NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016827

Metagenome / Metatranscriptome Family F016827

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016827
Family Type Metagenome / Metatranscriptome
Number of Sequences 244
Average Sequence Length 48 residues
Representative Sequence AAAVFFFVVKPVNALLQRFRSPAEEGMPDEERRHQELLAALKAR
Number of Associated Samples 200
Number of Associated Scaffolds 244

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.74 %
% of genes near scaffold ends (potentially truncated) 89.34 %
% of genes from short scaffolds (< 2000 bps) 90.16 %
Associated GOLD sequencing projects 194
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.672 % of family members)
Environment Ontology (ENVO) Unclassified
(27.049 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.705 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.83%    β-sheet: 0.00%    Coil/Unstructured: 54.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 244 Family Scaffolds
PF05173DapB_C 31.15
PF01661Macro 6.56
PF10823DUF2568 4.10
PF05193Peptidase_M16_C 3.28
PF01557FAA_hydrolase 2.87
PF01416PseudoU_synth_1 2.87
PF07883Cupin_2 1.64
PF00701DHDPS 1.64
PF01565FAD_binding_4 1.64
PF00266Aminotran_5 1.64
PF01741MscL 1.23
PF01887SAM_HAT_N 1.23
PF08031BBE 1.23
PF00296Bac_luciferase 1.23
PF07676PD40 1.23
PF08240ADH_N 1.23
PF00557Peptidase_M24 0.82
PF13673Acetyltransf_10 0.82
PF02798GST_N 0.82
PF01738DLH 0.82
PF00140Sigma70_r1_2 0.82
PF00106adh_short 0.82
PF06831H2TH 0.82
PF02817E3_binding 0.41
PF03713DUF305 0.41
PF09438DUF2017 0.41
PF02152FolB 0.41
PF13380CoA_binding_2 0.41
PF01176eIF-1a 0.41
PF01625PMSR 0.41
PF13417GST_N_3 0.41
PF12850Metallophos_2 0.41
PF02687FtsX 0.41
PF12893Lumazine_bd_2 0.41
PF01266DAO 0.41
PF13193AMP-binding_C 0.41
PF14224DUF4331 0.41
PF07366SnoaL 0.41
PF13365Trypsin_2 0.41
PF02381MraZ 0.41
PF04020Phage_holin_4_2 0.41
PF03060NMO 0.41
PF00196GerE 0.41
PF01321Creatinase_N 0.41
PF06736TMEM175 0.41
PF09391DUF2000 0.41
PF03364Polyketide_cyc 0.41
PF00353HemolysinCabind 0.41
PF00903Glyoxalase 0.41
PF132392TM 0.41
PF00004AAA 0.41
PF00535Glycos_transf_2 0.41
PF00041fn3 0.41
PF08818DUF1801 0.41
PF14518Haem_oxygenas_2 0.41
PF14696Glyoxalase_5 0.41
PF03992ABM 0.41
PF13517FG-GAP_3 0.41
PF04237YjbR 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 244 Family Scaffolds
COG02894-hydroxy-tetrahydrodipicolinate reductaseAmino acid transport and metabolism [E] 31.15
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 6.56
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 3.28
COG0101tRNA U38,U39,U40 pseudouridine synthase TruATranslation, ribosomal structure and biogenesis [J] 2.87
COG1912Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)Defense mechanisms [V] 1.23
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.23
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 1.23
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 1.23
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.82
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.82
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.41
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.41
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.41
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.41
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.41
COG3544Uncharacterized conserved protein, DUF305 familyFunction unknown [S] 0.41
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 0.41
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.41
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 0.41
COG2001MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activityTranslation, ribosomal structure and biogenesis [J] 0.41
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 0.41
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.41
COG1539Dihydroneopterin aldolaseCoenzyme transport and metabolism [H] 0.41
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.41
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.00 %
UnclassifiedrootN/A25.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000044|ARSoilOldRDRAFT_c011700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300000858|JGI10213J12805_10108981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1333Open in IMG/M
3300000891|JGI10214J12806_10473808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300000891|JGI10214J12806_12421420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300000956|JGI10216J12902_102061159Not Available803Open in IMG/M
3300002122|C687J26623_10228961Not Available516Open in IMG/M
3300004114|Ga0062593_102617583All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300004156|Ga0062589_100414193All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300004156|Ga0062589_102799727All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300004157|Ga0062590_100481078All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300004157|Ga0062590_102648495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300004463|Ga0063356_101936288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria890Open in IMG/M
3300004463|Ga0063356_102301918All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300004643|Ga0062591_101484797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300004643|Ga0062591_102655713Not Available529Open in IMG/M
3300004643|Ga0062591_102725819All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005327|Ga0070658_11902806All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005329|Ga0070683_100389494All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300005329|Ga0070683_102269476All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005334|Ga0068869_100724863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300005334|Ga0068869_100784876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300005337|Ga0070682_100641997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300005339|Ga0070660_100959262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300005343|Ga0070687_100641532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300005347|Ga0070668_100766273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria855Open in IMG/M
3300005354|Ga0070675_100153828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1973Open in IMG/M
3300005406|Ga0070703_10128916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300005435|Ga0070714_100896235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300005438|Ga0070701_11221438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300005441|Ga0070700_101980939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300005445|Ga0070708_101291409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300005456|Ga0070678_100284258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1400Open in IMG/M
3300005456|Ga0070678_100753724All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300005459|Ga0068867_100680401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales906Open in IMG/M
3300005459|Ga0068867_101475351All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005467|Ga0070706_100431084All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300005535|Ga0070684_100438280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1207Open in IMG/M
3300005536|Ga0070697_100809905Not Available829Open in IMG/M
3300005544|Ga0070686_100539941All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300005544|Ga0070686_100877702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium728Open in IMG/M
3300005564|Ga0070664_101800563All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005616|Ga0068852_102398000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300005718|Ga0068866_10174706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1264Open in IMG/M
3300005764|Ga0066903_104582286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300005840|Ga0068870_10593661All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005843|Ga0068860_101979813All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005937|Ga0081455_10474514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300006059|Ga0075017_100097591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2043Open in IMG/M
3300006196|Ga0075422_10428089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300006575|Ga0074053_11124296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300006576|Ga0074047_11999114All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300006844|Ga0075428_100303951All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300006844|Ga0075428_100812162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300006852|Ga0075433_11447747All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300006876|Ga0079217_11744324All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300006894|Ga0079215_11409268All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006904|Ga0075424_102613028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300006914|Ga0075436_100288453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci1175Open in IMG/M
3300006918|Ga0079216_10717392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300006953|Ga0074063_12535516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300007076|Ga0075435_100486680All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300009089|Ga0099828_10526419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1066Open in IMG/M
3300009090|Ga0099827_10000704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria15958Open in IMG/M
3300009156|Ga0111538_11229183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300009157|Ga0105092_10239937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300009789|Ga0126307_10445210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1045Open in IMG/M
3300009811|Ga0105084_1011679All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300009811|Ga0105084_1104848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300009823|Ga0105078_1044210Not Available577Open in IMG/M
3300010038|Ga0126315_10482430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium789Open in IMG/M
3300010040|Ga0126308_11070032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300010041|Ga0126312_10255693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1231Open in IMG/M
3300010045|Ga0126311_10013446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4672Open in IMG/M
3300010045|Ga0126311_10336662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1146Open in IMG/M
3300010045|Ga0126311_10502270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300010166|Ga0126306_10347344All Organisms → cellular organisms → Bacteria → Terrabacteria group1152Open in IMG/M
3300010391|Ga0136847_10264443Not Available599Open in IMG/M
3300010400|Ga0134122_11538339Not Available686Open in IMG/M
3300010999|Ga0138505_100053799Not Available584Open in IMG/M
3300011119|Ga0105246_10332264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1239Open in IMG/M
3300011270|Ga0137391_10742641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300012014|Ga0120159_1095449Not Available858Open in IMG/M
3300012356|Ga0137371_11139040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300012358|Ga0137368_10447353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300012529|Ga0136630_1126998Not Available931Open in IMG/M
3300012531|Ga0136640_10409570Not Available568Open in IMG/M
3300012668|Ga0157216_10276771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria775Open in IMG/M
3300012682|Ga0136611_10149642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1618Open in IMG/M
3300012898|Ga0157293_10293974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300012901|Ga0157288_10096979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300012901|Ga0157288_10105822Not Available773Open in IMG/M
3300012903|Ga0157289_10198486Not Available653Open in IMG/M
3300012907|Ga0157283_10127380Not Available720Open in IMG/M
3300012910|Ga0157308_10208152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300012910|Ga0157308_10414414Not Available527Open in IMG/M
3300012915|Ga0157302_10298017Not Available625Open in IMG/M
3300012925|Ga0137419_11935811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300012951|Ga0164300_11136256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300012958|Ga0164299_10715876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria702Open in IMG/M
3300012961|Ga0164302_10845238Not Available696Open in IMG/M
3300012985|Ga0164308_10170336All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300012989|Ga0164305_11288469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300012989|Ga0164305_11640444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300013096|Ga0157307_1048744All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300013104|Ga0157370_11407442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300013297|Ga0157378_10736268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300014052|Ga0120109_1103346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300014267|Ga0075313_1178966Not Available555Open in IMG/M
3300014320|Ga0075342_1252085Not Available514Open in IMG/M
3300014326|Ga0157380_10064942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2931Open in IMG/M
3300014968|Ga0157379_12230484All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300015200|Ga0173480_10466190Not Available749Open in IMG/M
3300015245|Ga0137409_10756395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300015262|Ga0182007_10304913All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300015371|Ga0132258_10316320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3846Open in IMG/M
3300015371|Ga0132258_12061130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1434Open in IMG/M
3300015371|Ga0132258_13102087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1149Open in IMG/M
3300015372|Ga0132256_100267856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1783Open in IMG/M
3300015372|Ga0132256_102567156Not Available610Open in IMG/M
3300015373|Ga0132257_100538128Not Available1437Open in IMG/M
3300015373|Ga0132257_101978079Not Available751Open in IMG/M
3300015373|Ga0132257_102136503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300015373|Ga0132257_103039637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300015374|Ga0132255_101084610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1203Open in IMG/M
3300015374|Ga0132255_103065472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300017657|Ga0134074_1302390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300017787|Ga0183260_10934225Not Available536Open in IMG/M
3300017792|Ga0163161_11694982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300017997|Ga0184610_1312655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300018032|Ga0187788_10417513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300018051|Ga0184620_10147575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300018056|Ga0184623_10399716All Organisms → cellular organisms → Bacteria → Terrabacteria group605Open in IMG/M
3300018061|Ga0184619_10052410All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300018061|Ga0184619_10459787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300018061|Ga0184619_10500287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300018063|Ga0184637_10444980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300018072|Ga0184635_10162878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria891Open in IMG/M
3300018077|Ga0184633_10618377All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300018083|Ga0184628_10236567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300018429|Ga0190272_11697542Not Available653Open in IMG/M
3300018432|Ga0190275_10493143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1257Open in IMG/M
3300018432|Ga0190275_10812841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria999Open in IMG/M
3300018466|Ga0190268_10158702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1168Open in IMG/M
3300018466|Ga0190268_12007283All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300018469|Ga0190270_10234363All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300018481|Ga0190271_12251959Not Available650Open in IMG/M
3300019269|Ga0184644_1741412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1004Open in IMG/M
3300020003|Ga0193739_1103756Not Available715Open in IMG/M
3300020016|Ga0193696_1143984Not Available592Open in IMG/M
3300020016|Ga0193696_1175072Not Available515Open in IMG/M
3300021374|Ga0213881_10238979Not Available806Open in IMG/M
3300022737|Ga0247747_1043171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300022756|Ga0222622_10006354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5372Open in IMG/M
3300022756|Ga0222622_10277295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1146Open in IMG/M
3300022756|Ga0222622_11176493Not Available564Open in IMG/M
3300022915|Ga0247790_10213766Not Available516Open in IMG/M
3300023066|Ga0247793_1081881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300023102|Ga0247754_1025271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1316Open in IMG/M
3300023263|Ga0247800_1082710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300023266|Ga0247789_1012572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1350Open in IMG/M
3300024055|Ga0247794_10330501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300025318|Ga0209519_10411844All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300025322|Ga0209641_10401375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria989Open in IMG/M
3300025322|Ga0209641_10414463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales969Open in IMG/M
3300025327|Ga0209751_10534844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria952Open in IMG/M
3300025327|Ga0209751_10874574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300025792|Ga0210143_1026255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300025888|Ga0209540_10465269All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS1673Open in IMG/M
3300025899|Ga0207642_10752689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300025904|Ga0207647_10234657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1055Open in IMG/M
3300025907|Ga0207645_10811992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300025916|Ga0207663_10566085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria890Open in IMG/M
3300025918|Ga0207662_11206088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300025930|Ga0207701_11329224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300025934|Ga0207686_10550050All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300025981|Ga0207640_11872482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300025981|Ga0207640_12088258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300025986|Ga0207658_11948090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300026121|Ga0207683_10944030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300026142|Ga0207698_10943458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300026332|Ga0209803_1125977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300026786|Ga0207497_104395Not Available548Open in IMG/M
3300026995|Ga0208761_1029446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300028589|Ga0247818_10785646Not Available664Open in IMG/M
3300028715|Ga0307313_10066956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1069Open in IMG/M
3300028718|Ga0307307_10018015All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300028719|Ga0307301_10209936All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300028744|Ga0307318_10137044All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium837Open in IMG/M
3300028754|Ga0307297_10138080Not Available825Open in IMG/M
3300028771|Ga0307320_10052349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1508Open in IMG/M
3300028778|Ga0307288_10034772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1683Open in IMG/M
3300028787|Ga0307323_10188251Not Available746Open in IMG/M
3300028787|Ga0307323_10322577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300028809|Ga0247824_10955800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300028811|Ga0307292_10196889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300028812|Ga0247825_10541258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium831Open in IMG/M
3300028814|Ga0307302_10010733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4104Open in IMG/M
3300028814|Ga0307302_10533610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300028824|Ga0307310_10546899Not Available586Open in IMG/M
3300028872|Ga0307314_10172273Not Available637Open in IMG/M
3300028875|Ga0307289_10267416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300028875|Ga0307289_10398021Not Available566Open in IMG/M
3300028881|Ga0307277_10332484Not Available676Open in IMG/M
3300028884|Ga0307308_10112197All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300030006|Ga0299907_10198453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1656Open in IMG/M
3300030336|Ga0247826_11425600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300030606|Ga0299906_10275717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1318Open in IMG/M
3300031239|Ga0265328_10161717Not Available844Open in IMG/M
3300031241|Ga0265325_10285362Not Available739Open in IMG/M
3300031251|Ga0265327_10031355All Organisms → cellular organisms → Bacteria2987Open in IMG/M
3300031344|Ga0265316_10009520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8943Open in IMG/M
3300031547|Ga0310887_10456490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300031547|Ga0310887_11081476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300031548|Ga0307408_101389898Not Available661Open in IMG/M
3300031562|Ga0310886_10935887Not Available553Open in IMG/M
3300031576|Ga0247727_10287074All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300031740|Ga0307468_100956720Not Available749Open in IMG/M
3300031834|Ga0315290_10065350All Organisms → cellular organisms → Bacteria2993Open in IMG/M
3300031834|Ga0315290_10743251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300031835|Ga0318517_10547832Not Available520Open in IMG/M
3300031847|Ga0310907_10892606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300031858|Ga0310892_10553737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300032002|Ga0307416_102321099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300032010|Ga0318569_10082487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1434Open in IMG/M
3300032013|Ga0310906_10516418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300032143|Ga0315292_10358726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1221Open in IMG/M
3300032163|Ga0315281_11576345All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300033551|Ga0247830_11334153Not Available573Open in IMG/M
3300034147|Ga0364925_0180540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300034176|Ga0364931_0020251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1872Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.51%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.28%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.28%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.05%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.05%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.05%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.23%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.23%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.23%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.23%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.82%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.82%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.82%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.41%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.41%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.41%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.41%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.41%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.41%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.41%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.41%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.41%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.41%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.41%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.41%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.41%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000044Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil oldHost-AssociatedOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002122Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012094Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06)EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012531Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06)EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012682Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06)EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026786Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ARSoilOldRDRAFT_01170023300000044Arabidopsis RhizosphereVFFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA*
JGI10213J12805_1010898133300000858SoilAAITFVSTAAAIFFFVVRPMNALMTRMKRPEGEAVADEERRHQELLAALEGLKR*
JGI10214J12806_1047380813300000891SoilAAAIFFFVVKPVNALMARRRQPEEEVVSDEERRHQELLVALEALRR*
JGI10214J12806_1242142023300000891SoilATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR*
JGI10216J12902_10206115913300000956SoilFFFVVKPVQAMLERRRREPVEEGMPDEERRHQELLAALRARA*
C687J26623_1022896113300002122SoilVVKPLNALTARMKKPEEDAVPDEERRHQELLAALRSRG*
Ga0062593_10261758313300004114SoilSITFVATAAAIFFFVVKPMGAIMARMKKPEEEAVADEERRHQELLAAIRNIGR*
Ga0062589_10041419313300004156SoilFVAIGAAVFFFVVKPMQMMAARGQKEPIEEGMPDEERRHRELLAALSARN*
Ga0062589_10279972723300004156SoilAFLTDLIQFAAIGAAVFFFIVKPVQMMLERSRKEPIEEGMPDEERRHQELLAALRASN*
Ga0062590_10048107813300004157SoilISFVAIAAAVFFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR*
Ga0062590_10264849523300004157SoilAFLTDLIQFAAIGAAVFFFIVKPVQMMLERSRKGPIEEGMPDEERRHQELLAALRASR*
Ga0063356_10193628813300004463Arabidopsis Thaliana RhizosphereVSTAAAIFFFVVKPVNALMARRRQPHEEVVADEERRHHELLAALEGLRR*
Ga0063356_10230191813300004463Arabidopsis Thaliana RhizosphereLAVAAAVFFFVVKPMNALRDRRAGGAEEEGLPDEERRHQELLAALRETRA*
Ga0062591_10148479723300004643SoilVSTAAAIFFFVVKPVNALMARRRQPEEEVVSDEERRHQELLVALEALRR*
Ga0062591_10265571313300004643SoilTDLIQFAAIGAAVFFFIVKPVQMMLDRSRKEPIEEGMPDEERRHQELLAALRASN*
Ga0062591_10272581913300004643SoilLSVAAAVFFFVVKPMNALRDRRAGGAEEEGLPDEERRHQELLAALRETRA*
Ga0070658_1190280613300005327Corn RhizosphereFITSAITFLATAAAIFLFVVKPYDALTSRFAKPAEGAVDDEERRHQELLAALRESRA*
Ga0070683_10038949413300005329Corn RhizosphereSTAAAIFFFVVKPANALKSRFETQEEAAVSDEERRHQELLAALARVGR*
Ga0070683_10226947623300005329Corn RhizosphereAAAVFFFVVKPMDAIRKRMTKEEEASISDEERRHQELLAALRSRP*
Ga0068869_10072486333300005334Miscanthus RhizosphereAAVFFFVVKPMNMLRERRAGGAEEEGLPDEERRHQELLAALRESRA*
Ga0068869_10078487623300005334Miscanthus RhizosphereTFVATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR*
Ga0070682_10064199723300005337Corn RhizosphereAAVFFFVVKPMDAIKQHMTRAEEATISDEERRHQELLAALRVRS*
Ga0070660_10095926213300005339Corn RhizosphereVAAAVFFFVVKPMNMLRERRAGGAEEEGLPDEERRHQELLAVLRESRA*
Ga0070687_10064153223300005343Switchgrass RhizosphereFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR*
Ga0070668_10076627313300005347Switchgrass RhizosphereFFFVVKPMNALMTRFEKPEEEAVADEERRHQELLAALRAR*
Ga0070675_10015382813300005354Miscanthus RhizosphereFVSTAAAIFFFVVKPANALNSRFETPEEAAVSDEERRHQELLAALERLGR*
Ga0070703_1012891613300005406Corn, Switchgrass And Miscanthus RhizosphereTDVISFVAIAAAVFFFVVKPMDALTKRRAKPTEEEVSDEERRHQELLAALRAR*
Ga0070714_10089623523300005435Agricultural SoilVIQFVAIAAAVFSFVVRQVNALPPRYRSPAEEGLPDEERRHQELLAALRGGQP*
Ga0070701_1122143823300005438Corn, Switchgrass And Miscanthus RhizosphereFVSTAAAIFFFVVKPTNALRARFEAPDEAAVSDEERRHQELLAALERLGR*
Ga0070700_10198093913300005441Corn, Switchgrass And Miscanthus RhizosphereFVATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR*
Ga0070708_10129140913300005445Corn, Switchgrass And Miscanthus RhizosphereAVFFFVVKPMDALMKRVAKPTEEEVSDEERRHQELLAALRAR*
Ga0070678_10028425813300005456Miscanthus RhizosphereAAVFFFVVKPMQMMAARGQKEPIEEGMPDEERRHQELLAALRARP*
Ga0070678_10075372423300005456Miscanthus RhizosphereVIQFVAIAAAVFFFVVKPMRVLEARRARGEELVVSDEERRHQELLEALRSLSRSA*
Ga0068867_10068040133300005459Miscanthus RhizosphereAAIFVFVVKPYGALTSRFAKSAEEAVDVEERRHQELLAALRAR*
Ga0068867_10147535123300005459Miscanthus RhizosphereISFVAIAAAVFFFVVKPMNAIMSRVRKPAEEEISDDERRHQELLAALRARG*
Ga0070706_10043108433300005467Corn, Switchgrass And Miscanthus RhizosphereIQFVAIAAAVFFFVVKPIQAMLERRRKEPIEEGMPDEERRHQELLAALRARS*
Ga0070684_10043828033300005535Corn RhizosphereFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA*
Ga0070697_10080990513300005536Corn, Switchgrass And Miscanthus RhizosphereGSVFFFVVKPVNALMTRFRSPAEEALPDEERRHQELLAALRGS*
Ga0070686_10053994133300005544Switchgrass RhizosphereFVSTAAAIFFFVVKPANALNSRFETPEEAAVSDEERRHQELLAALARLGR*
Ga0070686_10087770233300005544Switchgrass RhizosphereFFFVVRPVNALLGRFRSPAEEGMPDEERRHQELLAALRGASAPEAG*
Ga0070664_10180056313300005564Corn RhizosphereAAVFFFVVKPMDAIKKRMTREEEAEISDEERRHQELLAALASRT*
Ga0068852_10239800013300005616Corn RhizosphereAAVFFFVVKPMTILRERRAGGAEEEGLPDEERRHQELLAALRESRA*
Ga0068864_10123712213300005618Switchgrass RhizospherePMQMMAARGKEPIEEGMPDEERRHQELLAALRPRA*
Ga0068866_1017470633300005718Miscanthus RhizosphereFFFVVKPMNALMARMSKPEEEALSDEERRHQELLAALRAR*
Ga0066903_10458228613300005764Tropical Forest SoilITFVAIAAAVFFFVVKPTDMIAARRAKGEPEAIPDDERRHQELLAALRAHA*
Ga0068870_1059366113300005840Miscanthus RhizosphereTDVISFVAIAAAVFFFVVKPMDALTKRVEKPTEEEVSDEERRHQELLAALRAR*
Ga0068860_10197981333300005843Switchgrass RhizosphereAAAVFFFVVKPMNALRERRAGGAQEEGLPDEERRHQELLAALRESRA*
Ga0081455_1047451433300005937Tabebuia Heterophylla RhizosphereVFFFVVKPMNALMSRVRKPADEEVSDEERRHQELLAALRARG*
Ga0075017_10009759113300006059WatershedsAAVFLLVVKPMNALKARTAKEEAETISDEERRHRELLEALRSRG*
Ga0075422_1042808933300006196Populus RhizosphereAIAAAVFFFVVKPVQAMMARRAEPVEEGMPDEERRHQELLAALRESRA*
Ga0074053_1112429613300006575SoilAIAAAVFFFVVKPMDALMKRVAKPTEEEVSDEERRHQELLAVLRAR*
Ga0074047_1199911423300006576SoilFVAIAAAVFFFVVKPVQAMLARTQRTPVEEGMPDEERRHQELLSALRAAGSR*
Ga0075428_10030395133300006844Populus RhizosphereVFFFVVKPMQSIIARTHSPAEEGMPDEERRHQEVLAALNRIAA*
Ga0075428_10081216213300006844Populus RhizosphereAAAIFFFVVKPANAMMTRFTKPGEEAVDDEERRHQELLAAIRESR*
Ga0075433_1144774713300006852Populus RhizosphereAIAAAVFFFVVKPVNALLKRYRTPAEEGMPDEERRHQELLAALRGASSPSTS*
Ga0079217_1174432423300006876Agricultural SoilIQFVAIADAVFFFVVKPVQAMLARGRRTPVEDGMPDEERRHQELLAALRTQRS*
Ga0079215_1140926813300006894Agricultural SoilAAAVFFFVVKPVNALLQRFRSPAEEGMPDEERRHQELLAALKAR*
Ga0075426_1062063223300006903Populus RhizosphereRPVDMLIARLQRTAPEEGMPDEERRHQELLAALDRVALR*
Ga0075424_10261302813300006904Populus RhizosphereAIAAAVFFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA*
Ga0075436_10028845313300006914Populus RhizosphereSAISFVAIAAVVFFFVVKPMNAIMSRVRKPAEEEISDDERRHQELLAALRARG*
Ga0079216_1071739213300006918Agricultural SoilITFLATAAAIFFFVVKPVNAIMARMTTPAGDEVTDEERRHHELLAALEGLRR*
Ga0074063_1253551613300006953SoilALITFVAIAAAVFFFVIKPYDAIKARMSRGEEAAIDDEERRHQELLAALRAR*
Ga0075435_10048668013300007076Populus RhizosphereVFFFVVRPVDMLIARLQRTAPEEGMPDEERRHQELLAALDRVALR*
Ga0099828_1052641943300009089Vadose Zone SoilAFLTDLIQFVAIGAAVFFFIVKPVQMMLARNRREPIEEGVPDEERRHQELLAALRASR*
Ga0099827_1000070413300009090Vadose Zone SoilAIAAAVFFFVVKPVNALLKRFRSPAEEGMPDEERRHQELLAALRGSSASAR*
Ga0111538_1122918323300009156Populus RhizosphereVITFIAVGAAVFFFVVKPMQMMAARGQKEPIEEGMPDEERRHQELLAALEGLRR*
Ga0105092_1023993733300009157Freshwater SedimentAVFFFIVKPTQAILARRKAPVEEGMPDEERRHQELLAALAQVGSR*
Ga0126307_1044521033300009789Serpentine SoilFVVKPLNALLSRLQRTPAEEGMPDEERRHQELLAALATVRGR*
Ga0105084_101167913300009811Groundwater SandVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN*
Ga0105084_110484823300009811Groundwater SandVIQFVAIAAAVFFFIVKPVQAMTARSRREPVEEGMPDEERRHQELLAALGRVSR*
Ga0105078_104421013300009823Groundwater SandAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN*
Ga0126315_1048243023300010038Serpentine SoilVFFFIVKPVQAMLARPRREPVEEGMPDEERRHQELLAALGQLQR*
Ga0126308_1107003223300010040Serpentine SoilFVVKPVQAMMARFQRTPVEEGMPDEERRHQELLGALRGLAQ*
Ga0126312_1025569323300010041Serpentine SoilVFFFVVKPVNALMTRLRSPVQKGMPDEERRHQELLAALGRLGTR*
Ga0126311_1001344673300010045Serpentine SoilGASVFFFVVKPIDAMLSRSRRTPVEEGMPDEERRHQELLAALQARP*
Ga0126311_1033666213300010045Serpentine SoilGASVFFFVVKPIDAMLSRSRRTPVEEGMPDEERRHQELLAALQAARP*
Ga0126311_1050227033300010045Serpentine SoilAAVFFFIVKPVQMMLARGGREPVEEGMPDEERRHQELLAALRANR*
Ga0126306_1034734423300010166Serpentine SoilFFFVVKPINMIRTHRRGAAEEGLPDEERRHQELLAALAELRTG*
Ga0136847_1026444323300010391Freshwater SedimentFFFVVKPLNALMARMQKPGEEVVSDEERRHQELLAAIRESAR*
Ga0134122_1153833933300010400Terrestrial SoilFFVVKPMNALRERRAGGAQEEGLPDEERRHQELLAALRESRA*
Ga0138505_10005379923300010999SoilDLLTFVAVAGAVFFFVVKPVNALTNRLHSPVEEGMPDEERRHQELLAALGQIRTSSR*
Ga0105246_1033226433300011119Miscanthus RhizosphereTAAITFVSTAAAIFFFVVKPANALKSRFETQEEAAVSDEERRHQELLAALARVGR*
Ga0137391_1074264113300011270Vadose Zone SoilTDLIQFVAIGAAVFFVIVKPVQMMLARSRSEPTEEGMPDEERRHQELLAALRASR*
Ga0120159_109544913300012014PermafrostVFFFIVKPVQMMLARRRRGPIEEGMPDEERRHQELLAAIRGLSR*
Ga0136631_1042234913300012043Polar Desert SandPVQGMLERRRREPIEEGMPDEERRHQELLAALRARGA*
Ga0136638_1011455413300012094Polar Desert SandKPVQMMLARGRREPIEEGMPDEERRHQELLAALRASN*
Ga0137380_1089692613300012206Vadose Zone SoilKPVQMMLVRRRKEPVEEGMPDEERRHQELLAALRASH*
Ga0137371_1113904023300012356Vadose Zone SoilFFFIVKPVNMLLQRFRSPAEEGLPDEERRHQELLAALRAAH*
Ga0137368_1044735333300012358Vadose Zone SoilAIQFVAIAAAVFLFVVKPVNALLQRFRSPAEEGMPDEERRHQELLAALRAAPTR*
Ga0136630_112699813300012529Polar Desert SandTDVIQFAAIAAAVFFFVVKPVQAMLERRRTEPIEEGMPDEERRHQELLAALRTRGA*
Ga0136640_1040957013300012531Polar Desert SandIQFVAIGVAVFFFIVKPVQMMLARGRREPIEEGMPDEERRHQELLAALRASN*
Ga0157216_1027677133300012668Glacier Forefield SoilSTITFVAIAAAVFFFVVKPMNVVMGRLRKPEADVVTEEERRHQELLAALEGLRR*
Ga0136611_1014964223300012682Polar Desert SandFFIVKPVQMMLARGRREPIEEGMPDEERRHQELLAALRASN*
Ga0157293_1029397413300012898SoilAAVFFFIVKPMNALTARFVKPDEEEVPDEERRHQELLAALRAR*
Ga0157288_1009697923300012901SoilVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR*
Ga0157288_1010582233300012901SoilAAAVFFFVVKPMDAIRKRMTKEEEATISDDERRHQELLAALRERNA*
Ga0157289_1019848613300012903SoilFFFVVKPIDALLKRTRGPVEEGMPDEERRHQELLRALREVSAR*
Ga0157283_1012738013300012907SoilKPIDALLKRTRGPVEEGMPDEERRHQELLRALREVSAR*
Ga0157308_1020815223300012910SoilVSTAAAIFFFVVKPANALNSRFETPEEAAVSDEERRHQELLAALARVGR*
Ga0157308_1041441433300012910SoilAVFFFVVKPMNMLRERRAGSAEEERLPDEERRHQELLAALRERRA*
Ga0157302_1029801713300012915SoilITDVIQFLAIAAAVFFFIVKPVQAMLARSRREPIEEGMPDEERRHQELLAALGSIRR*
Ga0137419_1193581123300012925Vadose Zone SoilAVFFFIVKPVQMMLAAGRRDPVEEGIPDEERRHQELLAALRTRS*
Ga0164300_1113625623300012951SoilTAAITFVATAAAIFFFVVKPMGAIMARMRKSEDEVVSDEERRHQELLAAIRESAR*
Ga0164299_1071587623300012958SoilAAAVFFFVVKPVNAIVARSRGPEDEPVSDEERRHQELLAALRELDR*
Ga0164302_1084523813300012961SoilTNVIPFAAIAAAVFFFIVKPVDALLRRHRSPAEEGMPDEERRHQELLAALRGASAR*
Ga0164308_1017033643300012985SoilAAALFFFVVKPIDAIKSRMAKPTETEVTDEERRHQELLAALARIER*
Ga0164305_1128846913300012989SoilTFIATAAAVFFFVVKPMNAITARVRKRDEEEISDDERRHQELLAALRARA*
Ga0164305_1164044423300012989SoilVKPYDALTSRFAKPAEGAVDDEERRHQELLAALRAR*
Ga0157307_104874413300013096SoilITDAITFVATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRESRA*
Ga0157370_1140744223300013104Corn RhizosphereAVFFFVVKPMDALTKRVEKPTEEEVSDEERRHQELLAALRAR*
Ga0157378_1073626823300013297Miscanthus RhizosphereITFVATAAAIFFFVVKPMGAIMARMRKSEDEVVSDEERRHQELLAAIRESGR*
Ga0120154_115041923300013501PermafrostVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASK*
Ga0120109_110334633300014052PermafrostVVKPYELYMARVRGPQEEVVPDEERRHQELLAAIRGLGR*
Ga0075313_117896613300014267Natural And Restored WetlandsAAVFFFIVKPMSAIMARMRKPGEEEVTDEERRHQELLEAVRGISR*
Ga0075342_125208523300014320Natural And Restored WetlandsVTTAAAIFFFVVKPVSTLMARMAKPDEVEVTDEERRHQELLAALRARQPR*
Ga0157380_1006494213300014326Switchgrass RhizosphereITFIAPAAAIFFFVVRPMNALMARFQKPEEETVSDEERRHQELLAALRAR*
Ga0157379_1223048423300014968Switchgrass RhizosphereVFFFVVKPMDAIKARMSKAEEATIDDDERRHQELLAALAARN*
Ga0173480_1046619033300015200SoilAAAVFFFVVKPMNMLRERRAGSVEEEGLPDEERRHQELLAALGSIRR*
Ga0137409_1075639513300015245Vadose Zone SoilIGAAVFFFILKPVQMMLARNRREPIEEGVPDEECRHQELLAALRASR*
Ga0182007_1030491323300015262RhizosphereAVYFFVVKPVEAMMARFKREPIEEGMPDEERRHQELLAALGRLAAR*
Ga0132258_1031632043300015371Arabidopsis RhizosphereFITDVISFVAIAAAVFLFVVKPMDALMSRARKPAEDEVSDVERRHQELLAALRTRG*
Ga0132258_1206113043300015371Arabidopsis RhizosphereAVITFIAIAAAVFFFVVKPMDAIKARMSKAEEATIDDDERRHQELLAALAARN*
Ga0132258_1310208713300015371Arabidopsis RhizosphereAAVFFFVVKPMDAIKKRMTKEEEAAVSDEERRHQELLAALRERNA*
Ga0132258_1364762313300015371Arabidopsis RhizosphereQMMAARGQKEPIEEGMPDEERRHQELLAALRARP*
Ga0132256_10026785653300015372Arabidopsis RhizosphereAVFFFVVKPMNALRERRAGGAEEEGLPDEERRHQELLAALRESRA*
Ga0132256_10256715613300015372Arabidopsis RhizosphereVSTAAAIFFFVVKPVNAIVARGHRPEDEPVSDEERRHQELLVALREVSR*
Ga0132257_10053812843300015373Arabidopsis RhizosphereFFFVVKPVAAMAARRAAPIEAGMPDEERRHQELLAALGSLSR*
Ga0132257_10197807923300015373Arabidopsis RhizosphereVFFFVVKPVNALTARFQSPVEEGTPDEERRHQELLAALRESRA*
Ga0132257_10213650323300015373Arabidopsis RhizosphereVFFFIVKPVQMMLERSRKEPIEEGMPDEERRHQELLAALRASR*
Ga0132257_10272585313300015373Arabidopsis RhizospherePVQAMMARRAAPVEEGMPDEERRHQEVLAALGRLSR*
Ga0132257_10303963713300015373Arabidopsis RhizosphereITFVSTAAAIFFFVVKPANALKSRFETPEEAAVSDEERRHQELLVALERLGR*
Ga0132255_10108461033300015374Arabidopsis RhizosphereIAIAAAVFFFVVKPMDAIKARMSKAEEATIDDDERRHQELLAALAARN*
Ga0132255_10306547213300015374Arabidopsis RhizosphereVIQFVAIAAAVFFFVVKPVSALMARFQSPVEERTPDEERRHQELLAALRESRA*
Ga0134074_130239013300017657Grasslands SoilVKPVNVLLQRFLSPAEEGMPDEERRHQELLAALRSSSSQAS
Ga0183260_1093422523300017787Polar Desert SandQFLAIGAAVFFFVVKPVQEMLARSRRTPVEEGMPDEERRHQELLAALQTRT
Ga0136617_1028018113300017789Polar Desert SandVKPVQMMLARGRREPIEEGMPDEERRHQELLAALRASN
Ga0163161_1169498213300017792Switchgrass RhizosphereAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR
Ga0184610_122824623300017997Groundwater SedimentVVKPVQAMLARGRGEPGDEGMPDEERRHQELLAALRASN
Ga0184610_131265513300017997Groundwater SedimentTFVAIAAAVFFVVVKPMQAITARRKKDEPDVVPDEERRHQELLAALRAR
Ga0187788_1041751313300018032Tropical PeatlandIITFVSIAAAVFFFVVRPYEAIKARRSPEEEAAVDDDERRHLELVEAIRGIRA
Ga0184620_1014757513300018051Groundwater SedimentFITDVIQFVAIAAAVFFFIVKPVQLARAQRSGRDAEEEAPSDEERRHQELLAALRAG
Ga0184623_1039971613300018056Groundwater SedimentGAFITDVIQFLAIGAAVYFFVVKPVQMMLERSRRTPVEEGMPDEERRHQELLAALRGRG
Ga0184619_1005241023300018061Groundwater SedimentMTNVIKFVAIAAAVFFSIVKPVNVLLQRFQSPSEEGMPDEERRHQELLAALRSSSS
Ga0184619_1045978713300018061Groundwater SedimentVFFFVVKPVNALLKRFRSPAEEGMPDEERRHQELLAALRGASSPAAG
Ga0184619_1050028713300018061Groundwater SedimentMTNVIKFVAIAAAVFFSIVKPVNVLLQRFRSPAEEGMPDEERRHQQLLAALRSSSS
Ga0184637_1044498013300018063Groundwater SedimentAAVFFFVVKPMNALVGRMQAPGEAAISDEERRHQELLQAINGLGR
Ga0184635_1016287813300018072Groundwater SedimentVSVAAAVFFFVVKPINSLMGRFRSPVEEGMPDEERRHQELLAALKAR
Ga0184633_1061837713300018077Groundwater SedimentIAFVAIAAAVFFFVVKPVGAMVARMKKPGEEAVSDEERRHQELLAALRARG
Ga0184628_1023656723300018083Groundwater SedimentAAVFFFVVKPVQAMMARSERTPVEEGMPDDERRHQELLSALRAVGSR
Ga0190272_1169754213300018429SoilTAVFFFVVKPVQAMLERRREPIEEGMPDEERRHQELLAALRARS
Ga0190275_1049314313300018432SoilAAAIFFFVVRPMGGLMARMRKPDATEVTDEERRHQELLAALRARA
Ga0190275_1081284123300018432SoilAAVFFFVVKPVQAMLARSGRTPVEEGMPDDERRHQELLSALRAAGSR
Ga0190268_1015870223300018466SoilVIQFVSIAAAVFFFVVKPVNALLQRIRSPVEEGMPDEERRHQELLAALKAR
Ga0190268_1200728323300018466SoilFFFIVKPMNALQGRFAKPEDEVVSDEERRHQELLAALRAN
Ga0190270_1023436353300018469SoilAVFFFVVKPVNALLDRLRSPAEEGMPDEERRHQELLTALRARP
Ga0190271_1225195913300018481SoilIAAAVFFFVVRPMKMLMERRAKDEPEVVSDEERRHQELLAALRART
Ga0184644_174141223300019269Groundwater SedimentVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN
Ga0190267_1100924023300019767SoilVVKPVQMMLARGRKEPIEEGMPDEERRHQELLAALRARA
Ga0193739_110375623300020003SoilAVFFCFVKPVTAMMRRRGPEPIEEGMPDDERRHQELLAALSQISSR
Ga0193696_114398423300020016SoilAAIFFFVVKPMVAIQERRKRGEEEVVTDEERRHRELIAAIERART
Ga0193696_117507213300020016SoilFITDAIAFLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR
Ga0213881_1023897933300021374Exposed RockAVFFFIVKPVQMVLARRTQRDAEEEAPSDEERRHQELLAALAALQR
Ga0247747_104317113300022737SoilAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR
Ga0222622_1000635483300022756Groundwater SedimentLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR
Ga0222622_1027729533300022756Groundwater SedimentFFCVVKPVNALKARLTPPAEAELSDEERRHRELLAALEGLKR
Ga0222622_1117649323300022756Groundwater SedimentITDLITFLAIAAAVFFFIVKPVDMISKRRRLEGPEADEISDEERRHQELLAALRARA
Ga0247790_1021376613300022915SoilVVKPVNAMLRRFRGPVEEGMPDEERRHQELLAALKASRA
Ga0247793_108188113300023066SoilFFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR
Ga0247754_102527113300023102SoilITDVISFVAIAAAVFFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR
Ga0247800_108271023300023263SoilFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR
Ga0247789_101257233300023266SoilPRDRRAVFFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA
Ga0247794_1033050113300024055SoilSTAAAIFFFVVKPANALNSRFETPEEAAVSDEERRHQELLAALERLGR
Ga0209519_1041184413300025318SoilFVVKPLNALTARMKKPEEDAVPDEERRHQELLAALRSRG
Ga0209641_1040137533300025322SoilIAFVAVAAAIFFFVVKPMQALMSRLKKPEEVVISDEERRHQELLTALRAAR
Ga0209641_1041446313300025322SoilTAAAIFFVVVKPMNALAERIQKPGEEALSDEERRHQELLAAIRESARQRS
Ga0209751_1053484413300025327SoilFVIIAAAIFFVVKPASMTLERLKGKEEEAVPDEERRHQELLAALRTRG
Ga0209751_1087457413300025327SoilIVAVITFVAIAAAVFFFIVKPVDAITARTKRPGEEATPDEERRHQELLAAIKEMSR
Ga0210143_102625513300025792Natural And Restored WetlandsAFLTDAIAFLGVAVAVFFFVVKPINALRERRGGSAEEEGLPDEERRHQELLAALRETRA
Ga0209540_1046526923300025888Arctic Peat SoilTAVFFFIVKPVDTAKARFAKPGEEELSDEERRHQELLSALQIVGK
Ga0207642_1075268923300025899Miscanthus RhizosphereTFIATAAAIFFFVVKPMNALMARMSKPEEEALSDEERRHQELLAALRAR
Ga0207647_1023465733300025904Corn RhizosphereITDVISFVAIAAAVFFFVVKPMDALTKRVEKPTEEEVSDEERRHQELLAALRAR
Ga0207645_1081199223300025907Miscanthus RhizosphereTDVISFVAIAAAVFFFVVKPMDALTKRVEKPTEEEVSDEERRHQELLAALRAR
Ga0207663_1056608523300025916Corn, Switchgrass And Miscanthus RhizosphereYYGAFLTDLVQFAAIGAAVFFFIVKPVQMMQARNRQEPVEEGMPDEERRHQELLAALQAN
Ga0207662_1120608813300025918Switchgrass RhizosphereFITSAITFLATAAAIFLFVVKPYDALTSRFAKPAEGAVDDEERRHQELLAALQAR
Ga0207701_1132922423300025930Corn, Switchgrass And Miscanthus RhizosphereFFFVVKPMDAIKQRMTREEEATISDEERRHQELLAALGARN
Ga0207686_1055005013300025934Miscanthus RhizosphereIAAAVFFFVVKPMDAMKKRMTRAEEATISDEERRHQELLAALRSRP
Ga0207640_1187248223300025981Corn RhizosphereIAAAVFFFVVKPMDALTKRRAKPTEEEVSDEERRHQELLAALRAR
Ga0207640_1208825813300025981Corn RhizosphereAITFVATAAAVFFFIVKPMNALTARFVKPGEEEVPDEERRHQELLAALRAR
Ga0207658_1194809013300025986Switchgrass RhizosphereSFVAIAAAVFFFVVKPMNAIMKRVSKPTDEEISDEERRHQELLAALRAR
Ga0207683_1094403013300026121Miscanthus RhizosphereVAIAAAVFFFVVKPMDAMKKRMTRAEEATISDEERRHQELLAALRSRP
Ga0207698_1094345833300026142Corn RhizosphereAIAFVAVAAAVFFFVVKPMTILRERRAGGAEEEGLPDEERRHQELLAALRESRA
Ga0209803_112597733300026332SoilIVKPVNMLLQRFRSPAEEGLPDEERRHQELLAALRAAH
Ga0207497_10439523300026786SoilFVVKPVNAMLRRFRGPVEEGMPDEERRHQELLAALKGSRA
Ga0208761_102944613300026995SoilFVVKPMNALTSRFVKPGEEEIPDEERRHQELLAALRARA
Ga0247818_1078564623300028589SoilTDLIQFIAIGLAVFFFIVKPVQMALARRKGREAEEEAPSDEERRHQELLAALRARG
Ga0307313_1006695613300028715SoilQFVAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN
Ga0307307_1001801513300028718SoilAFLTDLIQFVAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRASN
Ga0307301_1020993613300028719SoilVFFFIVKPVQAMIARMMRKPIEEGMPDEERRHQELLAALGRVWR
Ga0307318_1013704423300028744SoilAAAIFFFVVKPVNAVMSRMQKPAEDEVTDDERRHQELLAALRSR
Ga0307297_1013808013300028754SoilITDVIQFLAIAAAVFFFIVKPVQAMLARSRREPIEEGMPDEERRHQELLAALGSIRR
Ga0307320_1005234913300028771SoilAIFFFVVKPMNVLRERRAGGAEEEGLPDEERRHLELLAALREIRA
Ga0307288_1003477233300028778SoilNLIQFIAIAASVFFFVVKPVNALLQRHKSPAEEGMPDEERRHQELLAALHASR
Ga0307323_1018825123300028787SoilITDAIAFLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR
Ga0307323_1032257713300028787SoilAVFFFIVKPMQMMLARRRGGPIEEGMPDEERRHQELLAALRASN
Ga0247824_1095580023300028809SoilIAAAVFFFVVRPMDAIMTRVRKPADAEVSDEERRHQELLAALRARA
Ga0307292_1019688913300028811SoilFFVVKPVNALKARFITPAETELADEERRHRELLTALEGLKR
Ga0307292_1021093213300028811SoilPVTAMMNRSRREPIEEGMPDEERRHQELLAALGQPSR
Ga0247825_1054125823300028812SoilVTAAAIFFFVVKPMNALMARVRKPAEDEITDEERRHQELLAAIKGLGR
Ga0307302_1001073313300028814SoilTDAIAFLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR
Ga0307302_1053361013300028814SoilLIQFVAIAASVFFFIVKPVDALLKRHKSAAEEGMPDEERRHQELLAALHASR
Ga0307310_1054689923300028824SoilTDLITFLAIAAAVFFFIVKPVDMISKRRRLEGPEADEISDEERRHQELLAALRARA
Ga0307314_1017227313300028872SoilAFLAIAAALFFFVVKPMNMIMERRRGPGEEVVSDEERRHQELLAALRAAR
Ga0307289_1026741623300028875SoilFVAIAASVFFFIVKPVDALLKRHKSAAEEGMPDEERRHQELLAALHASR
Ga0307289_1039802113300028875SoilIQFVAIAAAVFFFVVKPVNALMARFHSPAEEGMPDEERRHQELLTALRESRA
Ga0307277_1033248423300028881SoilTDLIQFVAIGAAVFFFIVKPVQMMLERSRREPIEEGMPDEERRHQELLAALRASN
Ga0307308_1011219743300028884SoilAGAVFFFVVKPVNALLQRFRSPAEEGMPDEERRHQELLAALRSSSA
Ga0299907_1019845333300030006SoilFLTAVITFLTTALAIFFFVVKPVGAVMARTEKPTEEEVTDEERRHQELLAALARR
Ga0247826_1142560023300030336SoilAIQFVAIAAAVFFFVVRPLDAIMGRVRKPTEEGISDEERRHQELLAALRARA
Ga0299906_1027571733300030606SoilTAAIQFLAIAAAVFFFIVKPMTAIMARMRKPDAEEVTDEERHHRELLEAIRGISR
Ga0299913_1088698513300031229SoilVVKPVNAMLTRRRGPVEEGMPDEERRHQEVLAALGRIGAR
Ga0265328_1016171713300031239RhizosphereFITDLTQFAAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRARS
Ga0265325_1028536213300031241RhizosphereDLIQFAAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRARS
Ga0265327_1003135543300031251RhizosphereAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRARS
Ga0265316_1000952013300031344RhizosphereAFITDLIQFAAIGAAVFFFIVKPVQMMLARSRREPIEEGMPDEERRHQELLAALRARS
Ga0310887_1045649013300031547SoilVATAAAIFFFVVKPMNALMARVKKPEEEVVSDEERRHQELLAALRAR
Ga0310887_1108147613300031547SoilAAVFFFVVKPMDSIMSRVRKPAEEEVSDEERRHQELLAALRARA
Ga0307408_10138989813300031548RhizosphereITDVISFVAIAAAVFFFVVKPMNALMKRVSKPTEEEVSDEERRHQELLAALRART
Ga0310886_1093588713300031562SoilITDVIQFLAIAAAVFLFIVKPVQGMVARREAPVEEGMPDEERRHQELLAALGQVGSR
Ga0247727_1028707423300031576BiofilmMITFIAIAAAVFFFVVKPVQAALAGTRQPAGEDVSGEERRHQELLATIRGIGR
Ga0307469_1233812813300031720Hardwood Forest SoilIVKPVQAMVARREAPVEEGMPDEERRHQELLAALGQVGSR
Ga0307468_10095672023300031740Hardwood Forest SoilVFLFIVKPVQAMVARREAPVEEGMPDEERRHQELLAALGQVGSR
Ga0315290_1006535043300031834SedimentMVITFLVIAAAVFFFVVKPLEAIKARRKQEEEEVVSDEERRHQELLAARKARN
Ga0315290_1074325123300031834SedimentIFFFVVKPMNALMLRMEKPGEAAVPDEERRHQELLAAIKEISR
Ga0318517_1054783213300031835SoilAAVFFFIVKPIDALRARRAKGEDEAPLSDEERRHQELLAALRAS
Ga0310907_1089260613300031847SoilIAAAVFFFVVKPMNAIMARGRKPTDEVVSDEERRHQELLAALRARG
Ga0310892_1055373713300031858SoilAAVFFFVVKPMDALMKRVAKPTDEEVSDEERRHQELLAALRTR
Ga0307416_10232109913300032002RhizosphereVQFLAVAAAVFFFVVKPVQAMMARRRREPIEEGMPDEERRHQELLTALGRMAR
Ga0318569_1008248713300032010SoilFFIVKPIDALRARRAKGEDEAPLSDEERRHQELLAALRAS
Ga0310906_1051641813300032013SoilAAITFVSTAVAIFFFVVKPANALKTRFTPAEEAAISDEERRHQELLAALERLGR
Ga0315292_1035872633300032143SedimentAAAVFFFVVKPMDAIKARTAKQEEAAVSDEERRHQELLAALRSRN
Ga0315281_1157634523300032163SedimentMVITFPVIAAAVFFFVVKPLEAIKARRKQEEEEVVSDEERRHQELLAARKARN
Ga0247830_1133415323300033551SoilVAIAAAVFFFVVKPIDALTSRRRPAAAEDEVPDEERRHLELLAALGQLSR
Ga0364925_0180540_2_1573300034147SedimentLITFIATAAAIFFFVVKPVNAVMSRMKKPAEDEVTDEERRHQELLAALRSR
Ga0364931_0020251_1713_18713300034176SedimentITFVATAAALFFVDVRPMNALVGRMQAPGEAAISDEERRHQELLQANKGLGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.