_1081132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1632Open in IMG/M
3300032355|Ga0325401_1000587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida27263Open in IMG/M
3300032355|Ga0325401_1004383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13292Open in IMG/M
3300032355|Ga0325401_1011588Not Available8504Open in IMG/M
3300032355|Ga0325401_1024953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida5439Open in IMG/M
3300032355|Ga0325401_1025317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5385Open in IMG/M
3300032355|Ga0325401_1034436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4329Open in IMG/M
3300032355|Ga0325401_1036423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4148Open in IMG/M
3300032355|Ga0325401_1038908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3938Open in IMG/M
3300032355|Ga0325401_1047508All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb33347Open in IMG/M
3300032355|Ga0325401_1078601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2071Open in IMG/M
3300032374|Ga0325400_1003553Not Available14129Open in IMG/M
3300032374|Ga0325400_1024620All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida5580Open in IMG/M
3300032374|Ga0325400_1046607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3625Open in IMG/M
3300032374|Ga0325400_1047791Not Available3560Open in IMG/M
3300032374|Ga0325400_1088416All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2124Open in IMG/M
3300032374|Ga0325400_1133840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis1394Open in IMG/M
3300032389|Ga0325405_1000222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus53340Open in IMG/M
3300032389|Ga0325405_1001041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida27915Open in IMG/M
3300032389|Ga0325405_1001058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae27773Open in IMG/M
3300032389|Ga0325405_1001398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus24487Open in IMG/M
3300032389|Ga0325405_1002420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta19205Open in IMG/M
3300032389|Ga0325405_1002425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida19190Open in IMG/M
3300032389|Ga0325405_1003743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15623Open in IMG/M
3300032389|Ga0325405_1009217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9688Open in IMG/M
3300032389|Ga0325405_1013248All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7790Open in IMG/M
3300032389|Ga0325405_1013797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7582Open in IMG/M
3300032389|Ga0325405_1016005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6869Open in IMG/M
3300032389|Ga0325405_1017939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6351Open in IMG/M
3300032389|Ga0325405_1019718Not Available5941Open in IMG/M
3300032389|Ga0325405_1022352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5399Open in IMG/M
3300032389|Ga0325405_1031634Not Available4046Open in IMG/M
3300032389|Ga0325405_1034116Not Available3776Open in IMG/M
3300032390|Ga0325404_1000104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta77340Open in IMG/M
3300032390|Ga0325404_1002204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida20860Open in IMG/M
3300032390|Ga0325404_1007883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta11053Open in IMG/M
3300032390|Ga0325404_1028618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4459Open in IMG/M
3300032390|Ga0325404_1036181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana3565Open in IMG/M
3300032390|Ga0325404_1040841Not Available3115Open in IMG/M
3300032735|Ga0325410_1031332Not Available4247Open in IMG/M
3300032740|Ga0325411_1000061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus94987Open in IMG/M
3300032740|Ga0325411_1021537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5851Open in IMG/M
3300032741|Ga0325414_1001613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta22043Open in IMG/M
3300032741|Ga0325414_1005569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13337Open in IMG/M
3300032741|Ga0325414_1026073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix viminalis5241Open in IMG/M
3300033160|Ga0325402_1000272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus32436Open in IMG/M
3300033160|Ga0325402_1005766Not Available11634Open in IMG/M
3300033160|Ga0325402_1007161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10571Open in IMG/M
3300033160|Ga0325402_1014725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7245Open in IMG/M
3300033160|Ga0325402_1024024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5332Open in IMG/M
3300033160|Ga0325402_1048330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2993Open in IMG/M
3300033179|Ga0307507_10007236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa16304Open in IMG/M
3300033179|Ga0307507_10021231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7237Open in IMG/M
3300033179|Ga0307507_10031489Not Available5567Open in IMG/M
3300033179|Ga0307507_10046899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida4229Open in IMG/M
3300033179|Ga0307507_10057619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3657Open in IMG/M
3300033179|Ga0307507_10062900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3441Open in IMG/M
3300033179|Ga0307507_10074616All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb33040Open in IMG/M
3300033179|Ga0307507_10084199Not Available2774Open in IMG/M
3300033179|Ga0307507_10257764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1117Open in IMG/M
3300033179|Ga0307507_10282757Not Available1035Open in IMG/M
3300033180|Ga0307510_10017661Not Available8407Open in IMG/M
3300033180|Ga0307510_10019511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7951Open in IMG/M
3300033180|Ga0307510_10025948Not Available6749Open in IMG/M
3300033180|Ga0307510_10026514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6657Open in IMG/M
3300033180|Ga0307510_10036476Not Available5470Open in IMG/M
3300033180|Ga0307510_10068065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3578Open in IMG/M
3300033180|Ga0307510_10082755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3103Open in IMG/M
3300033180|Ga0307510_10103924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2616Open in IMG/M
3300033180|Ga0307510_10130543Not Available2187Open in IMG/M
3300033180|Ga0307510_10253802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1244Open in IMG/M
3300033180|Ga0307510_10259617All Organisms → Viruses → Predicted Viral1219Open in IMG/M
3300033180|Ga0307510_10416087Not Available786Open in IMG/M
3300034688|Ga0325420_016446All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6324Open in IMG/M
3300034688|Ga0325420_037323Not Available3413Open in IMG/M
3300034689|Ga0325421_000349All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida43679Open in IMG/M
3300034689|Ga0325421_004577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13741Open in IMG/M
3300034689|Ga0325421_010630Not Available8521Open in IMG/M
3300034689|Ga0325421_017051All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. Kb36242Open in IMG/M
3300034689|Ga0325421_019062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5771Open in IMG/M
3300034778|Ga0325423_008840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus10125Open in IMG/M
3300034778|Ga0325423_023023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera5207Open in IMG/M
3300034778|Ga0325423_023259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5166Open in IMG/M
3300034778|Ga0325423_042881Not Available2849Open in IMG/M
3300034899|Ga0325407_000994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta28470Open in IMG/M
3300034899|Ga0325407_002090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida20671Open in IMG/M
3300034899|Ga0325407_051218Not Available2468Open in IMG/M
3300034899|Ga0325407_121990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa670Open in IMG/M
3300034901|Ga0325409_008100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10982Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza60.17%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem33.90%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf5.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034778Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M
3300034901Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307517_1001054373300028786EctomycorrhizaMIITYVNNKSSSFHSTNVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307517_1001250763300028786EctomycorrhizaMIIIYVNNKSSSFHRIGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307517_1001516183300028786EctomycorrhizaMIITYVNNKSSSFHSIGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307517_1001885663300028786EctomycorrhizaMVITYVNNKSSSFQSTGVGYTIQLGYESAKYLLYQGLFNTNLD
Ga0307517_1002303813300028786EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLE
Ga0307517_1003013313300028786EctomycorrhizaMIITYVNNKSSSFHSTGIGYTIRLGYESAKYLLYQGLYNINLD
Ga0307517_1003127573300028786EctomycorrhizaMIITYINNKSSSFHSIGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307517_1003564963300028786EctomycorrhizaMIITYVNNKSSSFHNTGVSYTKRLGYESAKYLLYQGLYNINLD
Ga0307517_1003931323300028786EctomycorrhizaMIITYVNNKSSSFYSTCVDYTIRLGYESAKYLLYQGLYNINLD
Ga0307517_1004105713300028786EctomycorrhizaMLSVFMIITYINNKSSSFHSKGVSYTIRLGYESAKYLLYQWLHNINLD
Ga0307517_1004519033300028786EctomycorrhizaMIITYVNNKSSSFHSTSVGYTIRLGYESAKYLLYQG
Ga0307517_1004978133300028786EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQGLYNINLD
Ga0307517_1005263713300028786EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYN
Ga0307517_1005419373300028786EctomycorrhizaMVITYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQGLF
Ga0307517_1006367313300028786EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIQLGYKSVKYLLYQGLYNINLD
Ga0307517_1006414663300028786EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNIN
Ga0307517_1007214413300028786EctomycorrhizaMVITYVNNKSSSFHNTGVGYIIQLGYESAKYLLYQGLYNINLD
Ga0307517_1008060013300028786EctomycorrhizaMIITYVNNKSSSFHSSGVGYTIQLGYESAKYLLYQVLYNINLD
Ga0307517_1011042243300028786EctomycorrhizaMIITYVNNKSSSFHSTCVGYTMRLDYESAKYLLYQGL
Ga0307517_1011046933300028786EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307517_1022743813300028786EctomycorrhizaKSSSFHSIGVGYTIRLGYESAKYLLYQELYNINLD
Ga0307517_1029285313300028786EctomycorrhizaFMMLTYVNNKLSSFHSTGVGYTIRLGYESAKHLLYQVLYNTNLD
Ga0307517_1035324913300028786EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESVKYLLYQGLYN
Ga0307517_1039041013300028786EctomycorrhizaMIITYVNNKSSSFHSIGVGYTIRLGYESAKYLLYQ
Ga0307515_10005156103300028794EctomycorrhizaMIITYVNNKXSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307515_10012614163300028794EctomycorrhizaMIITYVNNKSSSFHNTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307515_10014156143300028794EctomycorrhizaMIITYVNNKSSFFHNTGVGYTIRLGYESAKYLLYQVLYNINLD
Ga0307515_10022663183300028794EctomycorrhizaMIITYVNNKSSSFHSTGVDYTILLDYESAKYLLYQGLDNINLD
Ga0307515_10024577103300028794EctomycorrhizaMIITYVNNKSSFFHSTGVGYTIRLGYESATYLFYQGLYNINLD
Ga0307515_1004377213300028794EctomycorrhizaITYVNNKSSSFYSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307515_1005113573300028794EctomycorrhizaMIITYINNKSSSFHSTCVGYTLRLGYESAKYLLYQGLYNLNLD
Ga0307515_1005661353300028794EctomycorrhizaMMLIYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQGL
Ga0307515_1005681813300028794EctomycorrhizaMIITYINNKSSSFHSKGVSYTIRLGYESAKYLLYQGLYNINLD
Ga0307515_1005697453300028794EctomycorrhizaMLLIYVSNKSSSFHSTGVGYTIPLGYESAKYLLYQGLYNINLD
Ga0307515_1011218483300028794EctomycorrhizaMIITYVNNKSSSFRSTGVGYTIRLDYESAKYLLYQGLY
Ga0307515_1011391833300028794EctomycorrhizaMLTYVNNKSSSFHSTGVGYTIRLGYESAKHLLYQVLYNTNLD
Ga0307515_1013867813300028794EctomycorrhizaMVITYVNKSSSFHSTGVGNTIQLGYESVKYLLYQGLFKTNLD
Ga0307515_1017072213300028794EctomycorrhizaMIITYVNKKLSFFYSTSVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307515_1018859313300028794EctomycorrhizaFMIITYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQGLYNINLD
Ga0307515_1019011413300028794EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINL
Ga0307515_1019443813300028794EctomycorrhizaMLTYVNNKSSSFHSTGVGYTIWLGYESAKHFLYQVLYN
Ga0307511_1001666573300030521EctomycorrhizaMIITYVNNKSSSFHSIGVDYTLQLGYESAKYLLYQELYNINLD
Ga0307511_1001872613300030521EctomycorrhizaMMLTYVNNKSSSFHSTGVGYESAKYLLYQRLYNTNLDSFNKQGIKN
Ga0307511_1002780443300030521EctomycorrhizaMLTYVNKKSSSFHSIGVGYTIRLGYESAKHLLYQVLYNT
Ga0307511_1005730913300030521EctomycorrhizaMVITYANNNSSSFYSTGVGYTIQLGYESAKYLFYQGLFNTNLD
Ga0307511_1006525213300030521EctomycorrhizaMIITYVNNKSSSFHNTGVGYTKRLGYESAKYLLYQGLYNINLD
Ga0307511_1008428213300030521EctomycorrhizaMMLAYVNKKSSSFYSTGVRYTIRLGYKSAKYLLYQVLYNTDLD
Ga0307511_1020479423300030521EctomycorrhizaMLQEFMIITYVKNKSSSFHSTRVGYTIRLGYESAKYLLYQGLY
Ga0307511_1024174213300030521EctomycorrhizaMMLTYVNNKSSSFHSTGVGYTIRLSYESAKHLLYQVLYNTNLD
Ga0307511_1026025813300030521EctomycorrhizaMIITYVNNKSSFFHSTGVGYTIRLGYESATYLFYQGL
Ga0307512_1005649313300030522EctomycorrhizaMMLTYVNNKSSSFHSTGVGYTIRLGYESAKHLLYQVLYNANLD
Ga0307512_1007451323300030522EctomycorrhizaMIITYVNSKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307512_1009793113300030522EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNI
Ga0307512_1018365513300030522EctomycorrhizaMIITVNNKSSFFHSTGVDYTIWLGYESAKYLLYQG
Ga0307512_1023790913300030522EctomycorrhizaMLIYVNNKSSSFHSIGVGYTIQLGYESAKYLLYQG
Ga0307512_1028491213300030522EctomycorrhizaMLIYVNNKSSSFQSTGVGYTIKLGYESAKYLLYQGLYN
Ga0307512_1038854313300030522EctomycorrhizaMIITYVDNKSSSFHSTCVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307513_10004187253300031456EctomycorrhizaMLTYVNNKSSSFHSIGVGYTIRLGYESAKHLLYQVLYNTDLD
Ga0307513_10008654113300031456EctomycorrhizaMIITYVNNKSSSFHNTGVGYSIRLGYESAKYLLYQGLYNINLD
Ga0307513_10012721103300031456EctomycorrhizaMIITYVNNKSSSFHSAGVGYTIRLGYESVKYLLYQGLYNINLD
Ga0307513_1001476613300031456EctomycorrhizaMMLIYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQGLYNINLD
Ga0307513_1001719663300031456EctomycorrhizaMLTYINNKSSSFHSTGVGYTIRLGYESAKHLLYQVLYKTNLD
Ga0307513_1002930713300031456EctomycorrhizaMLSGIHDVNNKSSSFHNTGVGYTVQLGYESAKYLLYQGLYNINLD
Ga0307513_1004944663300031456EctomycorrhizaMLQVFMILTYVNNKSSSFHSTGFGYTIRLGYESAKYLLYQGLYNINLD
Ga0307513_1005514543300031456EctomycorrhizaMLIYVNNKSSSFHSTGVGYTIKLGYESAKYLLYQGLYNINLD
Ga0307513_1005812723300031456EctomycorrhizaMLTYVNNKSSSFHSTGVGYTIWLGYESAKHLLYQVLYNPNLD
Ga0307513_1006002023300031456EctomycorrhizaMMLIYVNNKSSSFHSIGVGYTIQLGYESARYLLYQGLYNINLD
Ga0307513_1006452613300031456EctomycorrhizaMIITYVNKKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307513_1009532013300031456EctomycorrhizaMMITYVNNKSSSFHNTGVDYTIQLGYESAKYLLYQWLYNINLD
Ga0307513_1009796323300031456EctomycorrhizaMIISYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307513_1010389253300031456EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNIYLD
Ga0307513_1010751543300031456EctomycorrhizaMVITYVNNKSSSFHSIGVGYTIQLGYESAKYLLSQGLFNTNLD
Ga0307513_1013616433300031456EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESEKYLLYQELYNLNID
Ga0307513_1021190723300031456EctomycorrhizaMIITYVNNKSSSFHNTGVGYTIRLGYESAKYLLYQGLDNINLD
Ga0307513_1021208513300031456EctomycorrhizaMLTYVNNKSSSFHSTGVGYESAKYLLYQRLYNTNLDSFNKQGIKN
Ga0307513_1026227413300031456EctomycorrhizaMLTYVNNKSSSFHSIGVGYTIRLGYESVKHLLYQVLYNTNL
Ga0307513_1062660013300031456EctomycorrhizaMMLIYVNNKSSSFHSTSVGYTIQLGYESAKYLLCQDLY
Ga0307509_1001356213300031507EctomycorrhizaMMLIYVNNKASSFHSTGVGYTIQLGYESAKYLLYQGLFNTNL
Ga0307509_1002479263300031507EctomycorrhizaMIITYVNNKSSSFHSTCVGYTMRLDYESAKYLLYQVLYNINLD
Ga0307509_1002606023300031507EctomycorrhizaMMLIYVNNKSSSSHNNDVGRRLXRIKHLLYQVLYNTNLDLSFNKQSIIN
Ga0307509_1002647933300031507EctomycorrhizaMLTYVNNKSSSFHSTGVGNTIRLRYESAKHLLYQMLYNTNLD
Ga0307509_1005207753300031507EctomycorrhizaMLQVFMILTYVNNKSSSFHSTGFGYTIRLGYESAKYLLCQGLYNINLD
Ga0307509_1006633723300031507EctomycorrhizaMVITYVNNKSSSFHSTSVGYTIQLGYESAKYLLYQGLFNTNLD
Ga0307509_1008171313300031507EctomycorrhizaMIITYVNNKSSSFHSIGVGYTIRLGYESAKYLLYQELDNINLD
Ga0307509_1016698013300031507EctomycorrhizaMMLTYVNNKSSSFHNTVVGYTIRLGYESAKHLLYQVLYNTNLD
Ga0307509_1021676913300031507EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGL
Ga0307509_1032360113300031507EctomycorrhizaMMLTYVNNKSSFFHNTGVGYTIRLGYESVKHLLYQLLDNTNLN
Ga0307509_1037355613300031507EctomycorrhizaITYVNNKSSSFHSIGVDYTIQLGYESAKYLLYQGLYNINLD
Ga0307509_1037502913300031507EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQ
Ga0307509_1046426913300031507EctomycorrhizaNNKSSSFHSTGVGYTIRLGYESAKYLFYQGLYNINLD
Ga0307509_1075983413300031507EctomycorrhizaMIITYVNNKSSSFHITSVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307508_1000568993300031616EctomycorrhizaFMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307508_1000849573300031616EctomycorrhizaMITYVNNKSNSFHNTGVGYTIQLGYESAKYLLYQRLFNTNLD
Ga0307508_1002063043300031616EctomycorrhizaMIITYINNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307508_1002559943300031616EctomycorrhizaMMLSYVNNKSSSFHSTCVGYTIRLGYESAKHLLYQMLYNTNLD
Ga0307508_10029083123300031616EctomycorrhizaMIITYVNNKSSSFHSTDVGYTIRLGYESAKYLLYQELYNINLD
Ga0307508_1013472223300031616EctomycorrhizaVFMIITYVNKKLSFFHSTGIGYTIRLGYESAKYLLYQGLYNINLD
Ga0307508_1020142013300031616EctomycorrhizaMIITYINNKSSSFHSTCVGYTIRLGYESAKYLLYQ
Ga0307508_1042660513300031616EctomycorrhizaMLQEFMIITYVKNKSSSFHSTRVGYTIRLGYESAKYLLYQRLYNINLD
Ga0307508_1055638413300031616EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLY
Ga0307514_10015111113300031649EctomycorrhizaMIITYVNSKSSSFHSTGVGYTIQLGYESAKYLLYQGLYNINLD
Ga0307514_1002005213300031649EctomycorrhizaMIITYVNNKSSSFHNTCVDYTKRLGYESAKYLLYQGLYNINLD
Ga0307514_1002286613300031649EctomycorrhizaMIITYVNNKSSSFYSTCVGYTIRLGYESAKYLLYQVLYNINLD
Ga0307514_1003615613300031649EctomycorrhizaMVITYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQG
Ga0307514_1003818313300031649EctomycorrhizaMIITYVNNKLSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307514_1003822533300031649EctomycorrhizaMLTYVNNKSSSFHSTGVGYTIQLDYESAKYLLYQGLFNTNLD
Ga0307514_1005151273300031649EctomycorrhizaMIITYVNNKSSSFRSTGVGYTIRLDYESAKYLLYQGLYNINLD
Ga0307514_1005564113300031649EctomycorrhizaMMLIYVNNKSSSFHSTGIGYTIQLGYESAKYLLYQGLYNLNLD
Ga0307514_1015302613300031649EctomycorrhizaMMLTYVNNKSSSFHSTGVDYTIRLGYESAKHLLYQVLYNTNLD
Ga0307516_10005510173300031730EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLDYKSVKYLLYQGLYNINLD
Ga0307516_1004877523300031730EctomycorrhizaMIISYVNNKSSSFHSTGIGYTIRLGYESAKYLLYQGLYNINLD
Ga0307516_10054092103300031730EctomycorrhizaMVITYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQGLFN
Ga0307516_1006543713300031730EctomycorrhizaMIITYVNTKSSSFHSTGVGYTIRLGYKSAKYLLYQGLYNINLD
Ga0307516_1009371533300031730EctomycorrhizaMIITYVNNKSSFFHSIGVGYTIRLGYESANYFLYQGLYNINLD
Ga0307516_1021485713300031730EctomycorrhizaMIITYVNNKSSFFHSTGVGYTIRLGYESAKYLLYQELYNINLD
Ga0307516_1038571813300031730EctomycorrhizaMIITYVNNKSSSFHSTCVGYTMRLDYESAKYLLYQGLYNINLD
Ga0307516_1041006223300031730EctomycorrhizaMIITYVNNKSSSFHSTSVGYTIRLGYESAKYLLYQGLYNI
Ga0307518_1011345013300031838EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIWLGYESAKYLLYQGLYNINLD
Ga0307518_1029062813300031838EctomycorrhizaAFMIITYVNNKSSSFHSTGVGYTIRLGYENAKYLLYQGLYNISLD
Ga0307518_1046717413300031838EctomycorrhizaMIITYVNNKSSSFHSTGVDYTIRLGYESAKYLLYQGLYNIN
Ga0325403_1000736183300032354XylemMIIIYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0325403_100325793300032354XylemMIITYVNNKSSSFHSTGVDYTIRLGYESAKYLLYQGLYNMNLD
Ga0325403_100335683300032354XylemMIITYVNNKSSSFHSTGVGYTIWLGYESAKYLLYQELYNINLD
Ga0325403_100402093300032354XylemMIITYVNNKSSSFHSTGVDYTIWLGYESAKYLLYQGLYNINLD
Ga0325403_1004145193300032354XylemMIITYVKNKSSSFYSTGVGYTIQLGYESAKYLLYQGLYNINLD
Ga0325403_1004965123300032354XylemMVISYVNNKSSFFYSTDVGYTIQLGYESAKYLLYQGLFNTNLD
Ga0325403_100616213300032354XylemMMLIYVNNKSSSFHTTGVGYTIQLGYESAKYLLHQGLYNINLD
Ga0325403_100637433300032354XylemMILTYVNNKSSFFHSTGVGYTIQLGYESAKYLLYQGLYNINLD
Ga0325403_1006911103300032354XylemMMLIYVNNKSSSFHSTGVGYTIQLGYESAKYLLHQGLYNINLD
Ga0325403_100751953300032354XylemMVITYVNNKSSSFHSIDVGYIIQLGYESAKYLLCQGLLNTNLD
Ga0325403_100903233300032354XylemMMLTDVNNKSSSFHSPSVGNTIRLGYESAKHLLYQVLYYTNLD
Ga0325403_101178273300032354XylemMIITYVNNKSSFFDSTGVDYTIRLGYESAKYLLYQGLYNINLD
Ga0325403_101372053300032354XylemMMLIYVNTKSSSFHSIGVGYTIQLSYESAKYLLCQVFKLYNINLD
Ga0325403_102211933300032354XylemMIITYVNNKSSSFHNIGVGYTIRLGYENAKYLLYQGLYNINLD
Ga0325403_102423713300032354XylemMMLTYVNNKSSSFPSTGVGYTNTVGYESAKYLLYQGLYNINLD
Ga0325403_102805113300032354XylemMIITYVNNKSSSFHSTGVGHTIRLGYESAKYLLYQGLYNINLD
Ga0325403_103070843300032354XylemMIITYVNNKSSSFHNTGDGYTIQLGYESAKYLLYQGLYNINLD
Ga0325403_103165533300032354XylemMIITYVNNKSSSFHSTSVGYTIRLGYESAKYLLYQGLYNINLD
Ga0325403_103622853300032354XylemMIITYVNNNSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0325403_103622863300032354XylemMIITYVNNNSSSFHSTGVGYTIRLGYESAKYLLYQGLYNIKEVPIRYC
Ga0325403_103866523300032354XylemMIITYVHNNSSFFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0325403_104013513300032354XylemMMLIYVNNKSSSFHSTSVGYIIQLGYESAKYLLYQGLYNINLD
Ga0325403_104015023300032354XylemMMLTYVNNKSSSFHSIGVSYTIQLSYESAKHLLYQVLYNTNLD
Ga0325403_104416253300032354XylemMIITYVNNKSSSFHSTSVGYTIQLGYESAKYLLYQGLYNINLN
Ga0325403_104696143300032354XylemMIITYVNNTSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0325403_104766323300032354XylemMMLIYVTNKSSSFQRIGVGYTIQLGYESAKYLLYQGLYD
Ga0325403_104804983300032354XylemMIITYVNNKSSFFYSTGVGYTIQLGYENAKYLLYQGLYNINLD
Ga0325403_108113213300032354XylemMIITYINNKSSFFYSTGVGYTIRLGYESDKYLLYQGLYNINLD
Ga0325401_100058733300032355XylemMIITYANNKLSSSHSTSVGYTIRLGYESAMYLLYQGLYNINLD
Ga0325401_1004383103300032355XylemMIITYVNNKSSSFDSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0325401_101158863300032355XylemMIITYVNNKSSSFHSTGVGYTIRLVYESAKYLLYQGLYNINLD
Ga0325401_102495383300032355XylemMIITYVNNKSNSFHSTSVGYTIWLGYESAKYLLYQGLYNINLD
Ga0325401_102531723300032355XylemMIITYLNNKSSSIHSTGVGYTIRLGYESAKYLLYQELYNINLD
Ga0325401_103443613300032355XylemMIITYVNNKSSSFHSIGVGYTYDWGYESVKYLLYLGYTT
Ga0325401_103642313300032355XylemMIITYANNKSSSFHSTSVSYTIWLGYESAKYLLYQGLYNINLD
Ga0325401_103890813300032355XylemMIITYVNNKSSSFHSTGVGYTIRLGYKNAKYLLYQGLYNINLD
Ga0325401_104750833300032355XylemMIITYVNNKSSSFYSTDVGYTIRLGYESAKYLLYQGLYNINLD
Ga0325401_107860113300032355XylemMIITYVNNKSSSFHSTGVSYTIRLGYESTKYLLYQGFYNINL
Ga0325400_100355373300032374XylemMCQAFMIITYVNNKSSSFHSTGVDYTIRLGYESAKYLLYQGLYNINLD
Ga0325400_102462023300032374XylemMLTYVNNKSSSFHSTGVGYTIHLGYESAKHLLYQVLYNIDLD
Ga0325400_104660713300032374XylemMIITYVNNKSNSFHSTGDDYTIRLGYESAKYLLYQGLYNINLD
Ga0325400_104779113300032374XylemMLIYVNTKSSSFHSIGVGYTIQLSYESAKYLLCQVF
Ga0325400_108841613300032374XylemMIITYINNKSSSFHSTSVGYTIQLGYEIAKYLLYQGLYNINLD
Ga0325400_113384043300032374XylemMIITYVNNKSSSFHSTCVGYTIQLGYESAKYLLYQGLYNI
Ga0325405_100022223300032389XylemMMLIYVTSKSSSFQRIGVGYTIQLGYESAKYLLYQGLYNINLD
Ga0325405_1001041143300032389XylemMMLIYVNNKSSFFYNTSVGYTILLGYESAKYLLCQWLYNINLD
Ga0325405_1001058223300032389XylemMIITYVNNKSSSFLSTGVGYTIRLGYESVKYLLYKGLYNINLD
Ga0325405_100139883300032389XylemMIITYVNNKSSSFHSISGGYTIRLGYESAKYLLYQGLYNINLD
Ga0325405_1002420143300032389XylemMMLTYVNNKSSSFHITGVGYTIRLGYESAKHLLYQVLY
Ga0325405_1002425113300032389XylemMTLTYVNNKSSSFHITGVGYTIRLGYESAKHLLYQVLY
Ga0325405_100374323300032389XylemMMLTDVNNKSSSFHSPGVGNTIRLGYESAKHLLYQVLYYTNLD
Ga0325405_100921733300032389XylemMIITYVNNKSSSFHSTGIGYTIRLGYKSAKYLLYLLENNINHILGPHLKA
Ga0325405_101324893300032389XylemMMLTYVNNKSSSFHSIGVGYTMRLGYVSAKHLLYLVLYNTNID
Ga0325405_101379743300032389XylemMMLTYVNNKSSSFHSTCIGYTIRLSYESAKHLLYQVLYNTNLD
Ga0325405_101600583300032389XylemMMLIYVNTKSSSFHSIGVGYTIQLSYESAKYLLCQVFELYNINLD
Ga0325405_101793943300032389XylemMIITYVNNKSSSFHSVGVGYTIRLGYESAKYLLYQGLYNIV
Ga0325405_101971813300032389XylemMLTYVNNKLRSFHSTDVGYTIWLGYESAKHLLYQVLYNTDLD
Ga0325405_102235253300032389XylemMIITYVKNKSSSFYSTGVGYTIQLGCESAKYLLYQGLYNINLD
Ga0325405_103163473300032389XylemMIITYVNNKSNSFHSTGVGYTIRVGYKSTKYLWYQGLYNINLD
Ga0325405_103411673300032389XylemMLTYVNNESSSFHSTGVGYTIHLGYESAKHLLYEVLYNIDLD
Ga0325404_1000104383300032390XylemMIITYVNNKSSSFHSTCVGYTIQLGYESAKYLLYQGLYNINLD
Ga0325404_1002204133300032390XylemMLTDVNNKSSSFHSPGVGNTIRLGYESAKHLLYQVLYYANLD
Ga0325404_100788363300032390XylemMVITYVNNKSSSIHSTCIGYTIQLGYESAKYLLYQELFNTNLD
Ga0325404_102861833300032390XylemMIITYVNNKLNSFHSTTVGYTIRLGYESAKYLLYQELYNINLD
Ga0325404_103618123300032390XylemMIITYVNNKLSSFHSTGVGYTIQLGYESAKYLLYQ
Ga0325404_104084163300032390XylemMLTYANNESSSFQSTGVGYTIHLGYESAKHLLYQALYNIDLD
Ga0325410_103133213300032735XylemMVISYVNNKSSFFYSTDVGYTIQLGYESVKYLLYQGLFNTNLD
Ga0325411_100006183300032740XylemMIITYVNNKSSSFHSTGVGYTIRLGYENAKYLLYQGLYNINLD
Ga0325411_102153733300032740XylemMMLIYVNNKSSSFHSTNVSYIIQLGYESAKYLLYQGLYNINLD
Ga0325414_1001613113300032741LeafMIITYVDNKLSSFHSTSLGSTLRLGYESAKYLLYQGLYNINLD
Ga0325414_100556953300032741LeafMIITYVNNKSSSFLAHVSVIPYGLGYETAKYLLYQDYTT
Ga0325414_102607313300032741LeafMIITYVNNKSNSFHSTGDDYTIRLGYESIKYLLYQGLYNINLD
Ga0325402_1000272163300033160XylemMIITYVNNKSSSFHSTGVGYTIRLGYESVKYLLYQGLYNINLD
Ga0325402_100576623300033160XylemMIITYVNNKSSSFHSIGVGYIPYGLGYESAKYLLYQSYTT
Ga0325402_100716193300033160XylemMIITYVNNKSSSFHSTGVDYTIRLGYEGAMYLLYQGLYNINLD
Ga0325402_101472533300033160XylemMITYVNNKSSSFYSTGVGYTIQLGYESAKYLLYQGLFNINLD
Ga0325402_102402433300033160XylemMLIYVNTKSSSFHSIGVGYTIQLSYESAKYLLCQVFELYNINLD
Ga0325402_104833023300033160XylemMIITYINNISSSFQSTCVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307507_10007236183300033179EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQWLYNINLD
Ga0307507_1002123173300033179EctomycorrhizaMIITYVNNKSSSFHSTGVGYTVRFGYESAKYLLYQGLYNINLD
Ga0307507_1003148913300033179EctomycorrhizaMIITYVNNKSSFFHNTGVGYTIRLGYESVKYLLYQSLYNINLD
Ga0307507_1004689933300033179EctomycorrhizaMMLTYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQGLFNTNLD
Ga0307507_1005761913300033179EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIQLGYESVKYLLYQGLYNINLD
Ga0307507_1006290023300033179EctomycorrhizaMVIIYVNSKSSSFHSTGVGYTIQLGYESAKYLLYQGLFNTNLD
Ga0307507_1007461623300033179EctomycorrhizaMMITYVNSKSSSFHSTGVGYTIQLGYESAKYLLYQGLYNINLE
Ga0307507_1008419913300033179EctomycorrhizaMIITYFNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307507_1025776413300033179EctomycorrhizaMITYVNNKSSFFHSTGVGYTIQLGYESAKYLLYQGLYNI
Ga0307507_1028275713300033179EctomycorrhizaMMLTYVNNKSSSFHSTGVAYTTRLGYKSAKYLLYQG
Ga0307510_1001766143300033180EctomycorrhizaMMLTYINNKSSSFHSTGVGYTIRLGYESAKHLLYQVLYKTNLD
Ga0307510_1001951163300033180EctomycorrhizaMIITYVNNKSSSFYSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307510_1002594823300033180EctomycorrhizaMIITYVNSKSSSFHSTGVGYTIRLGYENAKYLLYQGLYNINLD
Ga0307510_1002651433300033180EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIQLGYESAKYLVYQGLYNINLD
Ga0307510_1003647623300033180EctomycorrhizaMIITYVNKKLSFFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0307510_1006806513300033180EctomycorrhizaMVITYVNNKSSSFHSTGVGYTIQLGYESAKYLLYKGLFNINLD
Ga0307510_1008275573300033180EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLDYESAKYLFYQGLYNINLD
Ga0307510_1010392413300033180EctomycorrhizaMVIAYVNNKSSSFHSTSVGYTIQLGYESAKYLLYQGLFNTNL
Ga0307510_1013054313300033180EctomycorrhizaMMLTYVNNKSSSFHSTGVAYTTRLGYKSAKYLLYLGL
Ga0307510_1025380213300033180EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYRGLYNINL
Ga0307510_1025961713300033180EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQG
Ga0307510_1041608713300033180EctomycorrhizaMIITYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQMLYNINLD
Ga0325420_016446_1_1233300034688LeafMIITYVNNKSSSFHSTGVGYTIQLGYESAKYLLYQGLYNIN
Ga0325420_037323_1_1233300034688LeafTYVNNKSSSFHSTGVGYTIRLGYESAKYLLYQGLYNINLD
Ga0325421_000349_15736_158673300034689LeafMIITYVNNKSSSFHSTGVDYTIRLGYESAKYLLYQGLYNINLD
Ga0325421_004577_113_2383300034689LeafMIITYVNNKSSSFHSSGVGYTIQYENAKYLLYQVLDNINLD
Ga0325421_010630_6704_68353300034689LeafMIITYVNNKSSSFHSTSVGYTMRLGYESAKYLLYQGLYNINLD
Ga0325421_017051_4626_47573300034689LeafMMLTYVNNKSSSFHSIGVGYTIQLGYESAKYLLYQWLYNINLD
Ga0325421_019062_685_8133300034689LeafMLTYVNNKSNSFHSTSVGYTIRLGYESVKHLLYQVLYNTDLD
Ga0325423_008840_6840_69713300034778LeafMIIIYVNNKSSSFHSTGVGYTIQLGYESVKYLLYQGLYNINLD
Ga0325423_023023_4485_46133300034778LeafMLIYVNNKSSSFYSTGVDYTIQLGYKSAKYFLYQGLYNINLD
Ga0325423_023259_2045_21763300034778LeafMMLIYVNNKSSSFHSTNVSYIIQFGYESAKYLLYQGLYNINLD
Ga0325423_042881_1069_12093300034778LeafMIITYVNNKSSSFHSTSVGYTIRLGYESAKYLLYQGLYNINLDLLL
Ga0325407_000994_13723_138543300034899XylemMIITYINNKSSSFHSTGVGYTIWLGYESAKYLLYQGLYNINLD
Ga0325407_002090_8735_88633300034899XylemMLTDVNNKSSSFHSPGVGNTIRLGYESAKHLLYQVLYYTNLD
Ga0325407_051218_2329_24663300034899XylemVFMIITYVNNKSSFFYSTGVGYTIQLGYENAKYLLYQGLYNINLD
Ga0325407_121990_3_1193300034899XylemMIITYVNNKSSFFYSTGVGYTIQLGYENAKYLLYQGLYN
Ga0325409_008100_9885_100163300034901XylemMVITYVNNKSSSFHSTGVGYTKQLGYESAKYLLYQWLFNTNLD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.