Basic Information | |
---|---|
Family ID | F017510 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 240 |
Average Sequence Length | 43 residues |
Representative Sequence | AREHIDKLSRKYVGTDYRNPIGPQGRVILKVAPDKVNTPRSLGRR |
Number of Associated Samples | 197 |
Number of Associated Scaffolds | 240 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.25 % |
% of genes near scaffold ends (potentially truncated) | 98.33 % |
% of genes from short scaffolds (< 2000 bps) | 92.50 % |
Associated GOLD sequencing projects | 184 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (51.250 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.917 % of family members) |
Environment Ontology (ENVO) | Unclassified (15.417 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.083 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.29% β-sheet: 2.74% Coil/Unstructured: 73.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 240 Family Scaffolds |
---|---|---|
PF11248 | DUF3046 | 35.00 |
PF06053 | DUF929 | 5.00 |
PF03988 | DUF347 | 4.17 |
PF13845 | Septum_form | 2.08 |
PF02803 | Thiolase_C | 1.67 |
PF08044 | DUF1707 | 1.67 |
PF01979 | Amidohydro_1 | 1.25 |
PF13350 | Y_phosphatase3 | 1.25 |
PF05598 | DUF772 | 1.25 |
PF12727 | PBP_like | 1.25 |
PF08241 | Methyltransf_11 | 1.25 |
PF01548 | DEDD_Tnp_IS110 | 0.83 |
PF00480 | ROK | 0.83 |
PF00248 | Aldo_ket_red | 0.83 |
PF02583 | Trns_repr_metal | 0.83 |
PF01636 | APH | 0.83 |
PF01741 | MscL | 0.83 |
PF13279 | 4HBT_2 | 0.83 |
PF00583 | Acetyltransf_1 | 0.83 |
PF00403 | HMA | 0.42 |
PF10127 | RlaP | 0.42 |
PF01161 | PBP | 0.42 |
PF13460 | NAD_binding_10 | 0.42 |
PF00004 | AAA | 0.42 |
PF00154 | RecA | 0.42 |
PF00296 | Bac_luciferase | 0.42 |
PF03951 | Gln-synt_N | 0.42 |
PF13649 | Methyltransf_25 | 0.42 |
PF01872 | RibD_C | 0.42 |
PF13531 | SBP_bac_11 | 0.42 |
PF07690 | MFS_1 | 0.42 |
PF08734 | GYD | 0.42 |
PF02148 | zf-UBP | 0.42 |
PF11387 | DUF2795 | 0.42 |
PF04185 | Phosphoesterase | 0.42 |
PF01370 | Epimerase | 0.42 |
PF03061 | 4HBT | 0.42 |
PF01209 | Ubie_methyltran | 0.42 |
PF09957 | VapB_antitoxin | 0.42 |
PF07729 | FCD | 0.42 |
PF01177 | Asp_Glu_race | 0.42 |
PF14542 | Acetyltransf_CG | 0.42 |
PF08220 | HTH_DeoR | 0.42 |
PF00440 | TetR_N | 0.42 |
PF05721 | PhyH | 0.42 |
PF00578 | AhpC-TSA | 0.42 |
PF03781 | FGE-sulfatase | 0.42 |
PF14230 | DUF4333 | 0.42 |
PF00805 | Pentapeptide | 0.42 |
PF00486 | Trans_reg_C | 0.42 |
PF01609 | DDE_Tnp_1 | 0.42 |
PF07722 | Peptidase_C26 | 0.42 |
PF00392 | GntR | 0.42 |
PF02371 | Transposase_20 | 0.42 |
PF01471 | PG_binding_1 | 0.42 |
PF02668 | TauD | 0.42 |
COG ID | Name | Functional Category | % Frequency in 240 Family Scaffolds |
---|---|---|---|
COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 4.17 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.67 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.67 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.25 |
COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.83 |
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.42 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.42 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.42 |
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.42 |
COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.42 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.42 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.42 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.42 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.42 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.42 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.42 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.42 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.42 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.42 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.42 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.42 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.42 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.42 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.42 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.42 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.42 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.42 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.42 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.42 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 51.25 % |
All Organisms | root | All Organisms | 48.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001471|JGI12712J15308_10116587 | Not Available | 681 | Open in IMG/M |
3300001471|JGI12712J15308_10201315 | Not Available | 523 | Open in IMG/M |
3300001593|JGI12635J15846_10912363 | Not Available | 501 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100985968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 727 | Open in IMG/M |
3300004092|Ga0062389_103699802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
3300004617|Ga0068955_1266194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 895 | Open in IMG/M |
3300004635|Ga0062388_100055737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2606 | Open in IMG/M |
3300005327|Ga0070658_10578226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 973 | Open in IMG/M |
3300005332|Ga0066388_106619241 | Not Available | 584 | Open in IMG/M |
3300005335|Ga0070666_10420469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 962 | Open in IMG/M |
3300005338|Ga0068868_101609035 | Not Available | 610 | Open in IMG/M |
3300005435|Ga0070714_100362304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1363 | Open in IMG/M |
3300005435|Ga0070714_101825647 | Not Available | 593 | Open in IMG/M |
3300005435|Ga0070714_102211886 | Not Available | 535 | Open in IMG/M |
3300005435|Ga0070714_102282412 | Not Available | 526 | Open in IMG/M |
3300005436|Ga0070713_101619327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300005437|Ga0070710_10327573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1007 | Open in IMG/M |
3300005437|Ga0070710_11071073 | Not Available | 590 | Open in IMG/M |
3300005439|Ga0070711_101868224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis mediterranei | 527 | Open in IMG/M |
3300005445|Ga0070708_100040794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4066 | Open in IMG/M |
3300005524|Ga0070737_10052079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2214 | Open in IMG/M |
3300005563|Ga0068855_100516412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1296 | Open in IMG/M |
3300005564|Ga0070664_100774698 | Not Available | 896 | Open in IMG/M |
3300005564|Ga0070664_101338091 | Not Available | 677 | Open in IMG/M |
3300005586|Ga0066691_10945573 | Not Available | 507 | Open in IMG/M |
3300005602|Ga0070762_10443306 | Not Available | 843 | Open in IMG/M |
3300005602|Ga0070762_11258547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
3300005610|Ga0070763_10055808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1892 | Open in IMG/M |
3300005614|Ga0068856_100783208 | Not Available | 973 | Open in IMG/M |
3300005614|Ga0068856_102214173 | Not Available | 558 | Open in IMG/M |
3300005764|Ga0066903_103829016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
3300005764|Ga0066903_106225094 | Not Available | 624 | Open in IMG/M |
3300005841|Ga0068863_100453506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1259 | Open in IMG/M |
3300005921|Ga0070766_10163508 | Not Available | 1371 | Open in IMG/M |
3300006028|Ga0070717_10668113 | Not Available | 943 | Open in IMG/M |
3300006028|Ga0070717_11370699 | Not Available | 642 | Open in IMG/M |
3300006057|Ga0075026_100689684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300006102|Ga0075015_100547885 | Not Available | 672 | Open in IMG/M |
3300006175|Ga0070712_100403582 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300006176|Ga0070765_100139697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2149 | Open in IMG/M |
3300006176|Ga0070765_100602024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1036 | Open in IMG/M |
3300006642|Ga0075521_10311115 | Not Available | 759 | Open in IMG/M |
3300006642|Ga0075521_10518772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 584 | Open in IMG/M |
3300006755|Ga0079222_10484025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 899 | Open in IMG/M |
3300006804|Ga0079221_10086462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1505 | Open in IMG/M |
3300006804|Ga0079221_10204817 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300006804|Ga0079221_10331438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 909 | Open in IMG/M |
3300006880|Ga0075429_101284763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300006903|Ga0075426_11334392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300006953|Ga0074063_10058593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 799 | Open in IMG/M |
3300006954|Ga0079219_10391010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
3300006954|Ga0079219_11291335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus ruber | 641 | Open in IMG/M |
3300009098|Ga0105245_11821990 | Not Available | 661 | Open in IMG/M |
3300009101|Ga0105247_11086062 | Not Available | 630 | Open in IMG/M |
3300009174|Ga0105241_11959890 | Not Available | 575 | Open in IMG/M |
3300009520|Ga0116214_1000130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 32420 | Open in IMG/M |
3300009524|Ga0116225_1162687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
3300009525|Ga0116220_10558607 | Not Available | 523 | Open in IMG/M |
3300009698|Ga0116216_10219857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1163 | Open in IMG/M |
3300010045|Ga0126311_10615457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 861 | Open in IMG/M |
3300010047|Ga0126382_12425477 | Not Available | 510 | Open in IMG/M |
3300010048|Ga0126373_11338230 | Not Available | 782 | Open in IMG/M |
3300010323|Ga0134086_10163410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 818 | Open in IMG/M |
3300010360|Ga0126372_11901750 | Not Available | 640 | Open in IMG/M |
3300010371|Ga0134125_12494831 | Not Available | 562 | Open in IMG/M |
3300010371|Ga0134125_12904154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
3300010375|Ga0105239_10998720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
3300010379|Ga0136449_100414941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2381 | Open in IMG/M |
3300010396|Ga0134126_11913807 | Not Available | 649 | Open in IMG/M |
3300010396|Ga0134126_11987188 | Not Available | 636 | Open in IMG/M |
3300010396|Ga0134126_12023907 | Not Available | 629 | Open in IMG/M |
3300010397|Ga0134124_10461178 | Not Available | 1222 | Open in IMG/M |
3300010397|Ga0134124_12025757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
3300010869|Ga0126359_1061869 | Not Available | 516 | Open in IMG/M |
3300010876|Ga0126361_10434404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1308 | Open in IMG/M |
3300010880|Ga0126350_10043553 | Not Available | 1205 | Open in IMG/M |
3300010880|Ga0126350_10365712 | Not Available | 995 | Open in IMG/M |
3300010880|Ga0126350_10565393 | Not Available | 746 | Open in IMG/M |
3300010937|Ga0137776_1191557 | Not Available | 608 | Open in IMG/M |
3300012205|Ga0137362_11213606 | Not Available | 639 | Open in IMG/M |
3300012207|Ga0137381_11739349 | Not Available | 513 | Open in IMG/M |
3300012363|Ga0137390_11677053 | Not Available | 571 | Open in IMG/M |
3300012469|Ga0150984_123270292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 765 | Open in IMG/M |
3300012951|Ga0164300_10308109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
3300012957|Ga0164303_10212829 | Not Available | 1079 | Open in IMG/M |
3300012960|Ga0164301_11113238 | Not Available | 629 | Open in IMG/M |
3300012971|Ga0126369_13428403 | Not Available | 519 | Open in IMG/M |
3300012985|Ga0164308_11009319 | Not Available | 740 | Open in IMG/M |
3300012986|Ga0164304_11172804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300012988|Ga0164306_11657015 | Not Available | 553 | Open in IMG/M |
3300012989|Ga0164305_11032612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
3300013104|Ga0157370_10518471 | Not Available | 1094 | Open in IMG/M |
3300013296|Ga0157374_10795227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 961 | Open in IMG/M |
3300013306|Ga0163162_12082799 | Not Available | 651 | Open in IMG/M |
3300013307|Ga0157372_11191482 | Not Available | 880 | Open in IMG/M |
3300014165|Ga0181523_10543828 | Not Available | 640 | Open in IMG/M |
3300014501|Ga0182024_10453624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae | 1643 | Open in IMG/M |
3300014657|Ga0181522_11063704 | Not Available | 502 | Open in IMG/M |
3300014969|Ga0157376_11321948 | Not Available | 751 | Open in IMG/M |
3300016445|Ga0182038_11841069 | Not Available | 547 | Open in IMG/M |
3300017821|Ga0187812_1155661 | Not Available | 735 | Open in IMG/M |
3300017932|Ga0187814_10232806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 696 | Open in IMG/M |
3300017933|Ga0187801_10054334 | Not Available | 1461 | Open in IMG/M |
3300017943|Ga0187819_10513170 | Not Available | 683 | Open in IMG/M |
3300017955|Ga0187817_10154965 | Not Available | 1457 | Open in IMG/M |
3300017959|Ga0187779_10441354 | Not Available | 854 | Open in IMG/M |
3300017970|Ga0187783_10385726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1018 | Open in IMG/M |
3300017970|Ga0187783_10481332 | Not Available | 900 | Open in IMG/M |
3300017972|Ga0187781_11495919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300017973|Ga0187780_10113232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1871 | Open in IMG/M |
3300018001|Ga0187815_10041416 | Not Available | 1946 | Open in IMG/M |
3300018007|Ga0187805_10572474 | Not Available | 532 | Open in IMG/M |
3300018013|Ga0187873_1185665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
3300018054|Ga0184621_10001966 | All Organisms → cellular organisms → Bacteria | 5206 | Open in IMG/M |
3300018058|Ga0187766_10652057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
3300018060|Ga0187765_10682935 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300018060|Ga0187765_10721750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
3300018089|Ga0187774_10903166 | Not Available | 607 | Open in IMG/M |
3300018431|Ga0066655_11423581 | Not Available | 504 | Open in IMG/M |
3300018468|Ga0066662_12516745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300018482|Ga0066669_10087659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2118 | Open in IMG/M |
3300019767|Ga0190267_10481871 | Not Available | 726 | Open in IMG/M |
3300019890|Ga0193728_1295954 | Not Available | 617 | Open in IMG/M |
3300020580|Ga0210403_10335652 | Not Available | 1237 | Open in IMG/M |
3300020581|Ga0210399_11047772 | Not Available | 655 | Open in IMG/M |
3300021088|Ga0210404_10445929 | Not Available | 727 | Open in IMG/M |
3300021178|Ga0210408_10336526 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300021181|Ga0210388_11264548 | Not Available | 624 | Open in IMG/M |
3300021388|Ga0213875_10096444 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300021402|Ga0210385_10049147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2808 | Open in IMG/M |
3300021402|Ga0210385_11288538 | Not Available | 560 | Open in IMG/M |
3300021403|Ga0210397_10381103 | Not Available | 1051 | Open in IMG/M |
3300021403|Ga0210397_10395233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
3300021404|Ga0210389_10664162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300021405|Ga0210387_10920521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
3300021405|Ga0210387_11032173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
3300021406|Ga0210386_10059014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3063 | Open in IMG/M |
3300021406|Ga0210386_11066461 | Not Available | 687 | Open in IMG/M |
3300021407|Ga0210383_10029324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 4599 | Open in IMG/M |
3300021476|Ga0187846_10454548 | Not Available | 524 | Open in IMG/M |
3300021559|Ga0210409_10397173 | Not Available | 1234 | Open in IMG/M |
3300021560|Ga0126371_12423658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 635 | Open in IMG/M |
3300021560|Ga0126371_13199095 | Not Available | 554 | Open in IMG/M |
3300022734|Ga0224571_103484 | Not Available | 1015 | Open in IMG/M |
3300022840|Ga0224549_1056805 | Not Available | 534 | Open in IMG/M |
3300024181|Ga0247693_1040229 | Not Available | 662 | Open in IMG/M |
3300024227|Ga0228598_1039266 | Not Available | 934 | Open in IMG/M |
3300024288|Ga0179589_10071772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1358 | Open in IMG/M |
3300025464|Ga0208076_1010640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1547 | Open in IMG/M |
3300025527|Ga0208714_1020696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1608 | Open in IMG/M |
3300025878|Ga0209584_10101349 | Not Available | 1063 | Open in IMG/M |
3300025916|Ga0207663_11115181 | Not Available | 634 | Open in IMG/M |
3300025922|Ga0207646_11298547 | Not Available | 636 | Open in IMG/M |
3300025929|Ga0207664_11967487 | Not Available | 507 | Open in IMG/M |
3300025931|Ga0207644_10439185 | Not Available | 1071 | Open in IMG/M |
3300025938|Ga0207704_11146660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
3300025945|Ga0207679_11482728 | Not Available | 622 | Open in IMG/M |
3300026088|Ga0207641_10702755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ventii | 996 | Open in IMG/M |
3300026329|Ga0209375_1247071 | Not Available | 602 | Open in IMG/M |
3300027050|Ga0209325_1014570 | Not Available | 899 | Open in IMG/M |
3300027058|Ga0209111_1012678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 944 | Open in IMG/M |
3300027660|Ga0209736_1059298 | Not Available | 1077 | Open in IMG/M |
3300027725|Ga0209178_1293110 | Not Available | 597 | Open in IMG/M |
3300027725|Ga0209178_1424706 | Not Available | 508 | Open in IMG/M |
3300027855|Ga0209693_10572448 | Not Available | 535 | Open in IMG/M |
3300027905|Ga0209415_10181276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2034 | Open in IMG/M |
3300027905|Ga0209415_10824566 | Not Available | 642 | Open in IMG/M |
3300027905|Ga0209415_11047107 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300027968|Ga0209061_1036435 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
3300028047|Ga0209526_10477109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300028379|Ga0268266_12107205 | Not Available | 537 | Open in IMG/M |
3300028718|Ga0307307_10202579 | Not Available | 628 | Open in IMG/M |
3300028789|Ga0302232_10095599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1525 | Open in IMG/M |
3300028860|Ga0302199_1087253 | Not Available | 1023 | Open in IMG/M |
3300028865|Ga0302291_10310530 | Not Available | 542 | Open in IMG/M |
3300028877|Ga0302235_10175900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 949 | Open in IMG/M |
3300028879|Ga0302229_10075750 | Not Available | 1623 | Open in IMG/M |
3300028879|Ga0302229_10192450 | Not Available | 934 | Open in IMG/M |
3300029910|Ga0311369_10874830 | Not Available | 720 | Open in IMG/M |
3300029914|Ga0311359_10871184 | Not Available | 622 | Open in IMG/M |
3300029951|Ga0311371_11334590 | Not Available | 814 | Open in IMG/M |
3300030007|Ga0311338_10950628 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300030013|Ga0302178_10069076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1884 | Open in IMG/M |
3300030013|Ga0302178_10139126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
3300030013|Ga0302178_10441593 | Not Available | 574 | Open in IMG/M |
3300030057|Ga0302176_10149866 | Not Available | 924 | Open in IMG/M |
3300030503|Ga0311370_11133916 | Not Available | 855 | Open in IMG/M |
3300030580|Ga0311355_11504724 | Not Available | 581 | Open in IMG/M |
3300030687|Ga0302309_10540886 | Not Available | 552 | Open in IMG/M |
3300030739|Ga0302311_10663319 | Not Available | 694 | Open in IMG/M |
3300030740|Ga0265460_10531821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
3300031028|Ga0302180_10178561 | Not Available | 1157 | Open in IMG/M |
3300031231|Ga0170824_109877455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2527 | 816 | Open in IMG/M |
3300031231|Ga0170824_125120112 | Not Available | 1513 | Open in IMG/M |
3300031234|Ga0302325_10115529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4953 | Open in IMG/M |
3300031234|Ga0302325_10537284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1750 | Open in IMG/M |
3300031525|Ga0302326_12476293 | Not Available | 652 | Open in IMG/M |
3300031549|Ga0318571_10237410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
3300031708|Ga0310686_101514613 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300031708|Ga0310686_110827710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300031708|Ga0310686_115708257 | Not Available | 649 | Open in IMG/M |
3300031718|Ga0307474_10210009 | Not Available | 1484 | Open in IMG/M |
3300031747|Ga0318502_10147911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
3300031747|Ga0318502_10525121 | Not Available | 710 | Open in IMG/M |
3300031748|Ga0318492_10431359 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300031751|Ga0318494_10296261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
3300031764|Ga0318535_10344572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
3300031770|Ga0318521_10352348 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300031778|Ga0318498_10474042 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300031781|Ga0318547_10059891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2078 | Open in IMG/M |
3300031792|Ga0318529_10291828 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300031805|Ga0318497_10164126 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300031819|Ga0318568_10408095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 846 | Open in IMG/M |
3300031821|Ga0318567_10842692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300031832|Ga0318499_10114610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1046 | Open in IMG/M |
3300031846|Ga0318512_10057687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1748 | Open in IMG/M |
3300031894|Ga0318522_10288257 | Not Available | 622 | Open in IMG/M |
3300031896|Ga0318551_10064459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1882 | Open in IMG/M |
3300031947|Ga0310909_11191571 | Not Available | 616 | Open in IMG/M |
3300032009|Ga0318563_10317016 | Not Available | 844 | Open in IMG/M |
3300032009|Ga0318563_10726152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
3300032010|Ga0318569_10522903 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300032025|Ga0318507_10508709 | Not Available | 524 | Open in IMG/M |
3300032060|Ga0318505_10116808 | Not Available | 1219 | Open in IMG/M |
3300032076|Ga0306924_10975551 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300032094|Ga0318540_10556911 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300032126|Ga0307415_102344709 | Not Available | 524 | Open in IMG/M |
3300032160|Ga0311301_10007600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 36322 | Open in IMG/M |
3300032160|Ga0311301_12959347 | Not Available | 512 | Open in IMG/M |
3300032261|Ga0306920_100475620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1855 | Open in IMG/M |
3300032805|Ga0335078_10436037 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
3300032805|Ga0335078_12658446 | Not Available | 511 | Open in IMG/M |
3300032828|Ga0335080_10661017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
3300032892|Ga0335081_10024736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9707 | Open in IMG/M |
3300032892|Ga0335081_11056618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 940 | Open in IMG/M |
3300032898|Ga0335072_10133853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3082 | Open in IMG/M |
3300033004|Ga0335084_10640548 | Not Available | 1086 | Open in IMG/M |
3300034124|Ga0370483_0283701 | Not Available | 570 | Open in IMG/M |
3300034268|Ga0372943_0097634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1722 | Open in IMG/M |
3300034779|Ga0334945_117883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ventii | 502 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.92% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.42% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.33% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.75% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.92% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.50% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.08% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.08% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.08% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.25% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.25% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.25% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.83% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.42% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.42% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.42% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.42% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.42% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.42% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.42% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.42% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.42% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.42% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.42% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.42% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004617 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034779 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 41SMS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12712J15308_101165871 | 3300001471 | Forest Soil | RKHIDELARKYTGEDYAAPVGPQGRIILKVAPDKVITPRSLGR* |
JGI12712J15308_102013153 | 3300001471 | Forest Soil | REHIDELSQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGR* |
JGI12635J15846_109123633 | 3300001593 | Forest Soil | IDELSLKYNGHEYTNPIGPQGRVILKVAADKVNTSKR* |
JGIcombinedJ26739_1009859682 | 3300002245 | Forest Soil | GDEARQHIDELSRKYNGTDYSNPIGPQGRVILKIAADKVNTPKTMGRR* |
Ga0062389_1036998021 | 3300004092 | Bog Forest Soil | SGTEARRHADELSRRYTGEDYSMPVGPEGRVILKVSPDKVNTPGRLAE* |
Ga0068955_12661941 | 3300004617 | Peatlands Soil | ARRHIDELARKYTGHGYAAPVGPHGRVILKIAADKVNTPRLLGR* |
Ga0062388_1000557371 | 3300004635 | Bog Forest Soil | GEPARQHIDELSLRYNGHEYTNPIGPQGRVILKVAADKVNTSKR* |
Ga0070658_105782261 | 3300005327 | Corn Rhizosphere | RVVETINGKQAREHIDELSRKYVGTEYRNAIGPDGRVILVLEPTKVVTPKSLAR* |
Ga0066388_1066192411 | 3300005332 | Tropical Forest Soil | ARDHIDELSHKYVGREYANPVGPDGRIILTIQPDKVNTPKSMSR* |
Ga0070666_104204692 | 3300005335 | Switchgrass Rhizosphere | RHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0068868_1016090351 | 3300005338 | Miscanthus Rhizosphere | ETVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0070714_1003623043 | 3300005435 | Agricultural Soil | HIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0070714_1018256472 | 3300005435 | Agricultural Soil | DELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0070714_1022118863 | 3300005435 | Agricultural Soil | AETVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVIPDKVNTPRLLER* |
Ga0070714_1022824121 | 3300005435 | Agricultural Soil | EVSRKYTGHDFTAPVGPHGRVILKIAADKVNTPRLLGSDKLLG* |
Ga0070713_1016193272 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ETIDGDEARRHIDEVSRKYTGHDFTAPVGPHGRVILKIAADKVNTPRLLG* |
Ga0070710_103275731 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0070710_110710731 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRHIDELSRKYTGHDFTAPVGPHGRVILKVAPDKVNTPRLLER* |
Ga0070711_1018682241 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0070708_1000407945 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKINTPRLLGS* |
Ga0070737_100520793 | 3300005524 | Surface Soil | RHIDELAQKYTGGDYSNPIGPEGRVILKIAPDKVNTPALLNRG* |
Ga0068855_1005164123 | 3300005563 | Corn Rhizosphere | GDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0070664_1007746981 | 3300005564 | Corn Rhizosphere | KYVGSDYRNPVGPQGRVILKIAADKVNTPATVRRR* |
Ga0070664_1013380911 | 3300005564 | Corn Rhizosphere | LSRKYTGHDFTAPVGPHGRVILKIAADKVNTPRLLG* |
Ga0066691_109455733 | 3300005586 | Soil | LSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0070762_104433063 | 3300005602 | Soil | ARNHIDELSRRYVGRDYASPVGPQGRIIYTIKPDKINTPKSLGRR* |
Ga0070762_112585471 | 3300005602 | Soil | REHIDELARKYTGNDYAAPIGPQGRVILEVTADKVNTSGR* |
Ga0070763_100558084 | 3300005610 | Soil | ARKHIDELARKYTGQDYAAPIGPEGRVILKVAPDKVNTPRLLGR* |
Ga0068856_1007832082 | 3300005614 | Corn Rhizosphere | ELSRKYVGSDYRNPVGPQGRVILKIAADKVNTPATVRRR* |
Ga0068856_1022141733 | 3300005614 | Corn Rhizosphere | SRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0066903_1038290161 | 3300005764 | Tropical Forest Soil | RKHIDELSRKYVGSDYRNPVGPQGRVILKIAADKVNTPATVRRR* |
Ga0066903_1062250942 | 3300005764 | Tropical Forest Soil | ARQHIDELSLRYNGHEYRNPIGPQGRLILKVAADKVNTPRRLGRR* |
Ga0068863_1004535063 | 3300005841 | Switchgrass Rhizosphere | VAADVLAGELIDELSRKYVGSDYRNPVGPQGRVILKIAADKVNTPATVRRR* |
Ga0070766_101635081 | 3300005921 | Soil | IGGEAARQHIDELSQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGRR* |
Ga0070717_106681132 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRKYTGHDFTAPVGPHGRVILKIAADKVNTPRLLG* |
Ga0070717_113706993 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0075026_1006896842 | 3300006057 | Watersheds | ETVGGEEARAHIDALSNKYLGHDYRNPIGLQGRVILKVLPTKVVTPKSMGR* |
Ga0075015_1005478851 | 3300006102 | Watersheds | ELSRKYTGHDYAAPVGPRGRVILKIAADKVNTPRLLGR* |
Ga0070712_1004035823 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0070765_1001396971 | 3300006176 | Soil | RKYTGQDYAAPVGPHGRVILKIAADKVNTPRLLGR* |
Ga0070765_1006020241 | 3300006176 | Soil | KYVGTGYRNPIGPQGRIILKIAPDKVNTPRSLGRR* |
Ga0075521_103111152 | 3300006642 | Arctic Peat Soil | HIDELSRKYVGTDYQQPIGPQGRIILKVAATKVNTPKTAFR* |
Ga0075521_105187721 | 3300006642 | Arctic Peat Soil | ARDHIDELSHKYMGTEYRNPIGPRGRIILKIAPDKVNTPALLHH* |
Ga0079222_104840251 | 3300006755 | Agricultural Soil | HIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0079221_100864621 | 3300006804 | Agricultural Soil | VAETVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVIPDKVNTPRLLER* |
Ga0079221_102048173 | 3300006804 | Agricultural Soil | RRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0079221_103314383 | 3300006804 | Agricultural Soil | ARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0075429_1012847631 | 3300006880 | Populus Rhizosphere | TIDGQAARDHIDALSRKYIGQDYANPIGPHGRVILRIAADKTNTPGTMSR* |
Ga0075426_113343922 | 3300006903 | Populus Rhizosphere | AETVDGDEARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKINTPRLLGR* |
Ga0074063_100585933 | 3300006953 | Soil | KYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0079219_103910101 | 3300006954 | Agricultural Soil | RHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLAR* |
Ga0079219_112913351 | 3300006954 | Agricultural Soil | DARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0105245_118219901 | 3300009098 | Miscanthus Rhizosphere | HIDELSRKYMGTEYPNPIGPKGRIILKIAPDKVNTPALLNQ* |
Ga0105247_110860621 | 3300009101 | Switchgrass Rhizosphere | VDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVAPDKVNTPRLLER* |
Ga0105241_119598901 | 3300009174 | Corn Rhizosphere | IDELSRKYTGHDFTSPVGPHGRVILKVTPDKVHTTRLLER* |
Ga0116214_100013027 | 3300009520 | Peatlands Soil | HIDELSLRYNGHEYTNPIGPQGRVILKIAADKINTPRRMGRG* |
Ga0116225_11626871 | 3300009524 | Peatlands Soil | GGEPARRHIDELSLRYNGHEYTNPIGPQGRVILKIAADKINTPRRMGR* |
Ga0116220_105586072 | 3300009525 | Peatlands Soil | RYVGTDYQNPVGPEGRIILRIAADKVNTPAKLFG* |
Ga0116216_102198572 | 3300009698 | Peatlands Soil | RHIDELARKYTGKDYAAPVGPQGRVILRVAPDKVNTPRSLGR* |
Ga0126311_106154571 | 3300010045 | Serpentine Soil | DHIDFLAKKYLDADSYPNPIGPDGRIILKIAADKVNTSG* |
Ga0126382_124254771 | 3300010047 | Tropical Forest Soil | RGRVIGTETGDQSRKHSDELSRKYVGRDYRNPVGPQGRVILKIAADKVNTPATVRRR* |
Ga0126373_113382301 | 3300010048 | Tropical Forest Soil | AREHIDKLSRKYVGTHYRNPIGPQGRVILKIAADKVNTPRSIGRR* |
Ga0134086_101634102 | 3300010323 | Grasslands Soil | DEARRHIDALSRKYTGHDFTAPVGPHGRVILKVAPDKINTPRLLER* |
Ga0126372_119017501 | 3300010360 | Tropical Forest Soil | RDHIDELSNKYVGRDYGNPIGPEGRLILTIQPDKVNTPKSMSR* |
Ga0134125_124948311 | 3300010371 | Terrestrial Soil | GDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVIPDKVNTPRLLER* |
Ga0134125_129041541 | 3300010371 | Terrestrial Soil | LSNRYLGHDYRNPIGPEGRIILRIAADKVNTPKSMGR* |
Ga0105239_109987203 | 3300010375 | Corn Rhizosphere | LSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER* |
Ga0136449_1004149415 | 3300010379 | Peatlands Soil | HIDELSLRYNGHEYTNPIGPQGRVILKIAADKINTPRRMGR* |
Ga0134126_119138071 | 3300010396 | Terrestrial Soil | HVAETVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVIPDKVNTPRLLER* |
Ga0134126_119871881 | 3300010396 | Terrestrial Soil | ARRHIDELSRKYTGHDFTAPVGPHGRVVLKVTPDKVNTPRLLER* |
Ga0134126_120239071 | 3300010396 | Terrestrial Soil | RRHIDELSHKYNGADYANPIGEQGRIILKVAADKVNTPAQMGR* |
Ga0134124_104611781 | 3300010397 | Terrestrial Soil | KHIDELSRKYVGSDYRNPVGPQGRVILKIAADKVNTPVTVRRR* |
Ga0134124_120257571 | 3300010397 | Terrestrial Soil | RDHIDELSNRYLGHDYRNPVGPEGRIILRIAADKVNTPKSMGR* |
Ga0126359_10618692 | 3300010869 | Boreal Forest Soil | EARAHIDELSHKYTGQDYGNPIGPEGRVILKIAPDKINTPKRLGF* |
Ga0126361_104344041 | 3300010876 | Boreal Forest Soil | QRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGR* |
Ga0126350_100435531 | 3300010880 | Boreal Forest Soil | ARQHIDELSQRYNGHEYTNPIGPQGRVILKVAADKVNTPKRLGRR* |
Ga0126350_103657121 | 3300010880 | Boreal Forest Soil | IDELARKYTGHDYAAPIGPQGRVILKVAPDKINTPRRLGR* |
Ga0126350_105653931 | 3300010880 | Boreal Forest Soil | RYNGHEYTNPIGPQGRVILKVAADKINTPKRLGRR* |
Ga0137776_11915572 | 3300010937 | Sediment | DEARRHIDELSRKYTGHDFAAPVGPHGRVILKVAPDKVNTPRLLGR* |
Ga0137362_112136061 | 3300012205 | Vadose Zone Soil | AREYIDELSQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGRG* |
Ga0137381_117393492 | 3300012207 | Vadose Zone Soil | DELSRKYTGHDFTAPVGPHGRVILKIAADKVNTPRLLGR* |
Ga0137390_116770531 | 3300012363 | Vadose Zone Soil | ETVTCDEARRHIDEVARKYTVHDYAPPVGPHGRVILKITPDKINTPRLLAR* |
Ga0150984_1232702922 | 3300012469 | Avena Fatua Rhizosphere | VASGRHIDELSQKYVGTEYQNPIGDEGRVILVIEPDKVNNPKRLAA* |
Ga0164300_103081091 | 3300012951 | Soil | SRKYVGQDYANPIGPHGRVILRIAADKTNTPSTVSR* |
Ga0164303_102128291 | 3300012957 | Soil | HVAEIVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0164301_111132382 | 3300012960 | Soil | SRKYVGSDYRNPVGPQGRVILQIAADKVNTPATVRRR* |
Ga0126369_134284031 | 3300012971 | Tropical Forest Soil | ETGDQARKHIDELSRKYVGRDYRNPIGPQGRVILKIAADKVNTPATVRRR* |
Ga0164308_110093191 | 3300012985 | Soil | RKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR* |
Ga0164304_111728042 | 3300012986 | Soil | RDHIDALSRNYVGQDYANPIGPHGRVILRIAADKTNTPSMISG* |
Ga0164306_116570151 | 3300012988 | Soil | ARKHIDELSRKYVGSDYRNPVGPQGRVILKIAADKVNTPATVRRR* |
Ga0164305_110326122 | 3300012989 | Soil | RVVGMETGDQARQHIDELSRKYVGSDYRNPVGPQGRVILQIAADKVNTPATVRRR* |
Ga0157370_105184712 | 3300013104 | Corn Rhizosphere | SRKYVGSDYRNPVGPQGRVILKIAADKVNTPVTVRRR* |
Ga0157374_107952271 | 3300013296 | Miscanthus Rhizosphere | IDELSRKYTGHDFTAPVGPHGRVILKVIPDKVNTPRLLER* |
Ga0163162_120827991 | 3300013306 | Switchgrass Rhizosphere | QTVGGDEARAHIDALSRKYLGHDYTNPIGPGGRVILQVTPSKVNTPRSMGR* |
Ga0157372_111914823 | 3300013307 | Corn Rhizosphere | RKYTGHDFTAPVGPHGRVILKVAPDKVNTPRLLER* |
Ga0181523_105438282 | 3300014165 | Bog | SRKYVGTDYRNPIGPQGRVILTIAADKVNTPQSLGRR* |
Ga0182024_104536241 | 3300014501 | Permafrost | LSNRYVGSDYKNPIGPDGRIILRVAADKVNTPATLSR* |
Ga0181522_110637041 | 3300014657 | Bog | LARKYTGGDYQNPIGPEGRLILRVAPLKVVTPATAFR* |
Ga0157376_113219481 | 3300014969 | Miscanthus Rhizosphere | NRYLGHDYRNPVGPEGRIILRIAADKVNTPKSMGR* |
Ga0182038_118410692 | 3300016445 | Soil | AETVDGEQARQHIDELSRKYVASDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0187812_11556611 | 3300017821 | Freshwater Sediment | TVGGAPARQHSDELSLRYNAHEYRNPTGPQGRLILKVAADKINTPRRLGRR |
Ga0187814_102328061 | 3300017932 | Freshwater Sediment | ITGQQARDHIDELSRKYVGRDYANPIGPDGRIIYVVQPDKVNTPKSLGRR |
Ga0187801_100543341 | 3300017933 | Freshwater Sediment | HIDELSLRYNGHEYTNPIGPQGRVILKIAADKINTPRRMGRR |
Ga0187819_105131702 | 3300017943 | Freshwater Sediment | QHIDELSLRYNGHEYRNPIGPQGRVILKIAADKVNTPRRVGRR |
Ga0187817_101549652 | 3300017955 | Freshwater Sediment | IDELSLRYNGHEYRNPIGPQGRLILKVAADKVNTPRRMGRR |
Ga0187779_104413541 | 3300017959 | Tropical Peatland | RAHIDALSNRYVGQDYAREVGPQGRVILHIAPDKVNTPARRGRR |
Ga0187783_103857263 | 3300017970 | Tropical Peatland | ARKHIDELSQKYNGTEYRNPIGPQGRIILKIEADKVNTPRSLGLR |
Ga0187783_104813321 | 3300017970 | Tropical Peatland | LSQKYMGTDYRNPIGPQGRIILKVAADKINTSKSRR |
Ga0187781_114959192 | 3300017972 | Tropical Peatland | GGDEARHHIDELSQKYNGTEYRNPIGPQGRVILKIEADKINTSKSRR |
Ga0187780_101132321 | 3300017973 | Tropical Peatland | LSRKYTGQDYAPPVGPQGRVILKITPDKINTPRLLGR |
Ga0187815_100414161 | 3300018001 | Freshwater Sediment | HIDELSQRYNGHKYTNPIGPQGRVILKIAADKVNTPRRMGRR |
Ga0187805_105724742 | 3300018007 | Freshwater Sediment | RYNGHEYRNPIGPQGRLILKVAADKVNTPRRMGRR |
Ga0187873_11856651 | 3300018013 | Peatland | IDELSNRYLGQDYGAPVGPDGRVILVITPDKVNTPRTLGRR |
Ga0184621_100019661 | 3300018054 | Groundwater Sediment | HIDFLARKYLGTDSYPNPVGPEGRVILKIAADKVNARAGKD |
Ga0187766_106520571 | 3300018058 | Tropical Peatland | QARQHIDELSRKYVGSDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0187765_106829351 | 3300018060 | Tropical Peatland | TVGGIQAREHIDKLSRKYSGSDYRNPIGPQGRVILKIAPDKVNTPRSLGRR |
Ga0187765_107217501 | 3300018060 | Tropical Peatland | HIDELSRKYVGSDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0187774_109031661 | 3300018089 | Tropical Peatland | RKYTGQDYAPPVGPQGRVILKVAADKINTPRLLGR |
Ga0066655_114235811 | 3300018431 | Grasslands Soil | DELSRKYVGSDYRNPVGAQGRVILKIAADKINTPATVRRR |
Ga0066662_125167452 | 3300018468 | Grasslands Soil | GDDARRHIDEVSRKYTGHDFTAPVGPHGRVILKIAADKVNTPRLLAH |
Ga0066669_100876591 | 3300018482 | Grasslands Soil | GTVDGEEARRHIDELSRKYTGHDFTAPVGPHGRMILKVTPDKVNTPRLLGR |
Ga0190267_104818711 | 3300019767 | Soil | DFLAKKYVDADTYPNPIGPQGRIILKIAADKVNLPG |
Ga0193728_12959541 | 3300019890 | Soil | RKHIDELSRKYVGNDYRNPIGPQGRVILKIAADKVNTPATVRRR |
Ga0210403_103356523 | 3300020580 | Soil | IDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR |
Ga0210399_110477721 | 3300020581 | Soil | DELSRRYVGRDYANPIGAQGRVIYTIRPDKINTPKSLGRR |
Ga0210404_104459293 | 3300021088 | Soil | LSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR |
Ga0210408_103365263 | 3300021178 | Soil | AETVDGDEARQHIDDLSRKYTGHDFTAPVGPHGRVILKVTPDKINTPRLLGS |
Ga0210388_112645482 | 3300021181 | Soil | DHIDEVSRRYTGHEFRAPVGPHGRIILVVAPDKVNTPRRLGEG |
Ga0213875_100964441 | 3300021388 | Plant Roots | ELAQKYTGADYARPIGPDGRVILKIAPDKINTPRSLGR |
Ga0210385_100491474 | 3300021402 | Soil | ELSQRYNGHEYTNPIGPQGRVILKIAADKVNTSQRR |
Ga0210385_112885381 | 3300021402 | Soil | RYVGRDYASPVGPQGRVIYTIKPDKINTPKSLGRR |
Ga0210397_103811031 | 3300021403 | Soil | HVVRTIDGREARDHIDEVSRRYTGHEFRAPVGPHGRIILVVAPDKVNTPRRLGEG |
Ga0210397_103952333 | 3300021403 | Soil | GEPARQHIDELSQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGRR |
Ga0210389_106641621 | 3300021404 | Soil | ELSQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGRR |
Ga0210387_109205213 | 3300021405 | Soil | ARQHIDELSQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGRR |
Ga0210387_110321731 | 3300021405 | Soil | LSQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGRR |
Ga0210386_100590145 | 3300021406 | Soil | SQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGR |
Ga0210386_110664612 | 3300021406 | Soil | EHIDKLSRKYVGTDYSSPIGPQGRVILKVAPDKVNTPRSLGRR |
Ga0210383_100293241 | 3300021407 | Soil | IDELARKYTGQDYAAPIGPHGRVILKIAADKVNTPRLLGR |
Ga0187846_104545481 | 3300021476 | Biofilm | LSQKYIGTEYRNPIGPQGRLILKIAADKINTPRSRGRR |
Ga0210409_103971731 | 3300021559 | Soil | ARQHIDDLSRKYTGHDFTAPVGPHGRVILKVTPDKINTPRLLGS |
Ga0126371_124236581 | 3300021560 | Tropical Forest Soil | SRKYVGSDYRNPIGPQGRIILKIAADKVNTPAVIRRR |
Ga0126371_131990952 | 3300021560 | Tropical Forest Soil | SRKYVGSDYRNPVGPQGRVILKIAADKVNTPATVRRR |
Ga0224571_1034842 | 3300022734 | Rhizosphere | GSEAREHIDKLSRKYVGTDYRNPIGPQGRVILKVAPDKVNTPRSLGRR |
Ga0224549_10568051 | 3300022840 | Soil | GQQAREHIDELSNKYVGRDYANPIGPGGRVIFVIEPDKVNTPKSMGRR |
Ga0247693_10402291 | 3300024181 | Soil | TGDQARKHIDELSRKYVGSDYRNPVGPQGRVILKIAADKVNTPATVRRR |
Ga0228598_10392662 | 3300024227 | Rhizosphere | AREHIDKLSRKYVGTDYRNPIGPQGRVILKVAPDKVNTPRSLGRR |
Ga0179589_100717723 | 3300024288 | Vadose Zone Soil | IVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR |
Ga0208076_10106403 | 3300025464 | Arctic Peat Soil | KARDHIDELSRKYVGRDYANPIGPQGRVIYVIRPDKINTPRSLGRR |
Ga0208714_10206964 | 3300025527 | Arctic Peat Soil | EARRHIDELSRKYTGQDYAPPVGPHGRVILKVAPDKINTPRLLGR |
Ga0209584_101013493 | 3300025878 | Arctic Peat Soil | TVGGQQARDHIDELSRKYVGTDYQQPIGPQGRIILKVAATKVNTPKTAFR |
Ga0207663_111151813 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AETVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVIPDKVNTPRLLER |
Ga0207646_112985471 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DGDEARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR |
Ga0207664_119674871 | 3300025929 | Agricultural Soil | QARKHIDELSRKYVGRDYRNPIGPQGRVILQIAADKVNTPATVRRR |
Ga0207644_104391853 | 3300025931 | Switchgrass Rhizosphere | TVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER |
Ga0207704_111466601 | 3300025938 | Miscanthus Rhizosphere | DEARKHIDELSRQYVGSDYRNPVGPQGRVILKIAADKVNTPVTVRRR |
Ga0207679_114827283 | 3300025945 | Corn Rhizosphere | DELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER |
Ga0207641_107027554 | 3300026088 | Switchgrass Rhizosphere | EARDHIDFLAKKYLDADSYPNPIGPQGRIILKIAADKVNLPG |
Ga0209375_12470711 | 3300026329 | Soil | ELSRKYVGSDYRNPIGPQGRVILKVAADKVNTPAVIRRR |
Ga0209325_10145701 | 3300027050 | Forest Soil | HVAETVDGDDARRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR |
Ga0209111_10126781 | 3300027058 | Forest Soil | VRGHVVRTLTGAEARQHIDEVSLRYTGHAYAPPVGPGGRIVYVVAPDKVNTPKSLGCR |
Ga0209736_10592983 | 3300027660 | Forest Soil | HIDELARKYTGKEYAAPIGPQGRVILKVAPDKINTPRRLGR |
Ga0209178_12931101 | 3300027725 | Agricultural Soil | RRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLGR |
Ga0209178_14247061 | 3300027725 | Agricultural Soil | HIDELSRKYVGRDYRNPIGPQGRVILQIAADKVNTPATVRRR |
Ga0209693_105724482 | 3300027855 | Soil | PARQHIDELSLRYNGHEYRNPIGPQGRVILKVAADKVNTPRRMGRR |
Ga0209415_101812764 | 3300027905 | Peatlands Soil | HIDELSQKYNGTEYRNPIGPQGRVILKVAADKINTSKSRR |
Ga0209415_108245661 | 3300027905 | Peatlands Soil | RRHIDELSQKYNGTEYRNPIGPQGRMILKIEADKVNTPQNQGRR |
Ga0209415_110471071 | 3300027905 | Peatlands Soil | GGEARRHIDELSRKYTGQDYHRPVGPEGRVILMVAPDKVNTPKLLGR |
Ga0209061_10364351 | 3300027968 | Surface Soil | HIDELAQKYTGGDYSNPIGPEGRVILKIAPDKVNTPALLNRG |
Ga0209526_104771093 | 3300028047 | Forest Soil | ETVTGEEARRHIDELARKYTGHDYAAPVGPQGRVILKVAPDKVNTPRRSSH |
Ga0268266_121072051 | 3300028379 | Switchgrass Rhizosphere | ELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER |
Ga0307307_102025792 | 3300028718 | Soil | RRHIDELSRKYTGHDFTAPVGPHGRVILKVTPDKVNTPRLLER |
Ga0302232_100955991 | 3300028789 | Palsa | PARQHIDELSLKYNGHEYTNPIGPQGRVILKVAADKVNTSKR |
Ga0302199_10872531 | 3300028860 | Bog | ETGATARAHIDELSNRYVGTDYQNPIGPDGRIILRIAADKVNTPAKLFS |
Ga0302291_103105302 | 3300028865 | Fen | DHIDALSQKYLGKDYANPIGPDGRIILHVAADKVNTPKTMGR |
Ga0302235_101759001 | 3300028877 | Palsa | GDEARQHIDELSRKYVGTEYRNPIGPQGRIILKIAADKVNTPKTMGRR |
Ga0302229_100757502 | 3300028879 | Palsa | RYVGRDYANPIGPGGRIMLVIAPDKVNTPKTLGMR |
Ga0302229_101924503 | 3300028879 | Palsa | IDELARKYTGQDYAAPIGPQGRVILKVAPDKVNTPRLLGR |
Ga0311369_108748302 | 3300029910 | Palsa | LSRKYVGTDYRNPIGPGGRIIFKVAADKVNTPKTMGLR |
Ga0311359_108711842 | 3300029914 | Bog | VVGTETGATARAHIDELSNRYVGTDYQNPIGPDGRIILRIAADKVNTPAKLFS |
Ga0311371_113345903 | 3300029951 | Palsa | ARKHIDELARKYTGQDYAAPIGPEGRVILKVVPDKVNTPRLLGR |
Ga0311338_109506281 | 3300030007 | Palsa | DELSNRYVGSDFRNPIGPDGRVILRIAADKVNTPAKLHR |
Ga0302178_100690761 | 3300030013 | Palsa | RRHIDELSNRYTGQDYANPIGPAGRVILKIAPDKVNTPRSLGLG |
Ga0302178_101391263 | 3300030013 | Palsa | LSNRYTGQDYANPIGPAGRVILKIAPDKVNTPRLLGMG |
Ga0302178_104415933 | 3300030013 | Palsa | DDLAHKYTGQDYAAPIGPQGRVILKVAPDKVNTPRSLGR |
Ga0302176_101498664 | 3300030057 | Palsa | DELSLKYNGHEYTNPIGPQGRVILKVAADKVNTSKR |
Ga0311370_111339161 | 3300030503 | Palsa | LDQDVVRLAKHIDELARKYTGKDYAAPIGPEGRIILKVALDKVNTPRLLGR |
Ga0311355_115047242 | 3300030580 | Palsa | LSNKYTGQDYANPIGPAGRVILKIAPDKVNTPRLLGMG |
Ga0302309_105408861 | 3300030687 | Palsa | AHKYTGKDYAAPIGPQGRVILKVTPDKVNTPRSLGR |
Ga0302311_106633191 | 3300030739 | Palsa | HIDELARKYTGQDYAAPIGPEGRVILKVVPDKVNTPRLLGR |
Ga0265460_105318211 | 3300030740 | Soil | ARKHIDELARKYTGQDYAAPIGPQGRVILKVAPDKVNTPRLLGR |
Ga0302180_101785611 | 3300031028 | Palsa | RHIDELSNRYTGQDYANPIGPAGRVILKIAPDKVNTPRLLGMG |
Ga0170824_1098774552 | 3300031231 | Forest Soil | GHDFAAPVGPHGRVILKVAPDKVNTPRRRGELGAC |
Ga0170824_1251201122 | 3300031231 | Forest Soil | ARDHIDELSNKYLGRDYANPIGPGGRIILTIQPDKVNTPKSMSR |
Ga0302325_101155292 | 3300031234 | Palsa | MALDQDVVRLAKHIDELARKYTGKDYAAPIGPEGRIILKVALDKVNTPRLLGR |
Ga0302325_105372841 | 3300031234 | Palsa | DVARSHIDELSNRYVGSDYRNPIGPDGRVILRIAADKVNTPARLFR |
Ga0302326_124762932 | 3300031525 | Palsa | HIDELANKYTGQDYGNPIGPEGRVILKVVPDKVITPRTLGF |
Ga0318571_102374102 | 3300031549 | Soil | EQARKHIDELSRKYVGRDYRNPIGPQGRVILKIAADKVNTPATVRRR |
Ga0310686_1015146131 | 3300031708 | Soil | GRVVEMVDGGPAREHIDKLSRKYVGSDYRNPIGPQGRVILKIAADKINTPRSLGRR |
Ga0310686_1108277102 | 3300031708 | Soil | GGDEARRHIDELSEKYAGGAYRNPIGPQGRIILKIAPDKVNTPRKLGRR |
Ga0310686_1157082571 | 3300031708 | Soil | EQARRHIDELSQKYNGTEYRNPIGPQGRMILKIEADKVNTPRSLGRR |
Ga0307474_102100091 | 3300031718 | Hardwood Forest Soil | SQRYNGHEYTNPIGPQGRVILKVAADKINTPKRLGRR |
Ga0318502_101479113 | 3300031747 | Soil | SEAREHIDKLSRQYDGSDFRDPIGPQGRVILKIAPDKINTPRSLGRR |
Ga0318502_105251211 | 3300031747 | Soil | HIDELSLRYNGHEYRNPIGPQGRLILKVAADKVNTPKRLGRR |
Ga0318492_104313592 | 3300031748 | Soil | SRQYDGSDFRDPIGPQGRVILKIAPDKINTPRSLGRR |
Ga0318494_102962612 | 3300031751 | Soil | GEQARQHIDELSRKYVASDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0318535_103445721 | 3300031764 | Soil | RKYVGSDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0318521_103523481 | 3300031770 | Soil | IDKLARKYVGSDYRNPIGPQGRVILKIAPDKVNTPRSLGRR |
Ga0318498_104740421 | 3300031778 | Soil | VGGSEAREHIDKLSRQYDGSDFRDPIGPQGRVILKIAPDKINTPRSLGRR |
Ga0318547_100598911 | 3300031781 | Soil | IDELSMRYNGHEYRNPIGPQGRLILKIAADKVNTPRRLGRR |
Ga0318529_102918282 | 3300031792 | Soil | GGSEAREHIDKLSRQYDGSDFRDPIGPQGRVILKIAPDKINTPRSLGRR |
Ga0318497_101641261 | 3300031805 | Soil | VHGRVVDTVGGSEAREHIDKLSRQYDGSDFRDPIGPQGRVILKIAPDKINTPRSLGRR |
Ga0318568_104080951 | 3300031819 | Soil | SRKYVGSDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0318567_108426921 | 3300031821 | Soil | GGDEARSHIDELSRKYVGTAYRNPIGPQGRIILKIAPDKVNTPRKLGRR |
Ga0318499_101146101 | 3300031832 | Soil | KYVGSDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0318512_100576873 | 3300031846 | Soil | HIDKLSRKYTGSDYRNPIGPQGRVILKIAADKINTPRSLGRR |
Ga0318522_102882571 | 3300031894 | Soil | TETIGGGPAREHIDELSMRYNGHEYRNPIGPQGRLILKIAADKVNTPRRLGRR |
Ga0318551_100644593 | 3300031896 | Soil | ARQHIDELSRKYVASDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0310909_111915712 | 3300031947 | Soil | VGGEPARQHIDELSLRYNGHEYRNPIGPRGRLILKVAADKVNTPRRLGRR |
Ga0318563_103170161 | 3300032009 | Soil | LSLRYNGHEYRNPIGPQGRLILKVAADKVNTPRRLGRR |
Ga0318563_107261521 | 3300032009 | Soil | RKYVGSAYRNPIGPQGRIILKIAPDKVNTPRKLGRR |
Ga0318569_105229032 | 3300032010 | Soil | RKYTGSDYRNPIGPQGRVILKIAADKINTPRSLGRR |
Ga0318507_105087092 | 3300032025 | Soil | RYNGHEYRNPIGPQGRLILKVAADKVNTPRRLGRR |
Ga0318505_101168081 | 3300032060 | Soil | EEAREHIDELSRKYVGSDYRNPIGPQGRIILKIAADKVNTPAAIRRR |
Ga0306924_109755511 | 3300032076 | Soil | GSEAREHIDKLSRKYTGSDYRNPIGPQGRVILKIAADKINTPRSLGRR |
Ga0318540_105569111 | 3300032094 | Soil | VDTVGGSEAREHIDKLSRQYDGSDFRDPIGPQGRVILKIAPDKINTPRSLGRR |
Ga0307415_1023447093 | 3300032126 | Rhizosphere | GEPRAREHIDELSHKYQGTDYANPIGPEGRIILVVAPDKVNTSS |
Ga0311301_1000760033 | 3300032160 | Peatlands Soil | RHIDELSLRYNGHEYTNPIGPQGRVILKIAADKINTPRRMGR |
Ga0311301_129593471 | 3300032160 | Peatlands Soil | VTGDQARRHIDELSRKYTGHDYAAPVGPHGRVILKIATDKVNTPRLLGR |
Ga0306920_1004756201 | 3300032261 | Soil | EPARQHIDELSLRYNGHEYRNPIGPQGRLILKVAADKVNTPRRLGRR |
Ga0335078_104360373 | 3300032805 | Soil | RGHVVGTIDGSQAREHIDELPRQYVGTDYGAPVGPKGRIILKIAADKVNTPRTMGRR |
Ga0335078_126584462 | 3300032805 | Soil | KHIDELSRKYVGSDYRNPVGPQGRVILKIAADKVNTPATVRRR |
Ga0335080_106610173 | 3300032828 | Soil | VVETIDGDEARRHIDEVSRKYTGHDFTAPVGPHGRVILKIAADKVNTPRLLG |
Ga0335081_1002473610 | 3300032892 | Soil | LDGSQAREHIDKLSRKYVGTDYRNPVGPHGRVILKIATDKVNAPKKLGRR |
Ga0335081_110566181 | 3300032892 | Soil | AGGDDARRHIDELSRKYTGADYDNPIGPQGRVILKVAADKINTPKMVVP |
Ga0335072_101338531 | 3300032898 | Soil | KYVGTDYRNPIGPQGRVILKIAADHVNTPRSLGRR |
Ga0335084_106405482 | 3300033004 | Soil | RKYVGSDYRNPVGPHGRVILKIAADKVNTPATVRRR |
Ga0370483_0283701_450_569 | 3300034124 | Untreated Peat Soil | DELAHKYTGKDYAAPIGPQGRVILKVAPDKVNTPRSLGR |
Ga0372943_0097634_2_139 | 3300034268 | Soil | TARDHIDELSNKYVGTDYGNPIGPKGRVILKIAPDKVNTPASLNR |
Ga0334945_117883_360_500 | 3300034779 | Sub-Biocrust Soil | GQEARDHIDFLAKKYVDADSYPNPIGPQGRVILKFAADKVNVAPQL |
⦗Top⦘ |