Basic Information | |
---|---|
Family ID | F017813 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 238 |
Average Sequence Length | 42 residues |
Representative Sequence | MPTKLIVDCSTGVTTEVELTAEEIAQREADAAAFAEAKA |
Number of Associated Samples | 146 |
Number of Associated Scaffolds | 238 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 99.11 % |
% of genes near scaffold ends (potentially truncated) | 93.70 % |
% of genes from short scaffolds (< 2000 bps) | 78.99 % |
Associated GOLD sequencing projects | 137 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.840 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.227 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.538 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.681 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 14.93% Coil/Unstructured: 58.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 238 Family Scaffolds |
---|---|---|
PF13392 | HNH_3 | 4.62 |
PF05866 | RusA | 0.42 |
PF02945 | Endonuclease_7 | 0.42 |
COG ID | Name | Functional Category | % Frequency in 238 Family Scaffolds |
---|---|---|---|
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 50.84 % |
All Organisms | root | All Organisms | 49.16 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109110524 | Not Available | 598 | Open in IMG/M |
3300002835|B570J40625_100272225 | Not Available | 1743 | Open in IMG/M |
3300002835|B570J40625_100709930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300004240|Ga0007787_10127616 | Not Available | 1208 | Open in IMG/M |
3300005581|Ga0049081_10350514 | Not Available | 500 | Open in IMG/M |
3300005582|Ga0049080_10020332 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
3300005582|Ga0049080_10105556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
3300005805|Ga0079957_1111555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HGB0020 | 1466 | Open in IMG/M |
3300006641|Ga0075471_10548859 | Not Available | 570 | Open in IMG/M |
3300006802|Ga0070749_10054321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2432 | Open in IMG/M |
3300006802|Ga0070749_10059209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2315 | Open in IMG/M |
3300006802|Ga0070749_10079324 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
3300006802|Ga0070749_10149731 | Not Available | 1357 | Open in IMG/M |
3300006875|Ga0075473_10038120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1851 | Open in IMG/M |
3300006875|Ga0075473_10257901 | Not Available | 705 | Open in IMG/M |
3300007541|Ga0099848_1032803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2157 | Open in IMG/M |
3300007661|Ga0102866_1118560 | Not Available | 663 | Open in IMG/M |
3300007960|Ga0099850_1188346 | Not Available | 816 | Open in IMG/M |
3300007960|Ga0099850_1284070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300007972|Ga0105745_1229853 | Not Available | 591 | Open in IMG/M |
3300008107|Ga0114340_1133368 | Not Available | 941 | Open in IMG/M |
3300008111|Ga0114344_1025879 | All Organisms → Viruses → Predicted Viral | 2354 | Open in IMG/M |
3300008111|Ga0114344_1066580 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
3300008111|Ga0114344_1082076 | Not Available | 1194 | Open in IMG/M |
3300008113|Ga0114346_1226329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300008114|Ga0114347_1266509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300008116|Ga0114350_1024973 | All Organisms → Viruses → Predicted Viral | 2428 | Open in IMG/M |
3300008120|Ga0114355_1052590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1841 | Open in IMG/M |
3300008120|Ga0114355_1060136 | All Organisms → Viruses → Predicted Viral | 3518 | Open in IMG/M |
3300008120|Ga0114355_1110838 | Not Available | 1055 | Open in IMG/M |
3300008217|Ga0114899_1121363 | Not Available | 867 | Open in IMG/M |
3300008258|Ga0114840_1057283 | Not Available | 607 | Open in IMG/M |
3300008259|Ga0114841_1203425 | Not Available | 711 | Open in IMG/M |
3300008259|Ga0114841_1268722 | Not Available | 539 | Open in IMG/M |
3300008262|Ga0114337_1064505 | Not Available | 1841 | Open in IMG/M |
3300008263|Ga0114349_1192170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1381 | Open in IMG/M |
3300008266|Ga0114363_1082897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
3300008266|Ga0114363_1202123 | Not Available | 609 | Open in IMG/M |
3300008266|Ga0114363_1203762 | Not Available | 1041 | Open in IMG/M |
3300008448|Ga0114876_1120952 | Not Available | 1004 | Open in IMG/M |
3300008450|Ga0114880_1217632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300008450|Ga0114880_1267057 | Not Available | 521 | Open in IMG/M |
3300008962|Ga0104242_1055688 | Not Available | 664 | Open in IMG/M |
3300009068|Ga0114973_10399705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300009085|Ga0105103_10911536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300009154|Ga0114963_10254258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300009158|Ga0114977_10199015 | Not Available | 1175 | Open in IMG/M |
3300009182|Ga0114959_10045427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2580 | Open in IMG/M |
3300009450|Ga0127391_1052855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300010334|Ga0136644_10213778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
3300010354|Ga0129333_10039017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4476 | Open in IMG/M |
3300010354|Ga0129333_10197734 | All Organisms → Viruses → Predicted Viral | 1829 | Open in IMG/M |
3300010354|Ga0129333_10198778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1823 | Open in IMG/M |
3300010354|Ga0129333_10392223 | Not Available | 1230 | Open in IMG/M |
3300010354|Ga0129333_10440533 | Not Available | 1148 | Open in IMG/M |
3300010354|Ga0129333_10531390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 1028 | Open in IMG/M |
3300010354|Ga0129333_11310213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300010368|Ga0129324_10207223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TML10 | 794 | Open in IMG/M |
3300010370|Ga0129336_10078769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1946 | Open in IMG/M |
3300010370|Ga0129336_10090998 | All Organisms → Viruses → Predicted Viral | 1793 | Open in IMG/M |
3300010370|Ga0129336_10177030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
3300010370|Ga0129336_10361907 | Not Available | 797 | Open in IMG/M |
3300010370|Ga0129336_10597778 | Not Available | 589 | Open in IMG/M |
3300011268|Ga0151620_1207087 | Not Available | 591 | Open in IMG/M |
3300012017|Ga0153801_1074485 | Not Available | 596 | Open in IMG/M |
3300013004|Ga0164293_10435645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10216069 | Not Available | 1291 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10277072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10483433 | Not Available | 824 | Open in IMG/M |
3300013372|Ga0177922_10590211 | Not Available | 595 | Open in IMG/M |
3300013372|Ga0177922_10646038 | Not Available | 1187 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10725128 | Not Available | 536 | Open in IMG/M |
3300017707|Ga0181363_1072043 | Not Available | 597 | Open in IMG/M |
3300017716|Ga0181350_1132349 | Not Available | 592 | Open in IMG/M |
3300017723|Ga0181362_1048605 | Not Available | 884 | Open in IMG/M |
3300017723|Ga0181362_1049967 | Not Available | 870 | Open in IMG/M |
3300017736|Ga0181365_1039284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1190 | Open in IMG/M |
3300017736|Ga0181365_1044695 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300017761|Ga0181356_1059050 | Not Available | 1307 | Open in IMG/M |
3300017774|Ga0181358_1043405 | All Organisms → Viruses → Predicted Viral | 1721 | Open in IMG/M |
3300017774|Ga0181358_1078913 | Not Available | 1205 | Open in IMG/M |
3300017774|Ga0181358_1207328 | Not Available | 638 | Open in IMG/M |
3300017777|Ga0181357_1051719 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
3300017777|Ga0181357_1072478 | Not Available | 1324 | Open in IMG/M |
3300017780|Ga0181346_1031746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2186 | Open in IMG/M |
3300017784|Ga0181348_1057952 | Not Available | 1573 | Open in IMG/M |
3300017784|Ga0181348_1061326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HGB0020 | 1520 | Open in IMG/M |
3300017784|Ga0181348_1083641 | Not Available | 1262 | Open in IMG/M |
3300017784|Ga0181348_1216474 | Not Available | 678 | Open in IMG/M |
3300017785|Ga0181355_1004111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6433 | Open in IMG/M |
3300017785|Ga0181355_1043333 | All Organisms → Viruses → Predicted Viral | 1923 | Open in IMG/M |
3300017785|Ga0181355_1046607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1848 | Open in IMG/M |
3300017785|Ga0181355_1096058 | Not Available | 1228 | Open in IMG/M |
3300017785|Ga0181355_1223182 | Not Available | 732 | Open in IMG/M |
3300017785|Ga0181355_1240904 | Not Available | 696 | Open in IMG/M |
3300017785|Ga0181355_1378768 | Not Available | 515 | Open in IMG/M |
3300017788|Ga0169931_10066417 | All Organisms → Viruses → Predicted Viral | 3700 | Open in IMG/M |
3300017788|Ga0169931_10126520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2361 | Open in IMG/M |
3300019784|Ga0181359_1009702 | All Organisms → Viruses → Predicted Viral | 3386 | Open in IMG/M |
3300019784|Ga0181359_1031263 | All Organisms → Viruses → Predicted Viral | 2057 | Open in IMG/M |
3300019784|Ga0181359_1063487 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
3300019784|Ga0181359_1073447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1292 | Open in IMG/M |
3300020048|Ga0207193_1144970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2010 | Open in IMG/M |
3300020048|Ga0207193_1553439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300020074|Ga0194113_10268080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1315 | Open in IMG/M |
3300020084|Ga0194110_10579116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300020151|Ga0211736_10509762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300020172|Ga0211729_10956138 | Not Available | 584 | Open in IMG/M |
3300020193|Ga0194131_10246858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300020200|Ga0194121_10205711 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
3300020222|Ga0194125_10240035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1253 | Open in IMG/M |
3300020549|Ga0207942_1023464 | Not Available | 784 | Open in IMG/M |
3300021091|Ga0194133_10136139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1785 | Open in IMG/M |
3300021438|Ga0213920_1000629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24924 | Open in IMG/M |
3300021438|Ga0213920_1004559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5368 | Open in IMG/M |
3300021438|Ga0213920_1020468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1645 | Open in IMG/M |
3300021519|Ga0194048_10306857 | Not Available | 570 | Open in IMG/M |
3300021960|Ga0222715_10645805 | Not Available | 540 | Open in IMG/M |
3300021961|Ga0222714_10330176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300021962|Ga0222713_10175359 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
3300022176|Ga0212031_1047826 | Not Available | 716 | Open in IMG/M |
3300022179|Ga0181353_1066400 | Not Available | 927 | Open in IMG/M |
3300022179|Ga0181353_1091973 | Not Available | 754 | Open in IMG/M |
3300022179|Ga0181353_1106490 | Not Available | 684 | Open in IMG/M |
3300022190|Ga0181354_1234491 | Not Available | 530 | Open in IMG/M |
3300022198|Ga0196905_1108110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300022198|Ga0196905_1119203 | Not Available | 693 | Open in IMG/M |
3300022198|Ga0196905_1145185 | Not Available | 612 | Open in IMG/M |
3300022200|Ga0196901_1034256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1968 | Open in IMG/M |
3300022200|Ga0196901_1178621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300022221|Ga0224506_10300130 | Not Available | 722 | Open in IMG/M |
3300022407|Ga0181351_1048066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1789 | Open in IMG/M |
3300022748|Ga0228702_1116966 | Not Available | 610 | Open in IMG/M |
3300022752|Ga0214917_10167270 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
3300023174|Ga0214921_10552609 | Not Available | 529 | Open in IMG/M |
3300024239|Ga0247724_1012374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
3300024289|Ga0255147_1008605 | All Organisms → Viruses → Predicted Viral | 2271 | Open in IMG/M |
3300024350|Ga0255167_1002468 | All Organisms → Viruses → Predicted Viral | 4432 | Open in IMG/M |
3300024354|Ga0255171_1022292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae | 1264 | Open in IMG/M |
3300024850|Ga0255282_1056537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HGB0020 | 690 | Open in IMG/M |
3300025585|Ga0208546_1018260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1788 | Open in IMG/M |
3300025646|Ga0208161_1014566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3125 | Open in IMG/M |
3300025646|Ga0208161_1035033 | All Organisms → Viruses → Predicted Viral | 1731 | Open in IMG/M |
3300025647|Ga0208160_1073124 | Not Available | 931 | Open in IMG/M |
3300025647|Ga0208160_1130643 | Not Available | 626 | Open in IMG/M |
3300025655|Ga0208795_1101158 | Not Available | 772 | Open in IMG/M |
3300025687|Ga0208019_1002935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8359 | Open in IMG/M |
3300025732|Ga0208784_1159749 | Not Available | 664 | Open in IMG/M |
3300025732|Ga0208784_1188354 | Not Available | 603 | Open in IMG/M |
3300025818|Ga0208542_1075011 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
3300025818|Ga0208542_1163323 | Not Available | 598 | Open in IMG/M |
3300025872|Ga0208783_10205743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300025889|Ga0208644_1129377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
3300025896|Ga0208916_10047160 | Not Available | 1762 | Open in IMG/M |
3300027134|Ga0255069_1006316 | Not Available | 1196 | Open in IMG/M |
3300027135|Ga0255073_1007743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2053 | Open in IMG/M |
3300027135|Ga0255073_1036376 | Not Available | 834 | Open in IMG/M |
3300027137|Ga0255092_1011101 | All Organisms → Viruses → Predicted Viral | 1935 | Open in IMG/M |
3300027337|Ga0255087_1011534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2108 | Open in IMG/M |
3300027337|Ga0255087_1058723 | Not Available | 709 | Open in IMG/M |
3300027541|Ga0255158_1036286 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
3300027581|Ga0209651_1014900 | All Organisms → Viruses → Predicted Viral | 2488 | Open in IMG/M |
3300027631|Ga0208133_1013039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2242 | Open in IMG/M |
3300027697|Ga0209033_1057003 | Not Available | 1384 | Open in IMG/M |
3300027710|Ga0209599_10196194 | Not Available | 544 | Open in IMG/M |
3300027712|Ga0209499_1259467 | Not Available | 598 | Open in IMG/M |
3300027733|Ga0209297_1241265 | Not Available | 697 | Open in IMG/M |
3300027744|Ga0209355_1078167 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
3300027785|Ga0209246_10342044 | Not Available | 569 | Open in IMG/M |
3300027785|Ga0209246_10376872 | Not Available | 536 | Open in IMG/M |
3300027816|Ga0209990_10263870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300027956|Ga0209820_1109596 | Not Available | 753 | Open in IMG/M |
3300028025|Ga0247723_1021929 | All Organisms → Viruses → Predicted Viral | 2135 | Open in IMG/M |
3300028025|Ga0247723_1053576 | Not Available | 1143 | Open in IMG/M |
3300028394|Ga0304730_1114406 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300028394|Ga0304730_1246254 | Not Available | 647 | Open in IMG/M |
3300029349|Ga0238435_102531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2620 | Open in IMG/M |
3300029930|Ga0119944_1006341 | Not Available | 1879 | Open in IMG/M |
3300031758|Ga0315907_11206894 | Not Available | 529 | Open in IMG/M |
3300031784|Ga0315899_10248502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1775 | Open in IMG/M |
3300031787|Ga0315900_10138746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2274 | Open in IMG/M |
3300031787|Ga0315900_10358307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
3300031787|Ga0315900_10702299 | Not Available | 716 | Open in IMG/M |
3300031857|Ga0315909_10031568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5129 | Open in IMG/M |
3300031857|Ga0315909_10067824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3207 | Open in IMG/M |
3300031857|Ga0315909_10110830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2342 | Open in IMG/M |
3300031857|Ga0315909_10466218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
3300031857|Ga0315909_10631512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300031857|Ga0315909_10658706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300031857|Ga0315909_10699380 | Not Available | 658 | Open in IMG/M |
3300031857|Ga0315909_10786331 | Not Available | 604 | Open in IMG/M |
3300031857|Ga0315909_10883243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300031951|Ga0315904_10275765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1592 | Open in IMG/M |
3300031951|Ga0315904_10351860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1355 | Open in IMG/M |
3300031951|Ga0315904_10701523 | Not Available | 851 | Open in IMG/M |
3300031951|Ga0315904_10826507 | Not Available | 759 | Open in IMG/M |
3300031951|Ga0315904_11431471 | Not Available | 513 | Open in IMG/M |
3300031963|Ga0315901_11054574 | Not Available | 563 | Open in IMG/M |
3300031999|Ga0315274_11835811 | Not Available | 554 | Open in IMG/M |
3300032092|Ga0315905_11208006 | Not Available | 617 | Open in IMG/M |
3300032093|Ga0315902_10131009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2650 | Open in IMG/M |
3300032093|Ga0315902_10583812 | Not Available | 944 | Open in IMG/M |
3300032093|Ga0315902_10794517 | Not Available | 749 | Open in IMG/M |
3300032093|Ga0315902_10810927 | Not Available | 737 | Open in IMG/M |
3300032093|Ga0315902_11013503 | Not Available | 622 | Open in IMG/M |
3300032093|Ga0315902_11148598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300032116|Ga0315903_10098440 | All Organisms → Viruses → Predicted Viral | 2800 | Open in IMG/M |
3300032116|Ga0315903_10188941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1844 | Open in IMG/M |
3300032116|Ga0315903_10918333 | Not Available | 623 | Open in IMG/M |
3300032116|Ga0315903_11109248 | Not Available | 542 | Open in IMG/M |
3300032278|Ga0310345_11050477 | Not Available | 796 | Open in IMG/M |
3300034012|Ga0334986_0099793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1742 | Open in IMG/M |
3300034061|Ga0334987_0832193 | Not Available | 510 | Open in IMG/M |
3300034101|Ga0335027_0551871 | Not Available | 711 | Open in IMG/M |
3300034104|Ga0335031_0799081 | Not Available | 528 | Open in IMG/M |
3300034105|Ga0335035_0056965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2566 | Open in IMG/M |
3300034106|Ga0335036_0732720 | Not Available | 581 | Open in IMG/M |
3300034108|Ga0335050_0468835 | Not Available | 546 | Open in IMG/M |
3300034109|Ga0335051_0350472 | Not Available | 707 | Open in IMG/M |
3300034111|Ga0335063_0292231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300034116|Ga0335068_0086480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1776 | Open in IMG/M |
3300034122|Ga0335060_0135245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1450 | Open in IMG/M |
3300034283|Ga0335007_0083661 | All Organisms → Viruses → Predicted Viral | 2394 | Open in IMG/M |
3300034283|Ga0335007_0317815 | All Organisms → Viruses → Predicted Viral | 1012 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.23% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 13.87% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.03% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.66% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.98% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.30% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.62% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.62% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.62% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.94% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.68% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.26% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.26% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.26% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.84% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.84% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.42% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.42% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.42% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.42% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.42% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.42% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.42% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.42% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.42% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.42% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.42% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.42% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300024850 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300027137 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
3300027541 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1091105241 | 3300002408 | Freshwater | MTTPTAIEVDCSTGVVTERELTAAEIAQREADAAAYAVRKAEEDAAAA |
B570J40625_1002722251 | 3300002835 | Freshwater | MATKIIVDCSTGVTTEVELTAEEIAQREVDAAAYAIEKAEREAQATAKAAAKAS |
B570J40625_1007099301 | 3300002835 | Freshwater | MPTKLIINCETGEQTEVELTAEEIVQREADAKAYEADKVAKDAA |
Ga0007787_101276161 | 3300004240 | Freshwater Lake | MPTKLIVDCSTGVTTEVELTAEEVAQREVDAVAFAEIKAAEEAAAQAK |
Ga0049081_103505141 | 3300005581 | Freshwater Lentic | MPNPTKVIVDCSTGVTTEVELTDAEVAQREADAAAYA |
Ga0049080_100203326 | 3300005582 | Freshwater Lentic | MAHKLIVDCSTGVTTEVELTAEEVAQREADAAAFAEIK |
Ga0049080_101055563 | 3300005582 | Freshwater Lentic | MANPTKLVVDCSTGITEEIELTDAEVAQMQADAETYA |
Ga0079957_11115554 | 3300005805 | Lake | MTDTPRKLIVDCSTGITSEVELTAEEIAQREADAA |
Ga0075471_105488591 | 3300006641 | Aqueous | MPTKLVVDCSTGITTEVELTAEEIAQREADAAAFAV |
Ga0070749_100543211 | 3300006802 | Aqueous | MPTKLIVDCSTGVTTEVELTAEEIAQREADAAAFAEAKA |
Ga0070749_100592095 | 3300006802 | Aqueous | MPTKLIVDCSTGAVEEIELTAEEIAQREADAEAAAQ |
Ga0070749_100793245 | 3300006802 | Aqueous | MPTKLVVDCSTGAVEEIELTAEEIAQREADAEAAAQAKA |
Ga0070749_101497311 | 3300006802 | Aqueous | MPTKLVVDCSTGVTTEVELTAEEIAQREADAAAFAEAKAK |
Ga0075473_100381205 | 3300006875 | Aqueous | MKKLVVDCSTGITTEVELTAEEVAQREADAAAYAAELAEREAEATAKAE |
Ga0075473_102579011 | 3300006875 | Aqueous | MLTKLIVDCSTGEATEVELTAEEIAQREAEIAAYAAKKAEEEAAAQAKAEA |
Ga0103959_10478631 | 3300007214 | Freshwater Lake | MEKVIVDCSTGETTIVPLTAEEIAQREADAASYAAEKAARDAE |
Ga0099848_10328035 | 3300007541 | Aqueous | MATKLIVDCSTGITTEVELTAEEIAEREAMAAEYAVQKAQEDAAKAAV |
Ga0099848_12092261 | 3300007541 | Aqueous | MTTKLVVDCSTGVVEEIPLTEEELAQREADRIAFEAAEAERVAAEAEKA |
Ga0102866_11185602 | 3300007661 | Estuarine | MTTKLVVDCSTGITTEVELTAEEVAQREADAAAYAAEQAQREAEQ |
Ga0099850_11883463 | 3300007960 | Aqueous | MHKVIVDCSTGTVTEVELTAEEIAQREADALAYAEQKAQE |
Ga0099850_12840702 | 3300007960 | Aqueous | MTQHKLVVDCSTGVTTEVELTAEEIAQREADAVAYAAQKAAEEA |
Ga0105745_12298532 | 3300007972 | Estuary Water | MPTKIIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEEAAA |
Ga0114340_11333683 | 3300008107 | Freshwater, Plankton | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAYAEQK |
Ga0114344_10258791 | 3300008111 | Freshwater, Plankton | MPTKLVVDCSTGAVEEIELTAEEIAEMELAAQQAEEQKARE |
Ga0114344_10665804 | 3300008111 | Freshwater, Plankton | MPTKLVVDCSTGVTTEVELTAEEIAQQEADAAAFAVAEAERIAAE |
Ga0114344_10820761 | 3300008111 | Freshwater, Plankton | MPTKRVVDCSTGVTTEVELTAEEIAQQEADAAAFAVAEAERIAAE |
Ga0114346_12263291 | 3300008113 | Freshwater, Plankton | MPTKLVVDCSTGVTTEVELTAEEIAQREADAAAFAVAEAERIA |
Ga0114347_12665092 | 3300008114 | Freshwater, Plankton | MPTKLSVDCSTGVTTEVELTAEEIAEREAMAAEYAVQKAEED |
Ga0114350_10249731 | 3300008116 | Freshwater, Plankton | MPTKLIVDCSTGVTTEVELTAEEIVQREADAAAHAVAEAERI |
Ga0114355_10525901 | 3300008120 | Freshwater, Plankton | MTTKIIVDCSTGVVEEVELTEEELAQREADRIAFEAAE |
Ga0114355_10601367 | 3300008120 | Freshwater, Plankton | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAYAE |
Ga0114355_11108383 | 3300008120 | Freshwater, Plankton | MPTKLIVDCSTGVTTEVELTAEEIAQAEADAAAHAVAEAERIAAEEA |
Ga0114899_11213633 | 3300008217 | Deep Ocean | MPTKIVVDCSTGITQEVELTAEEVAAQEAMEARSAERAAAEEAA |
Ga0114840_10572832 | 3300008258 | Freshwater, Plankton | MTTKIIVDCSTGVVEEVELTEEELAQREADRIAFEAAEA |
Ga0114841_12034251 | 3300008259 | Freshwater, Plankton | MPNPTKLIVDCSTGVTTEVELTDEEVAQREAEAAKVAEIKAAEEA |
Ga0114841_12687222 | 3300008259 | Freshwater, Plankton | MTHKLVVDCSTGVATEVELTAEEIAQREADAVAYAAQKAADDAAAQ |
Ga0114337_10645055 | 3300008262 | Freshwater, Plankton | MSETLTKLVVDCSTGIQTIVPLTSEEIAQREAEAAAYAVIEAEREAAA |
Ga0114349_11921703 | 3300008263 | Freshwater, Plankton | MTHKLVVDCSTGVATEVELTAEEIAQREADAIAFAEQKALDDAAAQAX* |
Ga0114363_10828973 | 3300008266 | Freshwater, Plankton | MSHKLIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEEAAAQAK |
Ga0114363_11537951 | 3300008266 | Freshwater, Plankton | MTTKIVVDCSTGVVEEVELTEEELAQREADRIAFEAAEAARLAQEAEK |
Ga0114363_12021232 | 3300008266 | Freshwater, Plankton | MADTKIVVDCSTGEVSEIELTAEEIAQRVADAKAYADEKAKE |
Ga0114363_12037623 | 3300008266 | Freshwater, Plankton | MADTKIVVDCSTGEVSEIELTAEELAQRTADAKAYADEKAAEDA |
Ga0114878_10748224 | 3300008339 | Freshwater Lake | MTTKIIVDCSTGVVEEVELTEEELAQREADRIAFEAAEAARLAQEAEK |
Ga0114876_11209521 | 3300008448 | Freshwater Lake | MATKLIVDCSTGITTEVELTAEEVAQREADAAAWAEAEAAREA |
Ga0114880_12176322 | 3300008450 | Freshwater Lake | MPTKLIINCETGEQTEVELTAEEIAQREADAAKAE |
Ga0114880_12670572 | 3300008450 | Freshwater Lake | MPTKVIVDCSTGVTTEVELSAEEVAQREADAAAFA |
Ga0104242_10556883 | 3300008962 | Freshwater | MPTKLIINCETGEQTEVELTAEEIAQREADAKAYEAELKAKEAE |
Ga0114973_103997052 | 3300009068 | Freshwater Lake | MADTKIVVDCSTGEVSEIELTAEEVAQRQADAQAFAVAKAQEEAEAA |
Ga0105103_109115362 | 3300009085 | Freshwater Sediment | MTTKLIVDCSTGITTEVELTAEEIAEREAMAAEYAVQKAQEEA |
Ga0114963_102542583 | 3300009154 | Freshwater Lake | MPNPTKLIVDCSTGVTTEVELTDEEVTQRKVDAATY |
Ga0114977_101990153 | 3300009158 | Freshwater Lake | MATKLIVDCSTGVTTEVELTAEEVAQREVDAAAWAVAEAERETE |
Ga0114959_100454276 | 3300009182 | Freshwater Lake | MPTKLIINCETGEQTEVELTDEEVAQREADAAAYAAQKAEQ |
Ga0114974_103342751 | 3300009183 | Freshwater Lake | MADTKIIVNCETGEVSEVELTAEEIKQREADAIAYAK |
Ga0127391_10528553 | 3300009450 | Meromictic Pond | MATKLVVNCSTGITTEVELTAEEIAQREADAQAWAEV |
Ga0136644_102137781 | 3300010334 | Freshwater Lake | MPTKLIINCETGEQTEVELTAEEVAQREADAAAYAVQKAEQDAAEAAK |
Ga0129333_100390179 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAYAEQKAQEEAAAQAKAE |
Ga0129333_101977344 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAFAE |
Ga0129333_101987781 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKLIVDCSTGAVEEIELTAEEIAQREADAQAAA |
Ga0129333_103697731 | 3300010354 | Freshwater To Marine Saline Gradient | MTTKLVVDCSTGAVEEIELTEDELAQREADHIAFEKAEAERVKAEAEKAAKK |
Ga0129333_103922233 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAFAEQKAQEEAAAQAKAEA |
Ga0129333_104405331 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKLIVDCSTGVTTEVELTAEEIAQMEADAAAYAEQKAQEEAAAQAK |
Ga0129333_105313903 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKLVVDCSTGVTAEVELTAEEIAQMEADAAAYAEQKAQEE |
Ga0129333_113102132 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKLIVDCSTGVTTEVELTAEEIAQREADASAFAEA |
Ga0129324_102072231 | 3300010368 | Freshwater To Marine Saline Gradient | MATKLVVDCSTGVTTEVELTAEEIAQREADAQAWAE |
Ga0129336_100787695 | 3300010370 | Freshwater To Marine Saline Gradient | MPTKLIVDCSTGVTTEVELTAEEIAQREADAAAFAEAKAIEEA |
Ga0129336_100909985 | 3300010370 | Freshwater To Marine Saline Gradient | MSRPTKLVVNCTTGEQSVVELTDEEIAQREADALAFAEQQA |
Ga0129336_101770303 | 3300010370 | Freshwater To Marine Saline Gradient | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAYAEQKAQEEAAAQAKAEAK |
Ga0129336_103619073 | 3300010370 | Freshwater To Marine Saline Gradient | MPTKLIVDCSTGVPTEVELTAEEIAQREADAAAFAEAEAQRL |
Ga0129336_104157432 | 3300010370 | Freshwater To Marine Saline Gradient | MTTKLVVDCSTGAVEEIELTEDELAQREADRIAFEKAEAERVKA |
Ga0129336_105977782 | 3300010370 | Freshwater To Marine Saline Gradient | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAYAEQKA |
Ga0151620_12070871 | 3300011268 | Freshwater | MPTKLIINCETGEQTEVELTAEEIAQREADAKAYEAELKAKEAEAAAK |
Ga0153801_10744851 | 3300012017 | Freshwater | MATKLVINCSTGEQTEVELTAEEVAQREADAEVFAEQEAIRLAE |
Ga0157138_10189451 | 3300012352 | Freshwater | MSDTPMKLIVDCATGAQTYVPLSEEEIAQREADALAAAEAEAERVA |
Ga0164293_104356453 | 3300013004 | Freshwater | MADTKIIVNCETGEVTEVELTAEEVAQREADRIAYEA |
(restricted) Ga0172373_102160694 | 3300013131 | Freshwater | MTMPTKLVVDCSTGVTTEVELTAEEIAQREADAAAFAE |
(restricted) Ga0172372_102770723 | 3300013132 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQREADAVAFAEIKAAEEAAAQAKAEA |
(restricted) Ga0172372_104834333 | 3300013132 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEVAQREADAAAYAEAKAQEEADK |
Ga0177922_105902112 | 3300013372 | Freshwater | MPTKLIVDCSTGVTTEVELTAEEIAERETMAAEYATQKAAEDAAVA |
Ga0177922_106460381 | 3300013372 | Freshwater | MTHKLVVDCSTGVATEVELTAEEIAQREADAVAFAAQKAADDAAAQAK |
(restricted) Ga0172376_107251282 | 3300014720 | Freshwater | MPTKLIVDCSTGVTTEVELTAEEIAEREAMAAEYAVQKAQE |
Ga0181364_10255243 | 3300017701 | Freshwater Lake | MTNKIVVDCSTGVTTEVELTAAEIAEREAMAAEYAVQKATEEAEAAPTT |
Ga0181363_10720432 | 3300017707 | Freshwater Lake | MTHKIIVDCSTGVTTEVELTAEEIAQREADAAAFAE |
Ga0181350_11323491 | 3300017716 | Freshwater Lake | MPTKIIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEEAAAQ |
Ga0181362_10486053 | 3300017723 | Freshwater Lake | MSHKLIIDCSTGLTTEVELTAEEVAQREADAVAFAEIKAAEEAAAQA |
Ga0181362_10499671 | 3300017723 | Freshwater Lake | MTTKIIVDCSTGVTTEVELTAEEIAQREADAAAYAVRKAEEDAAV |
Ga0181365_10392844 | 3300017736 | Freshwater Lake | MPHKLIIDCSTGVTTEVELTAEEVAQREADAVAFA |
Ga0181365_10446951 | 3300017736 | Freshwater Lake | MPTKLIVDCSTGVTTELELTAEEVAQREADAAAFA |
Ga0181356_10590504 | 3300017761 | Freshwater Lake | VPTKLIVDCSTGVTTEVELTAEEVAQREADAAAFAEIKA |
Ga0181358_10434054 | 3300017774 | Freshwater Lake | MTTKLIVDCSTGVTTEVELTAEEIAQREADAAAYAVRK |
Ga0181358_10789133 | 3300017774 | Freshwater Lake | MATKIIVDCSTGVTTEVELTAAEIAERETMAAEYAT |
Ga0181358_12073282 | 3300017774 | Freshwater Lake | MPTKIIVDCSTGQTTEVELTAAEIAEREAMAAEYAAQKAA |
Ga0181357_10517191 | 3300017777 | Freshwater Lake | MPNPTKIIVNCSTGVTTEVELTAEEIAQKEIDTAAFV |
Ga0181357_10724784 | 3300017777 | Freshwater Lake | VPTKLIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEEAAA |
Ga0181346_10317461 | 3300017780 | Freshwater Lake | MTTKIIVDCSTGVTTEVELTAEEIAERETMAAEYATQKAAEDAAI |
Ga0181348_10579521 | 3300017784 | Freshwater Lake | MPTKLIINCATGEQTEVELTAEEIAQREADARAYEAEVQAKKVEAAIKATAKAELL |
Ga0181348_10613261 | 3300017784 | Freshwater Lake | MPTKLIINCETGEQTEVELTADEIAQREADAAAYAAQK |
Ga0181348_10836413 | 3300017784 | Freshwater Lake | MPNPTKVIVDCSTGISTEVELTNAEVAQREADAAAYAVEEAAREAA |
Ga0181348_12164742 | 3300017784 | Freshwater Lake | MPNPTKIIVDCSTGVTTEVELTDEEVAQREADAAAY |
Ga0181355_10041119 | 3300017785 | Freshwater Lake | MATKLVVDCSTGVTTEVELTAEEITQREADAAAWAVAEAERETEA |
Ga0181355_10433331 | 3300017785 | Freshwater Lake | MPNPTKLIVDCSTGVTTEVELTNAEVAQREADAAAYAVEEAAREAAA |
Ga0181355_10466071 | 3300017785 | Freshwater Lake | MPNPTKLIVDCSTGISTEVELTDAEVAQREADAIAYAA |
Ga0181355_10960583 | 3300017785 | Freshwater Lake | MTHKLIVDCSTGVTTEVELTAEEIAQREADAVAFA |
Ga0181355_12231822 | 3300017785 | Freshwater Lake | MTTKIIVDCSTGVTTEVELTAAEIAQREADAAAYAVRKAEEDAAVA |
Ga0181355_12409041 | 3300017785 | Freshwater Lake | MTHKLIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEEAAAQ |
Ga0181355_13787681 | 3300017785 | Freshwater Lake | MPTKLVVDCSTGAVEEIELTAEEVAQMEADAVAAAEAKAAE |
Ga0169931_100664178 | 3300017788 | Freshwater | MPTKLIVDCSTGVTTEVELTSEEIAQREADAAAFAVA |
Ga0169931_101265201 | 3300017788 | Freshwater | MPTKLIVDCSTGVTTEVELTAEEIAQREIDAVAFAEQEAERQAQADAL |
Ga0181359_10097021 | 3300019784 | Freshwater Lake | MPNPTKLIVDCSTGVTTEVELTDEEVAQREVDAAAFAAQKAEEEAAATAIS |
Ga0181359_10312635 | 3300019784 | Freshwater Lake | MPNPTKIIVNCSTGVTTEVELTAEEIAQKEIDTAAFVARRAEEEAAAT |
Ga0181359_10634871 | 3300019784 | Freshwater Lake | MPTKVIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEE |
Ga0181359_10734471 | 3300019784 | Freshwater Lake | MPTKIIVDCSTGVTTEVELTAEEVAQREADAVAYAAQKALD |
Ga0207193_11449701 | 3300020048 | Freshwater Lake Sediment | MPTKLIINCETGEQTEVELTAEEIAQREADAKAYEADKKAKEADAATKA |
Ga0207193_15534391 | 3300020048 | Freshwater Lake Sediment | MADTKIVVDCSTGEVSEIELTAEEVAQRTADAKTYADEKAKEEADAAAKA |
Ga0194113_102680801 | 3300020074 | Freshwater Lake | MPTKIVVDCSTGVTTEVELTAEEIAQREADAVAFAEIKAAEEA |
Ga0194110_105791161 | 3300020084 | Freshwater Lake | MTMPTKLIVDCSTGVTTEVELTAEEIAQREADAAAFAEIKAAEDAA |
Ga0211736_105097623 | 3300020151 | Freshwater | MPTKIIVDCSTGVTTEVELTAEEIAEREAMAAEYAVQKAA |
Ga0211729_109561381 | 3300020172 | Freshwater | MTHKLVVDCSTGVATEVELTAEEIAQREADAVAFAAQKALD |
Ga0194131_102468583 | 3300020193 | Freshwater Lake | MEKVIVNCETGEQTVVPLTAEEIAQREADAVAFAEIKAAEEAAAQAKA |
Ga0194121_102057111 | 3300020200 | Freshwater Lake | MPTKIVVDCSTGVTTEVELTAEEIAQREADAAAFAEIKAA |
Ga0194125_102400354 | 3300020222 | Freshwater Lake | MPTKLIVDCSTGVTTEVELTAEEIAQREADAVAFAEIKTAEEAAA |
Ga0207942_10234641 | 3300020549 | Freshwater | MATKIIVDCSTGVTTEVELTAEEIAQREVDAAAYA |
Ga0194133_101361394 | 3300021091 | Freshwater Lake | MPTKLIVDCSTGVTTEVELTAEEIAQREADAVAFAEIK |
Ga0213920_100062937 | 3300021438 | Freshwater | MTAPLTKLVVDCSTGEQTIVELTAEEIAQREADAQAYAEAKAIKD |
Ga0213920_10045598 | 3300021438 | Freshwater | MPTKLIINCETGEQTEVELTAEEIAQREADAKAYEAEKKAQEVIAASKAK |
Ga0213920_10204684 | 3300021438 | Freshwater | MPTKLIINCETGEQTEVELTAEEIAQREADAKAYEAEKKAQ |
Ga0194048_103068571 | 3300021519 | Anoxic Zone Freshwater | MATKLIIDCVTGATTEVELSVEEIAQREADAESFAEA |
Ga0222715_102455563 | 3300021960 | Estuarine Water | MSDTPQKLIVNVSTGERTYVDLTAEEIAQREADAAAYAQELADAE |
Ga0222715_106458051 | 3300021960 | Estuarine Water | MTHKLLVDCSTGVTTEVELTAEELAQREADAVAYAAQKALDDAAAQAKAEAKA |
Ga0222714_103301763 | 3300021961 | Estuarine Water | MPTKLIVDCSTGETTEVELTAEEIAQREADAAAFAVAEAERIA |
Ga0222713_101753591 | 3300021962 | Estuarine Water | MPTKLVVDCSTGVTSEVELTAEEIAQQEADAAAFAV |
Ga0212031_10478261 | 3300022176 | Aqueous | MHKVIVDCSTGTVTEVELTAEEIAQREADALAYAEQKAQEEAEAIAKAA |
Ga0181353_10664003 | 3300022179 | Freshwater Lake | MTHKIIVDCSTGVTTEVELTAEEIAQREADAAAFAEIKAAEEAAAQA |
Ga0181353_10919731 | 3300022179 | Freshwater Lake | MPTKLIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEEAAAQA |
Ga0181353_11064901 | 3300022179 | Freshwater Lake | MPTKLIINCETGEQTEVELTAEEIAQREADAKAYEAELKAKEVEA |
Ga0181354_12344912 | 3300022190 | Freshwater Lake | MPNPTKLIVDCSTGISTEVELTDEEVAQREADAEAYATQK |
Ga0196905_11081101 | 3300022198 | Aqueous | MPTKLVVDCSTGVTTEVELTAEEIAQREADAAAFAEAKAKEEAE |
Ga0196905_11192032 | 3300022198 | Aqueous | MPTKLVVDCSTGVTTEVELTAEEIAQREADAAAFAEAE |
Ga0196905_11451852 | 3300022198 | Aqueous | MTTKLIVDCSTGITTEVELTAEEIAEREAMAAEYAVQKAQE |
Ga0196901_10342561 | 3300022200 | Aqueous | MHKVIVDCSTGTVTEVELTAEEIAQREADALAYAEQKAIEEA |
Ga0196901_11786212 | 3300022200 | Aqueous | MTHKLVVDCSTGVTTEVELTAEEIAQREADAAAFAEIKAAEEAA |
Ga0224506_103001303 | 3300022221 | Sediment | MATKLIVDCSTGITTEVELTAEEVAQREADALAYAE |
Ga0181351_10480665 | 3300022407 | Freshwater Lake | MAQHKLVVDCSTGVTTEVELTAEEVAQREADAVAYA |
Ga0228702_11169662 | 3300022748 | Freshwater | MPTKVIVDCSTGISTEVELTAEEVAQMEADAAAYAVRKAEEDAAAE |
Ga0214917_101672701 | 3300022752 | Freshwater | MTDTPRKLVVDCSTGVTTEVELTAEEIAQREADAAAFAEAEAARKAE |
Ga0214921_105526091 | 3300023174 | Freshwater | MPTKLIINCETGVQEEIELTDEEVAQLEADRLAAEV |
Ga0247724_10123741 | 3300024239 | Deep Subsurface Sediment | MVSKLVVDCSTGITTEVELTAEEIAQREADASAYAEAEAERLAAEEAKAEA |
Ga0255147_10086055 | 3300024289 | Freshwater | MTDTPRKLVVDCSTGVTTEVELTAEEIAQMEADAAAFAVAEAERIAQEEAKA |
Ga0255167_10024681 | 3300024350 | Freshwater | MTDTPRKLVVDCSTGVTTEVELTAEEIAQMEADAAAFAVAEAERIAQEEAKAA |
Ga0255171_10222924 | 3300024354 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAYAEQKAQE |
Ga0255282_10565372 | 3300024850 | Freshwater | MTDTPRKLVVDCSTGVTTEVELTAEEIAQMEADAAAFAVAE |
Ga0208546_10182605 | 3300025585 | Aqueous | MATKLVVDCSTGITTEVELTAEEVAQREADALAWALAEAEREAEAAAK |
Ga0208161_10145661 | 3300025646 | Aqueous | MATKLIVDCSTGITTEVELTAEEIAEREAMAAEYAVQK |
Ga0208161_10350334 | 3300025646 | Aqueous | MTQHKLVVDCSTGVTTEVELTAEEIAQREADAVAFAEIKAAEEAA |
Ga0208160_10731243 | 3300025647 | Aqueous | MTTKLIVDCSTGITTEVELTAEEIAEREAMAAEYAVQKAQEDAAKAAVQA |
Ga0208160_11306432 | 3300025647 | Aqueous | MTTKLVVDCSTGVVEEIELTEEELAQREADRIAFEAAE |
Ga0208795_11011581 | 3300025655 | Aqueous | MHKVIVDCSTGTVTEVELTAEEIAQREADALAYAEQKAQEE |
Ga0208019_100293514 | 3300025687 | Aqueous | MHKVIVDCSTGTVTEVELTAEEIAQREADALAYAEQKAQEEAE |
Ga0208784_11597492 | 3300025732 | Aqueous | MLTKLIVDCSTGEATEVELTAEEIAQREAEIAAYAAKK |
Ga0208784_11883542 | 3300025732 | Aqueous | MKKLVVDCSTGITTEVELTAEEVAQREADAAAYAAELAEREAEATA |
Ga0208542_10750113 | 3300025818 | Aqueous | MPTKLIVDCSTGVTTEVELTAEEIAQREADAAAFAEA |
Ga0208542_11633231 | 3300025818 | Aqueous | MATKLIVDCSTGITTEAELTAEEVADREAAAEAFALEEAE |
Ga0208783_102057431 | 3300025872 | Aqueous | MATKLVVDCSTGITTEVELTAEEVAQREADALAWALAEAEREAE |
Ga0208644_11293773 | 3300025889 | Aqueous | MHKVIVDCSTGTVTEVELTAEEIAQREADALAYAEQKAQEEAEAIAKAAAKAEVL |
Ga0208916_100471604 | 3300025896 | Aqueous | MPNPTKLIVDCSTGVTTEVELTAEEIAQREADAKAYEA |
Ga0255069_10063161 | 3300027134 | Freshwater | MPTKVIVDCSTGVTTEVELTAEEVAQREADAAAFAEIKAAEEAAAQAK |
Ga0255073_10077435 | 3300027135 | Freshwater | MATKLIINCSTGEQTEVELTAEEVAQREADAEAFAE |
Ga0255073_10363761 | 3300027135 | Freshwater | MPTKVIVDCSTGVTTEVELTAEEVAQREADAAAFAEIKAAEEAAA |
Ga0255092_10111015 | 3300027137 | Freshwater | MPTKVIVDCSTGVTTEVELTAEEVAQREADAVAFA |
Ga0255087_10115341 | 3300027337 | Freshwater | MPTKVIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEEAAAQ |
Ga0255087_10587231 | 3300027337 | Freshwater | MPHKLIVDCSTGVTTEVELTAEEVAQREADAVAFAEIKAAEEAAAQAKADA |
Ga0255158_10362863 | 3300027541 | Freshwater | MTHKLVVDCSTGVTTEVELTAEEIAQREADAAAFA |
Ga0209651_10149001 | 3300027581 | Freshwater Lake | MPTKIIVDCSTGQTTEVELTAAEIAEREAMAAEYAAQKA |
Ga0208133_10130395 | 3300027631 | Estuarine | MSHKLIVDCSTGVTTEVELTAEEVAQREVDAVAFAEIKAAEEAAAQAKADAKAS |
Ga0209033_10570031 | 3300027697 | Freshwater Lake | MPTKLIVDCSTGVTTEVELTAEEVAQREADAAAFAEIKALDDAAA |
Ga0209599_101961941 | 3300027710 | Deep Subsurface | MPTKLIVDCSTGISTEVELTDAEVAQREADAAAYAAQKAEQD |
Ga0209499_12594672 | 3300027712 | Freshwater Lake | MPTKLIINCETGEQTEVELTAEEVAQREADAAAYAVQKAEQDA |
Ga0209297_12412652 | 3300027733 | Freshwater Lake | MATKLIVDCSTGVTTEVELTAEEVAQREVDAAAWAVAEAERE |
Ga0209355_10781674 | 3300027744 | Freshwater Lake | MPNPTKLIVDCSTGVTTEVELTDAEVAQREADAAA |
Ga0209500_101052414 | 3300027782 | Freshwater Lake | MTKLTRLEVNCTTGEVQEIELTAEEIKQRETDTAIAK |
Ga0209246_103420442 | 3300027785 | Freshwater Lake | MTTKLIVDCSTGITTEVELTAAEIAQREADAAAYAVQKAEEDAVAAAK |
Ga0209246_103768722 | 3300027785 | Freshwater Lake | MPNPTKIIVNCSTGVTTEVELTAEEIAQKEIDTAAFVA |
Ga0209990_102638703 | 3300027816 | Freshwater Lake | MADTKIVVDCSTGEVSEIELTAEEVAQRAADAQAFADAKAA |
Ga0209820_11095963 | 3300027956 | Freshwater Sediment | MTTKLVVDCSTGVVEEIELTEEELAQREADRIAFE |
Ga0247723_10219291 | 3300028025 | Deep Subsurface Sediment | MADTKIVVNCETGEVQELELTADEVAQREADAAAYAEA |
Ga0247723_10535761 | 3300028025 | Deep Subsurface Sediment | MATKLVVDCSTGITTEVELTAEEVAQREVDAVAWAE |
Ga0304730_11144061 | 3300028394 | Freshwater Lake | MATKLIVDCSTGITTEVELTAEEIAQQEADATAAATRKAEEDAAIAAK |
Ga0304730_12462541 | 3300028394 | Freshwater Lake | MTTKLIVDCSTGVTTEVELTAEEIAEREAMAAEYATQKAAKDA |
Ga0238435_1025311 | 3300029349 | Freshwater | MANTKIIVDCSTGEVSEIELTAEEVAQREADAKTYADEKAKEEADKAAK |
Ga0119944_10063415 | 3300029930 | Aquatic | MTTKLVVDCSTGVVEEVELTEEELAQREADAKAFEAAEKERKA |
Ga0315907_104826453 | 3300031758 | Freshwater | MTTKIVVDCSTGVVEEVELTEEELAQREADRIAFEAAEAARLAQEAE |
Ga0315907_112068941 | 3300031758 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAYAEQKAQ |
Ga0315899_102485021 | 3300031784 | Freshwater | MPNPTKLIVDCSTGVTTEVELTDEEIAQREASAAAYAIEQA |
Ga0315900_101387461 | 3300031787 | Freshwater | MTTKIIVDCSTGVVEEVELTEEELAQREADRIAFEAAEAA |
Ga0315900_103583071 | 3300031787 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQREADAAAFAVA |
Ga0315900_107022992 | 3300031787 | Freshwater | MPTKVIVDCSTGVTTEVELTAEEIAQMQADAAAYAAQQAEREAAE |
Ga0315909_100315681 | 3300031857 | Freshwater | MTHKLVVDCSTGVATEVELTAEELAQREADAVAFAAQKALDD |
Ga0315909_100678246 | 3300031857 | Freshwater | MPTKLIINCETGEQTEVELTAEEIAQREADAKAYEAEQKA |
Ga0315909_101108301 | 3300031857 | Freshwater | MTHKLVVDCSTGVATEVELTAEEIAQREADAVAYAAQK |
Ga0315909_104662181 | 3300031857 | Freshwater | MADTKIVVDCSTGEVSEIELTAEEVAQREADAKAHADQKAAEEADKVA |
Ga0315909_106315121 | 3300031857 | Freshwater | MPTKIIVDCSTGVTTEVELTAEEIAQREVDRIAYEA |
Ga0315909_106587061 | 3300031857 | Freshwater | MPNPTKIIINCTTGEQTEVELTAEEIAQREADAVKAEADRAAREAEEAAKAA |
Ga0315909_106993801 | 3300031857 | Freshwater | MTTKIIVDCSTGVVEEVELTEEELAQREADRIAFEA |
Ga0315909_107863312 | 3300031857 | Freshwater | MSETLTKLVVDCSTGIQTIVPLTSEEIAQREAEAAAYAVIEAEREAAAE |
Ga0315909_108832431 | 3300031857 | Freshwater | MANPTKLVVDCSTGITEEIELTDDEVAQMQADAQASAEAKALE |
Ga0315904_102757651 | 3300031951 | Freshwater | MADTKIVVDCSTGEVSEIELTAEEVAQRAADAQAFADAK |
Ga0315904_103518604 | 3300031951 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQAEADAAAHAVAE |
Ga0315904_107015231 | 3300031951 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQAEADAVAFAQAEAQRIAQEEAK |
Ga0315904_107863371 | 3300031951 | Freshwater | MTTKIVVDCSTGVVEEVELTEEELAQREADRIAFEAAEAARLAQEAEKAAKK |
Ga0315904_108265073 | 3300031951 | Freshwater | MPTKLVVDCSTGQTSEVELTAEEIAQREADAAAFAVAEAE |
Ga0315904_114314711 | 3300031951 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQAEADAQAAAVAK |
Ga0315901_110545742 | 3300031963 | Freshwater | MPTKLVVDCSTGAVEEIELTAEEIAEMELAARKAEEQKA |
Ga0315274_118358111 | 3300031999 | Sediment | MADTKIIVDCSTGIITEVELTAAEIEQRAVDAAAYAARKAE |
Ga0315905_112080061 | 3300032092 | Freshwater | MTTKIIVDCSTGVVEEVELTEEELAQREADRIAFEAAEAAREAEA |
Ga0315902_101310096 | 3300032093 | Freshwater | MADTKIVVDCSTGEVSEIELTAEEVAQREADAKAFAKDKAKKDADKAAA |
Ga0315902_105838123 | 3300032093 | Freshwater | MADTKIVVDCSTGEVSEIELTAEEVAQRAADAQAFADAKA |
Ga0315902_107945173 | 3300032093 | Freshwater | MPTKLIVDCSTGISTEVELTAEEIAQAATDAAAYATR |
Ga0315902_108109273 | 3300032093 | Freshwater | MSETLTKLVVDCSTGIQTIVPLTSEEIAQREAEAAAY |
Ga0315902_110135031 | 3300032093 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQREADAVAYAAQKATEEA |
Ga0315902_111485982 | 3300032093 | Freshwater | MSHKLIVDCSTGVTTEVELTAEEIAQREADAAAFAEIKAAE |
Ga0315903_100984401 | 3300032116 | Freshwater | MPTKLVVDCSTGVTTEVELTAEEIAQMEADAAAYAEQ |
Ga0315903_101889411 | 3300032116 | Freshwater | MPTKLVVDCSTGEVSEVELTAEEIAQREADAQAFAEAEAAR |
Ga0315903_109183332 | 3300032116 | Freshwater | MPTKLIVDCSTGISTEVELTAEEIAQAATDAAAYAT |
Ga0315903_111092482 | 3300032116 | Freshwater | MPTKIIVDCSTGVTTEVELTAEEIAERDAMAAEYEAEQ |
Ga0310345_110504773 | 3300032278 | Seawater | MPTKLVHDCSTGISEIVELTAEEIAQGDADRAAFDAD |
Ga0334986_0099793_1624_1740 | 3300034012 | Freshwater | MSNPTKLIVDCSTGVTTEVELTDEEVAKREADAAAYAAQ |
Ga0335024_0269506_765_881 | 3300034051 | Freshwater | MADTKIIVNCETGEVSEVELTAEEIKQREADAIAYAKAK |
Ga0334987_0832193_359_508 | 3300034061 | Freshwater | MPTKLIINCETGEQTEVELTAEEIAQREADAKAYEADKKAKDAELAAQAK |
Ga0335027_0551871_1_126 | 3300034101 | Freshwater | MTTKLVVDCSTGVVEEIELTEEELAQREADRVAFEAAEAERV |
Ga0335031_0799081_394_528 | 3300034104 | Freshwater | MTTKLIVDCSTGITTEVELTAEEIAEREAMAAEYAVQKAQEDAEK |
Ga0335035_0056965_2446_2565 | 3300034105 | Freshwater | MATKLVINCTTGEQTEVELTAEEVAQREADAEAFAEQEAL |
Ga0335036_0732720_3_125 | 3300034106 | Freshwater | MPNPTKVIVDCSTGVSTEVELTDAEVAQREADAAAYATRKA |
Ga0335050_0468835_3_119 | 3300034108 | Freshwater | MPNPTKVIVDCSTGISTEVELTDAEVAQREADAAAYAAR |
Ga0335051_0350472_2_184 | 3300034109 | Freshwater | MESKIPSNERKKMPNPTKIIVDCSTGVTTEVELTDEEVAQREADAIATAAAQAEREAAET |
Ga0335063_0292231_2_136 | 3300034111 | Freshwater | MADTKIVVDCSTGEVSEIELTAEEVAQRAADAKAFADDKAVEEAE |
Ga0335068_0086480_1616_1774 | 3300034116 | Freshwater | MADTKIVVDCSTGEVSEIELTAEEIAQRAADAQAYAEDKAKENADKAAAEAAK |
Ga0335060_0135245_1315_1449 | 3300034122 | Freshwater | MATKLIVDCSTGVTTEVELTAEEVAQREADAEAFAEQETIRLAEV |
Ga0335007_0083661_2251_2394 | 3300034283 | Freshwater | MATKLIVDCSTGVTTEVELTAEEITQREADAAAYAVAEAEREAEATAK |
Ga0335007_0317815_2_109 | 3300034283 | Freshwater | MPNPTKLVVDCSTGITEEIELTDAEVAQMQAEAETY |
⦗Top⦘ |