Basic Information | |
---|---|
Family ID | F017937 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 238 |
Average Sequence Length | 43 residues |
Representative Sequence | MKTIAKVIESMLTKDATQQWTGQTSAVQSRDVWSWGGFAD |
Number of Associated Samples | 137 |
Number of Associated Scaffolds | 237 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 65.13 % |
% of genes near scaffold ends (potentially truncated) | 37.39 % |
% of genes from short scaffolds (< 2000 bps) | 73.11 % |
Associated GOLD sequencing projects | 119 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.143 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (36.555 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.756 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (76.471 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 0.00% Coil/Unstructured: 79.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 237 Family Scaffolds |
---|---|---|
PF01966 | HD | 18.57 |
PF13490 | zf-HC2 | 11.81 |
PF08281 | Sigma70_r4_2 | 6.75 |
PF13487 | HD_5 | 2.11 |
PF02586 | SRAP | 1.27 |
PF00474 | SSF | 0.84 |
PF09055 | Sod_Ni | 0.42 |
PF00690 | Cation_ATPase_N | 0.42 |
PF00702 | Hydrolase | 0.42 |
PF02384 | N6_Mtase | 0.42 |
PF00275 | EPSP_synthase | 0.42 |
PF11755 | DUF3311 | 0.42 |
PF17147 | PFOR_II | 0.42 |
PF12679 | ABC2_membrane_2 | 0.42 |
PF07681 | DoxX | 0.42 |
PF03636 | Glyco_hydro_65N | 0.42 |
PF00484 | Pro_CA | 0.42 |
PF01548 | DEDD_Tnp_IS110 | 0.42 |
COG ID | Name | Functional Category | % Frequency in 237 Family Scaffolds |
---|---|---|---|
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.27 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.42 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.42 |
COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.42 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.42 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.42 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.14 % |
Unclassified | root | N/A | 42.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090004|P1_DRAFT_NODE_257239_len_651_cov_10_304148 | Not Available | 701 | Open in IMG/M |
2088090008|P3_DRAFT_NODE_326522_len_1179_cov_9_732824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1229 | Open in IMG/M |
2140918006|ConsensusfromContig113401 | Not Available | 634 | Open in IMG/M |
3300001385|JGI20193J14888_1003215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 4086 | Open in IMG/M |
3300001385|JGI20193J14888_1009574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium → Intrasporangium calvum | 2024 | Open in IMG/M |
3300001397|JGI20177J14857_1033740 | Not Available | 572 | Open in IMG/M |
3300001532|A20PFW1_1084443 | Not Available | 746 | Open in IMG/M |
3300001534|A15PFW1_10298918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 791 | Open in IMG/M |
3300001535|A3PFW1_10516112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 638 | Open in IMG/M |
3300001536|A1565W1_10114614 | Not Available | 868 | Open in IMG/M |
3300001870|JGI24129J20441_1073400 | Not Available | 674 | Open in IMG/M |
3300001871|JGI24133J20442_1008482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2945 | Open in IMG/M |
3300001871|JGI24133J20442_1080861 | Not Available | 580 | Open in IMG/M |
3300002066|JGIcombinedJ21911_10074877 | Not Available | 1067 | Open in IMG/M |
3300002069|JGIcombinedJ21912_10121114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 969 | Open in IMG/M |
3300002069|JGIcombinedJ21912_10225422 | Not Available | 616 | Open in IMG/M |
3300002162|JGI24139J26690_1019053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1299 | Open in IMG/M |
3300002515|JGI24144J35610_10137525 | Not Available | 559 | Open in IMG/M |
3300002538|JGI24132J36420_10157932 | Not Available | 575 | Open in IMG/M |
3300002549|JGI24130J36418_10003477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 5396 | Open in IMG/M |
3300002549|JGI24130J36418_10006869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 3778 | Open in IMG/M |
3300002549|JGI24130J36418_10094291 | Not Available | 692 | Open in IMG/M |
3300002550|JGI24131J36419_10043486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1326 | Open in IMG/M |
3300002564|JGI24134J36421_10025691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1848 | Open in IMG/M |
3300002564|JGI24134J36421_10154691 | Not Available | 503 | Open in IMG/M |
3300002569|JGI24136J36422_10022112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1998 | Open in IMG/M |
3300004778|Ga0062383_10035264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1885 | Open in IMG/M |
3300004778|Ga0062383_10225039 | Not Available | 876 | Open in IMG/M |
3300004780|Ga0062378_10098871 | Not Available | 718 | Open in IMG/M |
3300004780|Ga0062378_10100857 | Not Available | 713 | Open in IMG/M |
3300005045|Ga0071328_118707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 4679 | Open in IMG/M |
3300005045|Ga0071328_138772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 3840 | Open in IMG/M |
3300005938|Ga0066795_10028431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1620 | Open in IMG/M |
3300005938|Ga0066795_10100658 | Not Available | 860 | Open in IMG/M |
3300005947|Ga0066794_10045714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1294 | Open in IMG/M |
3300005947|Ga0066794_10062414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1107 | Open in IMG/M |
3300005947|Ga0066794_10246021 | Not Available | 537 | Open in IMG/M |
3300005994|Ga0066789_10000021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 39907 | Open in IMG/M |
3300005994|Ga0066789_10004424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 6179 | Open in IMG/M |
3300005994|Ga0066789_10019596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2994 | Open in IMG/M |
3300005994|Ga0066789_10029376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium → Intrasporangium calvum | 2436 | Open in IMG/M |
3300005994|Ga0066789_10104194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1217 | Open in IMG/M |
3300005994|Ga0066789_10110436 | Not Available | 1179 | Open in IMG/M |
3300006055|Ga0097691_1008473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium → Intrasporangium oryzae | 5330 | Open in IMG/M |
3300006055|Ga0097691_1017994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium | 3151 | Open in IMG/M |
3300006636|Ga0075525_10003792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3774 | Open in IMG/M |
3300006636|Ga0075525_10014522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1651 | Open in IMG/M |
3300006638|Ga0075522_10055206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2281 | Open in IMG/M |
3300006640|Ga0075527_10182128 | Not Available | 600 | Open in IMG/M |
3300006640|Ga0075527_10249226 | Not Available | 518 | Open in IMG/M |
3300006642|Ga0075521_10045873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1893 | Open in IMG/M |
3300006795|Ga0075520_1019132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Intrasporangium | 3428 | Open in IMG/M |
3300006795|Ga0075520_1153586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1003 | Open in IMG/M |
3300006864|Ga0066797_1257126 | Not Available | 609 | Open in IMG/M |
3300006949|Ga0075528_10011278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2148 | Open in IMG/M |
3300006949|Ga0075528_10016583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1813 | Open in IMG/M |
3300006949|Ga0075528_10038751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1220 | Open in IMG/M |
3300006949|Ga0075528_10048302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1094 | Open in IMG/M |
3300006949|Ga0075528_10156410 | Not Available | 611 | Open in IMG/M |
3300006950|Ga0075524_10035860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2016 | Open in IMG/M |
3300006950|Ga0075524_10052828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1686 | Open in IMG/M |
3300006950|Ga0075524_10094962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1270 | Open in IMG/M |
3300006950|Ga0075524_10107671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1194 | Open in IMG/M |
3300006950|Ga0075524_10108410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1190 | Open in IMG/M |
3300006950|Ga0075524_10218787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 830 | Open in IMG/M |
3300006950|Ga0075524_10353311 | Not Available | 647 | Open in IMG/M |
3300006950|Ga0075524_10366489 | Not Available | 634 | Open in IMG/M |
3300006950|Ga0075524_10413951 | Not Available | 595 | Open in IMG/M |
3300006950|Ga0075524_10425046 | Not Available | 587 | Open in IMG/M |
3300006950|Ga0075524_10536474 | Not Available | 521 | Open in IMG/M |
3300007740|Ga0104326_101239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1017 | Open in IMG/M |
3300007821|Ga0104323_107321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
3300009029|Ga0066793_10007364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 5666 | Open in IMG/M |
3300009029|Ga0066793_10367186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 828 | Open in IMG/M |
3300009029|Ga0066793_10424603 | Not Available | 762 | Open in IMG/M |
3300009029|Ga0066793_10486539 | Not Available | 706 | Open in IMG/M |
3300009029|Ga0066793_10864890 | Not Available | 512 | Open in IMG/M |
3300010862|Ga0126348_1010542 | Not Available | 632 | Open in IMG/M |
3300010880|Ga0126350_10310284 | Not Available | 677 | Open in IMG/M |
3300011971|Ga0120175_1000451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 12702 | Open in IMG/M |
3300011971|Ga0120175_1011889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1157 | Open in IMG/M |
3300011971|Ga0120175_1027287 | Not Available | 682 | Open in IMG/M |
3300011971|Ga0120175_1042530 | Not Available | 520 | Open in IMG/M |
3300011996|Ga0120156_1034940 | Not Available | 925 | Open in IMG/M |
3300011997|Ga0120162_1013857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus | 2806 | Open in IMG/M |
3300011997|Ga0120162_1017500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2359 | Open in IMG/M |
3300011997|Ga0120162_1035573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1337 | Open in IMG/M |
3300011997|Ga0120162_1058223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 906 | Open in IMG/M |
3300011997|Ga0120162_1063303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 849 | Open in IMG/M |
3300011997|Ga0120162_1064528 | Not Available | 838 | Open in IMG/M |
3300012005|Ga0120161_1015604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 3321 | Open in IMG/M |
3300012005|Ga0120161_1079138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 830 | Open in IMG/M |
3300012005|Ga0120161_1083228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 798 | Open in IMG/M |
3300012005|Ga0120161_1094150 | Not Available | 727 | Open in IMG/M |
3300012005|Ga0120161_1108424 | Not Available | 654 | Open in IMG/M |
3300012010|Ga0120118_1078751 | Not Available | 810 | Open in IMG/M |
3300012014|Ga0120159_1068945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1064 | Open in IMG/M |
3300012668|Ga0157216_10201021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 944 | Open in IMG/M |
3300012668|Ga0157216_10371562 | Not Available | 639 | Open in IMG/M |
3300012951|Ga0164300_10075288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
3300012955|Ga0164298_10445308 | Not Available | 850 | Open in IMG/M |
3300012958|Ga0164299_10212694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1127 | Open in IMG/M |
3300012960|Ga0164301_10459156 | Not Available | 908 | Open in IMG/M |
3300012987|Ga0164307_10566194 | Not Available | 870 | Open in IMG/M |
3300013427|Ga0120106_1042571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 861 | Open in IMG/M |
3300013758|Ga0120147_1011589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1836 | Open in IMG/M |
3300013766|Ga0120181_1125641 | Not Available | 560 | Open in IMG/M |
3300013772|Ga0120158_10241856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 909 | Open in IMG/M |
3300014490|Ga0182010_10071642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1691 | Open in IMG/M |
3300014498|Ga0182019_10102248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1755 | Open in IMG/M |
3300014502|Ga0182021_10054651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 4654 | Open in IMG/M |
3300014502|Ga0182021_11232967 | Not Available | 901 | Open in IMG/M |
3300014502|Ga0182021_12066137 | Not Available | 686 | Open in IMG/M |
3300014820|Ga0120160_1034864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 944 | Open in IMG/M |
3300014820|Ga0120160_1038090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 883 | Open in IMG/M |
3300014823|Ga0120170_1053367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 900 | Open in IMG/M |
3300014827|Ga0120171_1066212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1018 | Open in IMG/M |
3300015076|Ga0167656_1000064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16396 | Open in IMG/M |
3300015078|Ga0167660_1000055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 36989 | Open in IMG/M |
3300015079|Ga0167657_1012369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1169 | Open in IMG/M |
3300015086|Ga0167655_1019005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1185 | Open in IMG/M |
3300015086|Ga0167655_1049860 | Not Available | 624 | Open in IMG/M |
3300015163|Ga0167665_1000595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 11355 | Open in IMG/M |
3300015163|Ga0167665_1003759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus | 3277 | Open in IMG/M |
3300015167|Ga0167661_1054796 | Not Available | 745 | Open in IMG/M |
3300015189|Ga0167667_1001766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 7363 | Open in IMG/M |
3300015189|Ga0167667_1011001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2706 | Open in IMG/M |
3300015191|Ga0167659_1028171 | Not Available | 1198 | Open in IMG/M |
3300015194|Ga0167666_1001218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 9297 | Open in IMG/M |
3300015194|Ga0167666_1037452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1238 | Open in IMG/M |
3300015195|Ga0167658_1000184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 42344 | Open in IMG/M |
3300015195|Ga0167658_1000344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 27015 | Open in IMG/M |
3300015195|Ga0167658_1069290 | Not Available | 823 | Open in IMG/M |
3300015203|Ga0167650_1005444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus | 3762 | Open in IMG/M |
3300015203|Ga0167650_1028022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1510 | Open in IMG/M |
3300015208|Ga0167664_1008150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 3980 | Open in IMG/M |
3300015208|Ga0167664_1014845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2801 | Open in IMG/M |
3300015208|Ga0167664_1016720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus | 2617 | Open in IMG/M |
3300015208|Ga0167664_1036067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1682 | Open in IMG/M |
3300015208|Ga0167664_1039091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1605 | Open in IMG/M |
3300019785|Ga0182022_1010390 | Not Available | 1065 | Open in IMG/M |
3300019785|Ga0182022_1024443 | Not Available | 1571 | Open in IMG/M |
3300019785|Ga0182022_1106451 | Not Available | 1445 | Open in IMG/M |
3300025457|Ga0208850_1000233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 18958 | Open in IMG/M |
3300025461|Ga0208851_1026460 | Not Available | 1093 | Open in IMG/M |
3300025479|Ga0208588_1070432 | Not Available | 671 | Open in IMG/M |
3300025481|Ga0208079_1017334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 2274 | Open in IMG/M |
3300025481|Ga0208079_1033143 | Not Available | 1354 | Open in IMG/M |
3300025481|Ga0208079_1087576 | Not Available | 600 | Open in IMG/M |
3300025481|Ga0208079_1087916 | Not Available | 598 | Open in IMG/M |
3300025482|Ga0208715_1001044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 8018 | Open in IMG/M |
3300025495|Ga0207932_1005374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 4137 | Open in IMG/M |
3300025505|Ga0207929_1053268 | Not Available | 768 | Open in IMG/M |
3300025509|Ga0208848_1004760 | All Organisms → cellular organisms → Bacteria | 2718 | Open in IMG/M |
3300025509|Ga0208848_1054616 | Not Available | 848 | Open in IMG/M |
3300025544|Ga0208078_1023091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1397 | Open in IMG/M |
3300025544|Ga0208078_1090405 | Not Available | 624 | Open in IMG/M |
3300025650|Ga0209385_1029382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2151 | Open in IMG/M |
3300025650|Ga0209385_1073318 | Not Available | 1178 | Open in IMG/M |
3300025692|Ga0209744_1127887 | Not Available | 843 | Open in IMG/M |
3300025692|Ga0209744_1190886 | Not Available | 632 | Open in IMG/M |
3300025692|Ga0209744_1208723 | Not Available | 592 | Open in IMG/M |
3300025716|Ga0209746_1020647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2519 | Open in IMG/M |
3300025721|Ga0209587_1001533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 10801 | Open in IMG/M |
3300025725|Ga0209638_1012079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 4465 | Open in IMG/M |
3300025739|Ga0209745_1014364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3506 | Open in IMG/M |
3300025750|Ga0209747_1024074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2465 | Open in IMG/M |
3300025764|Ga0209539_1117893 | Not Available | 1055 | Open in IMG/M |
3300025764|Ga0209539_1249068 | Not Available | 631 | Open in IMG/M |
3300025764|Ga0209539_1286749 | Not Available | 569 | Open in IMG/M |
3300025829|Ga0209484_10001254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 4971 | Open in IMG/M |
3300025829|Ga0209484_10024350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1241 | Open in IMG/M |
3300025836|Ga0209748_1302893 | Not Available | 504 | Open in IMG/M |
3300025846|Ga0209538_1215516 | Not Available | 709 | Open in IMG/M |
3300025846|Ga0209538_1260678 | Not Available | 624 | Open in IMG/M |
3300025854|Ga0209176_10030239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1151 | Open in IMG/M |
3300025857|Ga0209014_10045269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1938 | Open in IMG/M |
3300025857|Ga0209014_10094052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1186 | Open in IMG/M |
3300025857|Ga0209014_10170688 | Not Available | 778 | Open in IMG/M |
3300025864|Ga0209429_10239708 | Not Available | 719 | Open in IMG/M |
3300025888|Ga0209540_10012400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 5296 | Open in IMG/M |
3300025888|Ga0209540_10116376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1633 | Open in IMG/M |
3300025888|Ga0209540_10178745 | Not Available | 1268 | Open in IMG/M |
3300025891|Ga0209585_10029368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2004 | Open in IMG/M |
3300025891|Ga0209585_10101540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1089 | Open in IMG/M |
3300026291|Ga0209890_10009470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3995 | Open in IMG/M |
3300026291|Ga0209890_10013082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3340 | Open in IMG/M |
3300026291|Ga0209890_10019363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2668 | Open in IMG/M |
3300026291|Ga0209890_10032283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1994 | Open in IMG/M |
3300027831|Ga0209797_10020010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3062 | Open in IMG/M |
3300027831|Ga0209797_10049673 | Not Available | 1872 | Open in IMG/M |
3300027831|Ga0209797_10231756 | Not Available | 779 | Open in IMG/M |
3300027840|Ga0209683_10053402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus | 1773 | Open in IMG/M |
3300027843|Ga0209798_10517020 | Not Available | 542 | Open in IMG/M |
3300028733|Ga0302261_1178839 | Not Available | 507 | Open in IMG/M |
3300028741|Ga0302256_10019493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1649 | Open in IMG/M |
3300028743|Ga0302262_10075173 | Not Available | 1163 | Open in IMG/M |
3300028856|Ga0302295_1016442 | Not Available | 1384 | Open in IMG/M |
3300028868|Ga0302163_10148535 | Not Available | 625 | Open in IMG/M |
3300028868|Ga0302163_10198474 | Not Available | 554 | Open in IMG/M |
3300028869|Ga0302263_10043343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1773 | Open in IMG/M |
3300028870|Ga0302254_10099582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1061 | Open in IMG/M |
3300029980|Ga0302298_10179399 | Not Available | 688 | Open in IMG/M |
3300029984|Ga0311332_10108691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2021 | Open in IMG/M |
3300029984|Ga0311332_10979117 | Not Available | 678 | Open in IMG/M |
3300029987|Ga0311334_10039324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus cremeus | 3334 | Open in IMG/M |
3300029987|Ga0311334_10290513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1275 | Open in IMG/M |
3300029987|Ga0311334_10439056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1042 | Open in IMG/M |
3300029989|Ga0311365_10417278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1161 | Open in IMG/M |
3300029989|Ga0311365_10772119 | Not Available | 832 | Open in IMG/M |
3300029990|Ga0311336_10045729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 3388 | Open in IMG/M |
3300029990|Ga0311336_10254987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1442 | Open in IMG/M |
3300030002|Ga0311350_10272089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1510 | Open in IMG/M |
3300030003|Ga0302172_10297129 | Not Available | 521 | Open in IMG/M |
3300030019|Ga0311348_10571812 | Not Available | 844 | Open in IMG/M |
3300030019|Ga0311348_11450382 | Not Available | 510 | Open in IMG/M |
3300030047|Ga0302286_10212550 | Not Available | 975 | Open in IMG/M |
3300030114|Ga0311333_10997636 | Not Available | 709 | Open in IMG/M |
3300030339|Ga0311360_11125300 | Not Available | 618 | Open in IMG/M |
3300030838|Ga0311335_10031740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus | 3237 | Open in IMG/M |
3300031521|Ga0311364_11416366 | Not Available | 687 | Open in IMG/M |
3300031673|Ga0307377_11108599 | Not Available | 524 | Open in IMG/M |
3300031726|Ga0302321_100252933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1866 | Open in IMG/M |
3300031902|Ga0302322_100095010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3087 | Open in IMG/M |
3300031902|Ga0302322_102972564 | Not Available | 583 | Open in IMG/M |
3300034126|Ga0370486_187009 | Not Available | 514 | Open in IMG/M |
3300034128|Ga0370490_0143614 | Not Available | 782 | Open in IMG/M |
3300034129|Ga0370493_0238595 | Not Available | 613 | Open in IMG/M |
3300034158|Ga0370507_0069771 | Not Available | 1077 | Open in IMG/M |
3300034170|Ga0370487_0136907 | Not Available | 797 | Open in IMG/M |
3300034257|Ga0370495_0001746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus | 6825 | Open in IMG/M |
3300034257|Ga0370495_0019049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 2043 | Open in IMG/M |
3300034257|Ga0370495_0170058 | Not Available | 696 | Open in IMG/M |
3300034281|Ga0370481_0004482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 3625 | Open in IMG/M |
3300034281|Ga0370481_0004482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 3625 | Open in IMG/M |
3300034652|Ga0316598_022591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1612 | Open in IMG/M |
3300034653|Ga0316599_027557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae | 1385 | Open in IMG/M |
3300034965|Ga0370497_0126188 | Not Available | 627 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 36.55% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 13.45% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 12.18% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 10.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 6.72% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 5.46% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 3.78% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 2.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.26% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.42% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
3300001385 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 | Environmental | Open in IMG/M |
3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
3300001532 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illumina | Environmental | Open in IMG/M |
3300001534 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illumina | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
3300001871 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 | Environmental | Open in IMG/M |
3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002162 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-21A | Environmental | Open in IMG/M |
3300002515 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A | Environmental | Open in IMG/M |
3300002538 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 | Environmental | Open in IMG/M |
3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
3300002550 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 | Environmental | Open in IMG/M |
3300002564 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 | Environmental | Open in IMG/M |
3300002569 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006636 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011971 | Permafrost microbial communities from Nunavut, Canada - A7_80cm_12M | Environmental | Open in IMG/M |
3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
3300012005 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013427 | Permafrost microbial communities from Nunavut, Canada - A15_35cm_18M | Environmental | Open in IMG/M |
3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014820 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0.25M | Environmental | Open in IMG/M |
3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300015076 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6a, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
3300015163 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout) | Environmental | Open in IMG/M |
3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015189 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine) | Environmental | Open in IMG/M |
3300015191 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-10 : a,b,c samples pooled, hydrological sediment from glacier outflow) | Environmental | Open in IMG/M |
3300015194 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout) | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015208 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface) | Environmental | Open in IMG/M |
3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025479 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
3300025716 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes) | Environmental | Open in IMG/M |
3300025721 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
3300025750 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes) | Environmental | Open in IMG/M |
3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300028733 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4 | Environmental | Open in IMG/M |
3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
3300028856 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4 | Environmental | Open in IMG/M |
3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034653 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_03R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P1_DRAFT_00995250 | 2088090004 | Soil | MKLIAKVIESMLSKDATQQWTGQTSAVASHSGWSWGGFSE |
P3_DRAFT_00448460 | 2088090008 | Soil | MTMKTIAKVIESMLTKDATQQWTGQTSAVASRGWTWGGFSDETTTVF |
P1_C_00709480 | 2140918006 | Soil | MRIIAKVIESMLSKDATQRWTGQTSAVQSNNVWGWNPLSEETAPIC |
JGI20193J14888_10032155 | 3300001385 | Arctic Peat Soil | MRIIAKVIESMLRKDATQTWNGQTSAVQSRDIWTWGGFSEERATIC* |
JGI20193J14888_10095741 | 3300001385 | Arctic Peat Soil | PSKGTVMRIIAKVIESMLRKDATQTWNGQTSAVASRDIWGWGGFS* |
JGI20177J14857_10337401 | 3300001397 | Arctic Peat Soil | VMRIIAKVIESMLRKDATQTWNGQTSAVASRDIWGWGGFS* |
A20PFW1_10844432 | 3300001532 | Permafrost | MLTKDATQQWTGQTSAVASDSWHWGGFSDETSTVF* |
A15PFW1_102989182 | 3300001534 | Permafrost | SMLTKDATQQWTGQTSAFASRNGWAWGGFSDETTTIL* |
A3PFW1_105161122 | 3300001535 | Permafrost | MKTIAKVIESMLSKDATQQWTGQTSAVASRDTWNWGGFADETTIVF* |
A1565W1_101146142 | 3300001536 | Permafrost | MKTIARVIESMLTKDATQQWTGQTSAVQSRDTWSWGGFSDQAATVF* |
JGI24129J20441_10734002 | 3300001870 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVQSRNIWSWGGFAD* |
JGI24133J20442_10084821 | 3300001871 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVAPCXXWXWAGFSD* |
JGI24133J20442_10808612 | 3300001871 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVASRGNWSWGGFSDETTTSF* |
JGIcombinedJ21911_100748774 | 3300002066 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAAASRGNWSWGGFSDETTVF* |
JGIcombinedJ21912_101211142 | 3300002069 | Arctic Peat Soil | MKIIAKVIESMLSKDATQKWNGQTSAFELNNTWHWNP* |
JGIcombinedJ21912_102254221 | 3300002069 | Arctic Peat Soil | LIAKVIESMLSKDATQQWTGQTSAVASQDVWHWGGFSA* |
JGI24139J26690_10190531 | 3300002162 | Arctic Peat Soil | MKIIAKVIESMLSKDATQKWNGQTSAFEPNNVWHWNP* |
JGI24144J35610_101375251 | 3300002515 | Arctic Peat Soil | MRIXAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF* |
JGI24132J36420_101579322 | 3300002538 | Arctic Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAVASQDVWHWGGFSA* |
JGI24130J36418_100034771 | 3300002549 | Arctic Peat Soil | APPSKGTVMRIIAKVIESMLRKDATQTWNGQTSAVQSRDIWTWGGFSEERATIC* |
JGI24130J36418_100068694 | 3300002549 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVSSRGCWHWGGFSDETSTVF* |
JGI24130J36418_100942912 | 3300002549 | Arctic Peat Soil | MRIIAKVIESMLRKDATQTWNGQTSAVASRDIWGWGGFS* |
JGI24131J36419_100434863 | 3300002550 | Arctic Peat Soil | MRIITRIIESMLSKDVTQRWTGQTSAAGPSSVWGWNPVSEETAPIA* |
JGI24134J36421_100256913 | 3300002564 | Arctic Peat Soil | MKLIAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF* |
JGI24134J36421_101546911 | 3300002564 | Arctic Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAVQSRDTWNWGGFSDETPTIF* |
JGI24136J36422_100221124 | 3300002569 | Arctic Peat Soil | MRIITRIIESMLSKDATQRWTGQTPAAGPSSVWGWNPVSEETAPIA* |
Ga0062383_100352642 | 3300004778 | Wetland Sediment | MKIIAKVIESMLSKDKTQWTGQTSAVQSRDVWHWNPISDETATIC* |
Ga0062383_102250392 | 3300004778 | Wetland Sediment | MKLIAKVIESMLTKDAAQQWTGQTSAVQSRGGWSWGGFSDETSTIL* |
Ga0062378_100988711 | 3300004780 | Wetland Sediment | MKLIAKVIESMLTKDATQRWTGQTSAVQSRDVWGWGGFADETPTIL* |
Ga0062378_101008571 | 3300004780 | Wetland Sediment | MKLIAKVIESMLTKDATQRWTGQTSAVQSRDVWGWGGFADQTPTIL* |
Ga0071328_1187074 | 3300005045 | Permafrost | MKTIAKVIESMLTKDATQQWTGQTSAVASRGWSWNPVAETSTVF* |
Ga0071328_1387724 | 3300005045 | Permafrost | MKTIAKVIESMLTKDATQQWTGQTSAVQARDTWTWGGFADETSTVF* |
Ga0066795_100284311 | 3300005938 | Soil | TVMRIIAKVIESMLRKDATQTWNGQTSAVQSRDIWTWGGFSEERATIC* |
Ga0066795_101006582 | 3300005938 | Soil | MKTIAKVIESMLTKDATQQWTGQTSAVQSRDTWNWGGFSDETPTIF* |
Ga0066794_100457142 | 3300005947 | Soil | MKTIAKVIESMLSKDATQQWTGQTSAVSSRGSWHWGGFSDETSTVF* |
Ga0066794_100624142 | 3300005947 | Soil | IAKVIESMLSKDATQQWTGQTSAVASNSGWSWGGFSE* |
Ga0066794_102460211 | 3300005947 | Soil | AKVIESMLRKDATQTWNGQTSAVQSRDIWTWGGFSEERATIC* |
Ga0066789_100000218 | 3300005994 | Soil | MRIIAKVIESMLSKDATQQWTGQTSAVASNVWGWNGLAEQTATIL* |
Ga0066789_100044244 | 3300005994 | Soil | MRIIAKVIESMLSKDATQTWSGETSAVASCNIWSWGGFTA* |
Ga0066789_100195962 | 3300005994 | Soil | MRIIAKVIESMLRKDATQTWTGQTSAVASRDVWGWGGISE* |
Ga0066789_100293763 | 3300005994 | Soil | MRIIAKVIESMLRKDATQTWTGQTSAVASRDIWGWGGFS* |
Ga0066789_101041942 | 3300005994 | Soil | MKIIAKVIESMLRKDATQTWTGQTSAVASRDVWGWGGISE* |
Ga0066789_101104361 | 3300005994 | Soil | MKIIAKVIESMLRKDATQKWNGQTSAFEPNNVWHWNP* |
Ga0097691_10084732 | 3300006055 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVGSRDGWCWGGFSDES* |
Ga0097691_10179941 | 3300006055 | Arctic Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAVASRDTWRWGGFSE* |
Ga0075525_100037927 | 3300006636 | Arctic Peat Soil | MRIIAKVIESMLSKDATQRWTGRTSAVQSRDTWSWGGFADETATIF* |
Ga0075525_100145221 | 3300006636 | Arctic Peat Soil | IESMLSKDATQRWTGQTSAVQSRDTWSWGGFADETATIF* |
Ga0075522_100552062 | 3300006638 | Arctic Peat Soil | MRIIVKVIESMLSKDNTKWTGQTSAVASRGTWHWNP* |
Ga0075527_101821281 | 3300006640 | Arctic Peat Soil | AAPQRKGMTMKTIAKVIESMLTKDATQQWTGQTSAVQSRDVWSWGGFAD* |
Ga0075527_102492261 | 3300006640 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVQSRNIWSWGGYAG* |
Ga0075521_100458734 | 3300006642 | Arctic Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAVASHDTWRWGGFSE* |
Ga0075520_10191321 | 3300006795 | Arctic Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAAPTKATWGWSGFSA* |
Ga0075520_11535862 | 3300006795 | Arctic Peat Soil | MRIIAKVIESMLSKDATQQWTGQTSAAASQHWSWGG* |
Ga0066797_12571261 | 3300006864 | Soil | MKTIAKVIESMLTKDATQQWTGQTSAVSSRGSWHWGGFSDETSTVF* |
Ga0075528_100112784 | 3300006949 | Arctic Peat Soil | MRIIAKVIESMLSKDATQQWTGQTSAAASQHWGWGG* |
Ga0075528_100165831 | 3300006949 | Arctic Peat Soil | MRIIAKVIESMLSKDNTKWTGQTSAVQPRGWHWNP* |
Ga0075528_100387511 | 3300006949 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVGSRDHWTWGGFAD* |
Ga0075528_100483022 | 3300006949 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVQARDTWNWGGFAD* |
Ga0075528_101564102 | 3300006949 | Arctic Peat Soil | SKGTVMRIIAKVIESMLRKDATQTWNGQTSAVQSRDIWTWGGFSEERATIC* |
Ga0075524_100358604 | 3300006950 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVESRDTWTWGGFAD* |
Ga0075524_100528282 | 3300006950 | Arctic Peat Soil | KGTVMRIIAKVIESMLRKDATQTWNGQTSAVASRDIWGWGGFS* |
Ga0075524_100949622 | 3300006950 | Arctic Peat Soil | GMTMKTIAKVIESMLTKDATQQWTGQTSAVESRNIWTWGGFAD* |
Ga0075524_101076715 | 3300006950 | Arctic Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAVASNSGWSWGGFS |
Ga0075524_101084102 | 3300006950 | Arctic Peat Soil | KTIAKVIESMLTKDATQQWTGQTSAVAPCNVWSWTGFSD* |
Ga0075524_102187871 | 3300006950 | Arctic Peat Soil | GMIMKTIAKVIESMLTKDATQQWTGQTSAVQARDTWNWGGFAD* |
Ga0075524_103533111 | 3300006950 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVESRNIWGWGGFAD* |
Ga0075524_103664893 | 3300006950 | Arctic Peat Soil | KVIESMLSKDATQQWTGQTSAVASQDVWHWGGFSA* |
Ga0075524_104139512 | 3300006950 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAAASRGNWSWGGFSDETTTVF* |
Ga0075524_104250461 | 3300006950 | Arctic Peat Soil | MKTIAKVIESMLAKDATQQWTGQTSAVAPCNVWSWTGFSD* |
Ga0075524_105364741 | 3300006950 | Arctic Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAVASNSGWSWGGFSE* |
Ga0104326_1012392 | 3300007740 | Soil | MIMKTIAKVIESMLTKDATQQWTGQTSAVSSRDCWSWGGFAGETSTVF* |
Ga0104323_1073213 | 3300007821 | Soil | MIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDGWCWGGFADETSTVF* |
Ga0066793_100073641 | 3300009029 | Prmafrost Soil | PSKGTVMRIIAKVIESMLRKDATQTWNGQTSAVQSRDIWTWGGFSEERATIC* |
Ga0066793_103671862 | 3300009029 | Prmafrost Soil | VIESMLTKDATQQWTGQTSAASSRGCWHWGGFSDETSTVF* |
Ga0066793_104246031 | 3300009029 | Prmafrost Soil | MKLIAKVIESMLSKDATQQWTGQTSAVASNSGWSWG |
Ga0066793_104865392 | 3300009029 | Prmafrost Soil | MKTIAKVIESMLTKDATQQWTGHTSAVESRNMWTWGGFAD* |
Ga0066793_108648902 | 3300009029 | Prmafrost Soil | MKLIAKVIESMLSKDATQQWTGQTSAVASHSGWSWGGFSE* |
Ga0126348_10105422 | 3300010862 | Boreal Forest Soil | MRIIAKVIESMLSKDATQQWTGQTSAVASSSWGWGGFSDETTIL* |
Ga0126350_103102842 | 3300010880 | Boreal Forest Soil | MRIIAKVIESMLSKDATQQWTGQTSAVQSRGTWIWGGFSDETATIL* |
Ga0120175_10004512 | 3300011971 | Permafrost | MIMKTIAKVIESMLTKDATQQWTGQTSAVASDSWHWGGFSDETSTVF* |
Ga0120175_10118892 | 3300011971 | Permafrost | KTIAKVIESMLTKDATQQWTGQTSAVGSRDHWTWGGFAD* |
Ga0120175_10272871 | 3300011971 | Permafrost | AKVIESMLTKDATQQWTGQTSAVSSRDCWSWGGFAGETSTVF* |
Ga0120175_10425302 | 3300011971 | Permafrost | MIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDGWQWGGFAD* |
Ga0120156_10349402 | 3300011996 | Permafrost | MIMKTIARVIESMLTKDATQQWTGQTSAVQSRDTWSWGGFSDQAATVF* |
Ga0120162_10138573 | 3300011997 | Permafrost | MKTIAKVIESMLTKDATQQWTGQTSAVSSRDCWSWGGFAGETSTVF* |
Ga0120162_10175003 | 3300011997 | Permafrost | IMKTIAKVIESMLSKDATQQWTGQTSAVASRDTWNWGGFADETTIVF* |
Ga0120162_10355731 | 3300011997 | Permafrost | MKTIAKVIESMLTKDATQQWTGQTSAVAPCNMWSWSGFSA* |
Ga0120162_10582232 | 3300011997 | Permafrost | GMIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDHWTWGGFAD* |
Ga0120162_10633032 | 3300011997 | Permafrost | VIESMLTKDATQQWTGQTSAVAPCNIWTWGGFAD* |
Ga0120162_10645281 | 3300011997 | Permafrost | MIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDHWTWTGFAG* |
Ga0120161_10156041 | 3300012005 | Permafrost | KTIAKVIESMLTKDATQQWTGQTSAVSSRDCWSWGGFAGETSTVF* |
Ga0120161_10791381 | 3300012005 | Permafrost | TIAKVIESMLTKDATQQWTGQTSAVGSRDHWTWGGFAD* |
Ga0120161_10832282 | 3300012005 | Permafrost | TIAKVIESMLTKDATQQWTGQTSAVGSRDGWCWGGFADETSTVF* |
Ga0120161_10941502 | 3300012005 | Permafrost | EDIMKTIAKVIESMLTKDATQQWTGQTSAFASRNGWAWGGFSDETTTIL* |
Ga0120161_11084242 | 3300012005 | Permafrost | IAKVIESMLTKDATQQWTGQTSAVESRNIWTWGGFAD* |
Ga0120118_10787511 | 3300012010 | Permafrost | MIMKTISRVIESMLTKDATQQWTGQTSAVQSRDTWSWGGFSDQAATVF* |
Ga0120159_10689451 | 3300012014 | Permafrost | MKTIAKVIESMLTKDATQQWTGQTSAVSSRDGWTWG |
Ga0157216_102010212 | 3300012668 | Glacier Forefield Soil | MKTIAKVIESMLTKDATQQWTGQTSAVASRDSWGW |
Ga0157216_103715622 | 3300012668 | Glacier Forefield Soil | RIIAKVIESMLSKDATQQWTGQTSAVPARDVWGWGGFADETSTIL* |
Ga0164300_100752884 | 3300012951 | Soil | MKTIAKVIETMLSKDATQQWTGQTAAVEPIGTWSWGV* |
Ga0164298_104453082 | 3300012955 | Soil | MKTIAKVLESMLSKDATQQWTGQTAAVEPLGTWSWGV* |
Ga0164299_102126942 | 3300012958 | Soil | MKTIAKVLESMLSKDATQQWTGQTAAVEPIGTWSWGV* |
Ga0164301_104591562 | 3300012960 | Soil | MKTIAKVIETMLSKDATQQWTGQATAVEPLGTWSWGV* |
Ga0164307_105661942 | 3300012987 | Soil | MKTIAKVIETMLSKDATQQWTGQATAVEPIGTWSWGV* |
Ga0120106_10425712 | 3300013427 | Permafrost | VIESMLTRDATQQWTGQTSAVSSRDCWSWGGFAGETSTVF* |
Ga0120147_10115893 | 3300013758 | Permafrost | MIMKTIAKVIESMLTKDATQQWTGQTSAVASDSWH |
Ga0120181_11256411 | 3300013766 | Permafrost | MIMKTIAKVIESMLTKDATQQWTGQTSAVASDSWHWGGFSDE |
Ga0120158_102418561 | 3300013772 | Permafrost | AKVIESMLTKDATQQWTGQTSAVGSRDGWQWGGFAD* |
Ga0182010_100716422 | 3300014490 | Fen | VSNIDDCGPSETKGTVMRIIARVIESMLSKDATQRWNGQTSAVEPSNVWGWGGVSQENAPIC* |
Ga0182019_101022482 | 3300014498 | Fen | MRIIAKVIESMLSKDATQRWNGKTSAVEPSNVWGWGGVSQESAPIC* |
Ga0182021_100546512 | 3300014502 | Fen | MRIIAKVIESMLSKDATQRWNGQTSAVEPSNVWGWGGVSQENAPIC* |
Ga0182021_112329671 | 3300014502 | Fen | MKLIAKVIESMLSKDATQQWNGQTSAVASRGTWSWGGFSEV* |
Ga0182021_120661372 | 3300014502 | Fen | MKILAKVIESMLSKDATQTWTGQTSAVASRDVWGWGGISEETSTII* |
Ga0120160_10348641 | 3300014820 | Permafrost | AAPLRKGMIMKTIAKVIESMLSKDATQQWTGQTSAVASRDTWNWGGFADETTIVF* |
Ga0120160_10380901 | 3300014820 | Permafrost | SMLTKDATQQWTGQTSAVASDSWHWGGFSDETSTVF* |
Ga0120170_10533672 | 3300014823 | Permafrost | VIESMLTKDATQQWTGQTSAVQSRDTWSWGGFSDQAATVF* |
Ga0120171_10662122 | 3300014827 | Permafrost | VIESMLTKDPTQQWTGQTSAVGSRDHWSWTGFAG* |
Ga0167656_100006410 | 3300015076 | Glacier Forefield Soil | MRIIAKVIESMLTKDATQQWTGQTSAVASRGIWSWGGFSDETTTIL* |
Ga0167660_100005517 | 3300015078 | Glacier Forefield Soil | MIMKTIAKVIESMLTKDATQQWTGQTSAVGSHDGWHWGGFSDETSTVF* |
Ga0167657_10123692 | 3300015079 | Glacier Forefield Soil | MLTKDATQQWTGQTSAVASRGIWSWGGFSDETTTIL* |
Ga0167655_10190051 | 3300015086 | Glacier Forefield Soil | MIMKTIARVIESMLTKDATQQWTGQTSAVSSRDGWHWTGFADETSTVL* |
Ga0167655_10498602 | 3300015086 | Glacier Forefield Soil | MKIIAKVIESMLTKDATQQWTGQTSAVASRSWSWNPVADQTSTIF* |
Ga0167665_10005952 | 3300015163 | Glacier Forefield Soil | MKAIAKVIESMLTKDATQQWTGQTSAVSSRDNWAWTGFSA* |
Ga0167665_10037591 | 3300015163 | Glacier Forefield Soil | MKAIAKVIESMLTKDATQQWTGQTSAVASRDNWTWGGFTA* |
Ga0167661_10547962 | 3300015167 | Glacier Forefield Soil | MKTIAKVIESMLTKDATQQWTGQTSAVGSRDHWTWTGFAA* |
Ga0167667_10017661 | 3300015189 | Glacier Forefield Soil | RQVAGSVRQTKGKIMKLIAKVIESMLTKDATQQWTGQTSAVQSRDVWGWGGFADQTPTIL |
Ga0167667_10110011 | 3300015189 | Glacier Forefield Soil | MKLIAKVIESMLTKDATQQWTGQTSAVQSRDVWGWGGF |
Ga0167659_10281712 | 3300015191 | Glacier Forefield Soil | MKLIAKVIESMLTKDATQQWTGQTSAVQSRDVWGWGGFADQTPTIL* |
Ga0167666_100121811 | 3300015194 | Glacier Forefield Soil | MIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDGWHWNP* |
Ga0167666_10374521 | 3300015194 | Glacier Forefield Soil | MIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDHWGWTGFAG* |
Ga0167658_10001842 | 3300015195 | Glacier Forefield Soil | MIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDHWTWGGFAD* |
Ga0167658_10003441 | 3300015195 | Glacier Forefield Soil | SPPKGMIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDHWTWTGFAA* |
Ga0167658_10692902 | 3300015195 | Glacier Forefield Soil | MKLIAKVIESMLTKDATQQWTGQTSAVASRGWSWHPIADETSTIF* |
Ga0167650_10054442 | 3300015203 | Glacier Forefield Soil | MKIIVKVIESMLSKDATQQWTGQTSATSREHWGWGGFTK* |
Ga0167650_10280222 | 3300015203 | Glacier Forefield Soil | MRIIAKVIESMLSKDATQQWTGQTSAVQSRDTWSWGGFADETATIF* |
Ga0167664_10081501 | 3300015208 | Glacier Forefield Soil | MKAIAKVIESMLTKDATQQWTGQTSAVSSRDGWSWSGFSA* |
Ga0167664_10148451 | 3300015208 | Glacier Forefield Soil | MKLIAKVIESMLTKDATQQWTGQTSAVQSRDVWSWGGFADETSTIL* |
Ga0167664_10167203 | 3300015208 | Glacier Forefield Soil | MKAIAKVIESMLTKDATQQWTGQTSAVASRDSWSWSGFSDETTTAF* |
Ga0167664_10360671 | 3300015208 | Glacier Forefield Soil | NIMKAIAKVIESMLTKDATQQWTGQTSAVASRDNWTWGGFTA* |
Ga0167664_10390913 | 3300015208 | Glacier Forefield Soil | MKTIAKVIESMLTKDATQQWTGQTSAVASRDGWGWGGFADETSTVF* |
Ga0182022_10103902 | 3300019785 | Fen | MRIIARVIESMLSKDATQRWNGQTSAVEPSNVWGWGGVSQENAPIC |
Ga0182022_10244431 | 3300019785 | Fen | VSNIDDCGPSETKGTVMRIIARVIESMLSKDATQRWNGQTSAVEPSNVWGWGGVSQENAPIC |
Ga0182022_11064511 | 3300019785 | Fen | MRIIARVIESMLSKDATQRWNGQTSAVEPSNVWGWGA |
Ga0208850_10002336 | 3300025457 | Arctic Peat Soil | MRIIAKVIESMLRKDATQTWNGQTSAVASRDIWGWGGFS |
Ga0208851_10264601 | 3300025461 | Arctic Peat Soil | MRIIAKVIESMLSKDATQRWTGQTSAVESRGTWTWGGYSEETATIC |
Ga0208588_10704321 | 3300025479 | Arctic Peat Soil | MKLIAKVIESMLTKDATQRWTGQTSAVQSRDVWGWGGFADETPTIL |
Ga0208079_10173343 | 3300025481 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVSSRGCWHWGGFSDETSTVF |
Ga0208079_10331432 | 3300025481 | Arctic Peat Soil | MRIIAKVIESMLSKDNTKWTGQTSAVQPRGWHWNP |
Ga0208079_10875761 | 3300025481 | Arctic Peat Soil | PPSKGTVMRIIAKVIESMLRKDATQTWNGQTSAVASRDIWGWGGFS |
Ga0208079_10879161 | 3300025481 | Arctic Peat Soil | PPSKGTVMRIIAKVIESMLRKDATQTWNGQTSAVQSRDIWTWGGFSEERATIC |
Ga0208715_10010447 | 3300025482 | Arctic Peat Soil | MRIIAKVIESMLRKDATQTWNGQTSAVQSRDIWTWGGFSEERATIC |
Ga0207932_10053742 | 3300025495 | Arctic Peat Soil | MRIIAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF |
Ga0207929_10532681 | 3300025505 | Arctic Peat Soil | MRIIAKVIESMLTKDATQQWTGQTSAVQSRDTWSWGGFADQTATIL |
Ga0208848_10047604 | 3300025509 | Arctic Peat Soil | MRIIAKVIESMLSKDATQQWTGQTSAVASNVWGWNGLAEQTATIL |
Ga0208848_10546162 | 3300025509 | Arctic Peat Soil | MKIIAKVIESMLRKDATQTWTGQTSAVASRDVWGWGGISE |
Ga0208078_10230911 | 3300025544 | Arctic Peat Soil | EGMIMKTIAKVIESMLTKDATQQWTGQTSAVASDSWHWGGFSDETSTVF |
Ga0208078_10904051 | 3300025544 | Arctic Peat Soil | MRIIAKVIESMLSKDATQQWTGQTSAVASNVWGWNGLTEQTATIL |
Ga0209385_10293822 | 3300025650 | Arctic Peat Soil | MRIIAKVIESMLSKDATQQWTGQTSAAASQHWSWGG |
Ga0209385_10733182 | 3300025650 | Arctic Peat Soil | MKIIAKVIESMLSKDATQKWNGQTSAFEPNNVWHWNP |
Ga0209744_11278871 | 3300025692 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVQARDTWNWGGFAD |
Ga0209744_11908862 | 3300025692 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVASRGSWSWGG |
Ga0209744_12087231 | 3300025692 | Arctic Peat Soil | MTMKTIAKVIESMLTKDATQQWTGQTSAVASRGNWSWGGFSDETTTSF |
Ga0209746_10206474 | 3300025716 | Arctic Peat Soil | MRIITRIIESMLSKDATQRWTGQTPAAGPSSVWGWNPVSEETAPIA |
Ga0209587_10015336 | 3300025721 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVQSRNIWSWGGYAG |
Ga0209638_10120795 | 3300025725 | Arctic Peat Soil | MKIIAKVIESMLSKDATQKWNGQTSAFELNNTWTWNP |
Ga0209745_10143644 | 3300025739 | Arctic Peat Soil | IESMLTKDATQQWTGQTSAVAPCNIWGWAGFSDETSTVL |
Ga0209747_10240743 | 3300025750 | Arctic Peat Soil | MRIITRIIESMLSKDVTQRWTGQTPAAGPSSVWGWNPVSEETAPIA |
Ga0209539_11178932 | 3300025764 | Arctic Peat Soil | MKLITKVIESMLSKDATQQWTGQTSAVASQDVWHWGGFSA |
Ga0209539_12490681 | 3300025764 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVAPCNTWTWGGFAD |
Ga0209539_12867492 | 3300025764 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVAPCDVWTWGGFAD |
Ga0209484_100012545 | 3300025829 | Arctic Peat Soil | RTPAAPPSKGTVMRIIAKVIESMLRKDATQTWNGQTSAVASRDIWGWGGFS |
Ga0209484_100243501 | 3300025829 | Arctic Peat Soil | VMRIIAKVIESMLSKDATQQWTGQTSAAASHHWSWNP |
Ga0209748_13028932 | 3300025836 | Arctic Peat Soil | KTLRRPPNKGTIMRIIAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF |
Ga0209538_12155162 | 3300025846 | Arctic Peat Soil | MRIITRIIESMLSKDVTQRWTGQTSAAGPSSVWGWNPVSEETAPIA |
Ga0209538_12606781 | 3300025846 | Arctic Peat Soil | PSRGTVMRIIAKVIESMLRKDATQTWNGQTSAVASRDIWGWGGFS |
Ga0209176_100302392 | 3300025854 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVQSRDVWSWGGFAD |
Ga0209014_100452693 | 3300025857 | Arctic Peat Soil | MRIIAKVIESMLSKDATQQWTGQTSAAASQHWSWGGYTDETATIC |
Ga0209014_100940521 | 3300025857 | Arctic Peat Soil | PATRGMIMKTIAKVIESMLTKDATQQWTGQTSAVGSRDGWHWTGFADES |
Ga0209014_101706881 | 3300025857 | Arctic Peat Soil | PATRGMIMKTIAKVIESMLTKDATQQWTGQTSAVSSRGCWHWGGFSDETSTVF |
Ga0209429_102397081 | 3300025864 | Arctic Peat Soil | MRIITRIIESMLSKDATQRWTGQTSAVGPSSVWGWNPVSEETAPI |
Ga0209540_100124008 | 3300025888 | Arctic Peat Soil | MKLIAKVIESMLSKDATQTWNGQTSAVASNSGWSWGGFS |
Ga0209540_101163762 | 3300025888 | Arctic Peat Soil | MRIIAKVIESMLSKDATQTWTGQTSAVQSRDVWGWGGISKETATII |
Ga0209540_101787451 | 3300025888 | Arctic Peat Soil | MKIIAKVIESMLSKDATQKWNGQTSAFELNNTWHWNP |
Ga0209585_100293683 | 3300025891 | Arctic Peat Soil | MKTIAKVIESMLTKDATQQWTGQTSAVESRDTWTWGGFAD |
Ga0209585_101015401 | 3300025891 | Arctic Peat Soil | GMTMKTIAKVIESMLTKDATQQWTGQTSAVESRNIWTWGGFAD |
Ga0209890_100094701 | 3300026291 | Soil | MRIIAKVIESMLSKDATQTWSGETSAVASCNIWSWGGFTA |
Ga0209890_100130821 | 3300026291 | Soil | MKIIAKVIESMLRKDATQKWNGQTSAFEPNNVWHWNP |
Ga0209890_100193633 | 3300026291 | Soil | MRIIAKVIESMLRKDATQTWTGQTSAVASRDIWGWGGFS |
Ga0209890_100322832 | 3300026291 | Soil | MRIIAKVIESMLRKDATQTWTGQTSAVASRDVWGWGGISE |
Ga0209797_100200104 | 3300027831 | Wetland Sediment | MKTIAKVIESMLTKDATQQWTGQTSAVQSRNVWSW |
Ga0209797_100496732 | 3300027831 | Wetland Sediment | MKLIAKVIESMLTKDAAQQWTGQTSAVQSRGGWSWGGFSDETSTIL |
Ga0209797_102317561 | 3300027831 | Wetland Sediment | MKLIAKVIESMLTKDATQRWTGQTSAVQSRDVWGWGGFADQTPTIL |
Ga0209683_100534022 | 3300027840 | Wetland Sediment | MKTIAKVIESMLTKDATQQWTGQTSAVQSRNVWSWGGFAD |
Ga0209798_105170201 | 3300027843 | Wetland Sediment | IAKVIESMLTKDATQRWTGQTSAVQSRDVWGWGGFADQTPTIL |
Ga0302261_11788392 | 3300028733 | Fen | QTPSKGNTVKIIAKVIESMLSKDATQTWTGQTSAVASSDVWHWGGFSE |
Ga0302256_100194932 | 3300028741 | Fen | HQDNKTPTPSKGNTVKIIAKVIESMLSKDATQTWTGQTSAVASSDVWHWGGFSE |
Ga0302262_100751732 | 3300028743 | Fen | VKIIAKVIESMLSKDATQTWTGQTSAVASSDVWHWGGFSE |
Ga0302295_10164422 | 3300028856 | Fen | VKIIAKVIESMLSKDATQTWTGQTSAVASQDTWHWGGFSE |
Ga0302163_101485352 | 3300028868 | Fen | KTPTPSKGNTVKIIAKVIESMLSKDATQTWTGQTSAVVSSDVWHWGGFSA |
Ga0302163_101984741 | 3300028868 | Fen | VKIIAKVIESMLSKDATQTWTGQTSAVVSSDVWHWG |
Ga0302263_100433433 | 3300028869 | Fen | MKILAKVIESMLSKDATKTWTGQTSAVSSRDVWGWGGISEDTSTIF |
Ga0302254_100995822 | 3300028870 | Fen | MKILAKVIESMLSKDATQTWTGQTSAVSSRDVWGWGGISEDTSTIF |
Ga0302298_101793991 | 3300029980 | Fen | VKIIAKVIESMLSKDATQTWTGQTSAVASSDVWHWG |
Ga0311332_101086911 | 3300029984 | Fen | MKILAKVIESMLSKDATQTWTGQTSAVSSRDVWGWGGISGDTST |
Ga0311332_109791172 | 3300029984 | Fen | MRIIAKVIESMLTKDATQQWTGQTSAVQSRDVWGWGGFADETPTIL |
Ga0311334_100393243 | 3300029987 | Fen | HQDNKTPTPSKGNTVKIIAKVIESMLSKDATQTWTGQTSAVASQDTWHWGGFSE |
Ga0311334_102905132 | 3300029987 | Fen | MKILAKVIESMLSKDATQTWTGQTSAVASRDVWGWGGIAEETATII |
Ga0311334_104390562 | 3300029987 | Fen | PQAKEPNMKILAKVIESMLSKDATKTWTGQTSAVSSRDVWGWGGISGDTSTIF |
Ga0311365_104172781 | 3300029989 | Fen | LSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF |
Ga0311365_107721191 | 3300029989 | Fen | VKIIAKVIESMLSKDATQTWTGQTSAVVSSDVWHWGGFSA |
Ga0311336_100457291 | 3300029990 | Fen | IESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF |
Ga0311336_102549873 | 3300029990 | Fen | MKILAKVIESMLSKDATQTWTGQTSAVSSRDVWGWGGISGDTSTIF |
Ga0311350_102720891 | 3300030002 | Fen | PRKGTTMKLIAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF |
Ga0302172_102971291 | 3300030003 | Fen | MRIIAKVIESMLSKDATQTWTGQTSAVASSDTWHWGGFSETATIC |
Ga0311348_105718121 | 3300030019 | Fen | MKILAKVIESMLSKDATQTWTGQTSAVSSRDVWGWGGISGDTSTII |
Ga0311348_114503821 | 3300030019 | Fen | MKLIAKVIESMLSKDATQRWTGQTSAVQSRDIWSWGG |
Ga0302286_102125502 | 3300030047 | Fen | MKLIAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF |
Ga0311333_109976361 | 3300030114 | Fen | KVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF |
Ga0311360_111253002 | 3300030339 | Bog | MKLIAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIFLV |
Ga0311335_100317401 | 3300030838 | Fen | ESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDETPTIF |
Ga0311364_114163661 | 3300031521 | Fen | MKLIAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSD |
Ga0307377_111085991 | 3300031673 | Soil | MKAIAKVIESMLTKDATQQWTGQTSAIQASNVWGWTGFTA |
Ga0302321_1002529331 | 3300031726 | Fen | MKLIAKVIESMLSKDAAQQWTGQTSAVQSRDTWNWGGFSDET |
Ga0302322_1000950102 | 3300031902 | Fen | MKILAKVIESMLSKDATKTWTGQTSAVSSRDVWGWGGISGDTSTIF |
Ga0302322_1029725641 | 3300031902 | Fen | KVIESMLSKDATQRWTGQTSAVQSRDIWSWGGFSDETPTIF |
Ga0370486_187009_211_351 | 3300034126 | Untreated Peat Soil | MKLIAKVIESMLSKDATQRWTGQTSAVQSRDVWGWGGFSDETPTIL |
Ga0370490_0143614_19_159 | 3300034128 | Untreated Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAVQSRDVWGWGGFADETPTIL |
Ga0370493_0238595_497_604 | 3300034129 | Untreated Peat Soil | MLRKDATQTWTGQTSAVSRDVWGWGGISEETSTIL |
Ga0370507_0069771_699_890 | 3300034158 | Untreated Peat Soil | MPTSTGSRQRIPHKGNIMKLIAKVIESMLSKDATQRWTGQTSAVQSRDVWGWGGFSDETPTIL |
Ga0370487_0136907_549_689 | 3300034170 | Untreated Peat Soil | MKLIARVIESMLSKDATQRWTGQTSAVQSRDVWGWGGFSDETPTIL |
Ga0370495_0001746_3220_3360 | 3300034257 | Untreated Peat Soil | MRIIAKVIESMLTKDATQQWTGQTSAVQSRDIWGWGGVSDGTASIL |
Ga0370495_0019049_1192_1332 | 3300034257 | Untreated Peat Soil | MRIIVKVIESMLTKDATQQWTGQTSAVQSRDVWGWGGISDETPTIL |
Ga0370495_0170058_555_695 | 3300034257 | Untreated Peat Soil | MKLIAKVIESMLSKDATQQWTGQTSAVQSRDTWSWGGFSDETPTIF |
Ga0370481_0004482_514_636 | 3300034281 | Untreated Peat Soil | MKLIAKVIESMLSKDATQQWNGQTSAVASRDTWSWGGFSA |
Ga0370481_0004482_762_887 | 3300034281 | Untreated Peat Soil | MKLIAKVIESMLSKDATQQWNGQTSAVASRDTWSWGGFSEV |
Ga0316598_022591_694_813 | 3300034652 | Untreated Peat Soil | MKIIAKVIESMLSKDATQQWSGQTSAVANDGWHWNPFAE |
Ga0316599_027557_131_271 | 3300034653 | Untreated Peat Soil | MKLIAKVIESMLTKDATQRWTGQTSAAQSRDVWGWGGFADEIPTIL |
Ga0370497_0126188_496_627 | 3300034965 | Untreated Peat Soil | IAKVIESMLTKDATQRWTGQTSAVQSRDVWGWGGFADETPTIL |
⦗Top⦘ |