NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F016573

Metagenome / Metatranscriptome Family F016573

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F016573
Family Type Metagenome / Metatranscriptome
Number of Sequences 246
Average Sequence Length 128 residues
Representative Sequence VSAPLKKADLLAVAYYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKREKKTKTKPKARGTAA
Number of Associated Samples 184
Number of Associated Scaffolds 246

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.13 %
% of genes near scaffold ends (potentially truncated) 77.64 %
% of genes from short scaffolds (< 2000 bps) 81.71 %
Associated GOLD sequencing projects 172
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.593 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(15.447 % of family members)
Environment Ontology (ENVO) Unclassified
(32.520 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.715 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.30%    β-sheet: 0.00%    Coil/Unstructured: 48.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 246 Family Scaffolds
PF13560HTH_31 1.22
PF03466LysR_substrate 1.22
PF13443HTH_26 1.22
PF04956TrbC 1.22
PF01545Cation_efflux 0.81
PF00126HTH_1 0.81
PF13378MR_MLE_C 0.81
PF03979Sigma70_r1_1 0.81
PF00069Pkinase 0.81
PF02195ParBc 0.81
PF12770CHAT 0.81
PF09278MerR-DNA-bind 0.81
PF08924DUF1906 0.41
PF03625DUF302 0.41
PF13413HTH_25 0.41
PF00691OmpA 0.41
PF08282Hydrolase_3 0.41
PF04250DUF429 0.41
PF10088DUF2326 0.41
PF02687FtsX 0.41
PF07669Eco57I 0.41
PF00753Lactamase_B 0.41
PF01139RtcB 0.41
PF03960ArsC 0.41
PF02146SIR2 0.41
PF08937DUF1863 0.41
PF03928HbpS-like 0.41
PF02899Phage_int_SAM_1 0.41
PF01935DUF87 0.41
PF13286HD_assoc 0.41
PF00072Response_reg 0.41
PF00497SBP_bac_3 0.41
PF06441EHN 0.41
PF13561adh_short_C2 0.41
PF05368NmrA 0.41
PF14267DUF4357 0.41
PF08281Sigma70_r4_2 0.41
PF03167UDG 0.41
PF13414TPR_11 0.41
PF03534SpvB 0.41
PF13620CarboxypepD_reg 0.41
PF02586SRAP 0.41
PF14559TPR_19 0.41
PF12146Hydrolase_4 0.41
PF00589Phage_integrase 0.41
PF00248Aldo_ket_red 0.41

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 246 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.25
COG3838Type IV secretory pathway, VirB2 component (pilin)Intracellular trafficking, secretion, and vesicular transport [U] 1.22
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.81
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.81
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.81
COG0789DNA-binding transcriptional regulator, MerR familyTranscription [K] 0.81
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.81
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.41
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.41
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.41
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.41
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.41
COG2410Predicted nuclease (RNAse H fold)General function prediction only [R] 0.41
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.41
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.41
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.41
COG1690RNA-splicing ligase RtcB, repairs tRNA damageTranslation, ribosomal structure and biogenesis [J] 0.41
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.41
COG1393Arsenate reductase or related protein, glutaredoxin familyInorganic ion transport and metabolism [P] 0.41
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 0.41
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.41
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.41
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.41
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.41


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.59 %
UnclassifiedrootN/A0.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10075439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1632Open in IMG/M
3300001356|JGI12269J14319_10320249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → Anaeromyxobacter dehalogenans553Open in IMG/M
3300001593|JGI12635J15846_10356207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae896Open in IMG/M
3300001686|C688J18823_10441605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae838Open in IMG/M
3300003352|JGI26345J50200_1041983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae516Open in IMG/M
3300004080|Ga0062385_10133311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1258Open in IMG/M
3300004082|Ga0062384_100117692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → Microbacterium esteraromaticum1453Open in IMG/M
3300004152|Ga0062386_101193917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae632Open in IMG/M
3300004635|Ga0062388_100188354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → Microbacterium esteraromaticum1615Open in IMG/M
3300005437|Ga0070710_11367490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae528Open in IMG/M
3300005534|Ga0070735_10072206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2219Open in IMG/M
3300005541|Ga0070733_10003743All Organisms → cellular organisms → Bacteria10317Open in IMG/M
3300005586|Ga0066691_10797200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp.557Open in IMG/M
3300005610|Ga0070763_10479945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae709Open in IMG/M
3300006052|Ga0075029_101210140All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae528Open in IMG/M
3300006059|Ga0075017_100081387All Organisms → cellular organisms → Bacteria2229Open in IMG/M
3300006162|Ga0075030_100035505All Organisms → cellular organisms → Bacteria4237Open in IMG/M
3300006162|Ga0075030_100763001All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae765Open in IMG/M
3300006173|Ga0070716_100086252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1888Open in IMG/M
3300006174|Ga0075014_100025303All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB602334Open in IMG/M
3300006176|Ga0070765_100225822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1709Open in IMG/M
3300006797|Ga0066659_11515669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae562Open in IMG/M
3300007258|Ga0099793_10087584All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1428Open in IMG/M
3300007982|Ga0102924_1063495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2057Open in IMG/M
3300009012|Ga0066710_100849210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1402Open in IMG/M
3300009038|Ga0099829_10814916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae775Open in IMG/M
3300009137|Ga0066709_100141871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3052Open in IMG/M
3300009176|Ga0105242_13034106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae520Open in IMG/M
3300009518|Ga0116128_1227098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae521Open in IMG/M
3300009521|Ga0116222_1078497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1425Open in IMG/M
3300009521|Ga0116222_1365234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae626Open in IMG/M
3300009549|Ga0116137_1179869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae573Open in IMG/M
3300009616|Ga0116111_1040991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1400Open in IMG/M
3300009638|Ga0116113_1182028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae537Open in IMG/M
3300009665|Ga0116135_1016665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → Leptolyngbya ohadii2551Open in IMG/M
3300009665|Ga0116135_1172997All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae815Open in IMG/M
3300009672|Ga0116215_1036339All Organisms → cellular organisms → Bacteria2258Open in IMG/M
3300009672|Ga0116215_1260119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae758Open in IMG/M
3300009683|Ga0116224_10356169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae696Open in IMG/M
3300009839|Ga0116223_10521789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae690Open in IMG/M
3300010341|Ga0074045_10951910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae541Open in IMG/M
3300010358|Ga0126370_11175530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae712Open in IMG/M
3300010379|Ga0136449_100865925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1479Open in IMG/M
3300010379|Ga0136449_101794595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae918Open in IMG/M
3300010379|Ga0136449_102753545All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae696Open in IMG/M
3300011269|Ga0137392_10315549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1293Open in IMG/M
3300012189|Ga0137388_11903442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae525Open in IMG/M
3300012200|Ga0137382_11022782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae592Open in IMG/M
3300012202|Ga0137363_10795274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae802Open in IMG/M
3300012205|Ga0137362_10857884All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae776Open in IMG/M
3300012363|Ga0137390_10632242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1036Open in IMG/M
3300012918|Ga0137396_10037744All Organisms → cellular organisms → Bacteria3245Open in IMG/M
3300012925|Ga0137419_10449038All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1016Open in IMG/M
3300014156|Ga0181518_10271785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae853Open in IMG/M
3300014156|Ga0181518_10282396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae832Open in IMG/M
3300014156|Ga0181518_10593847All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae516Open in IMG/M
3300014158|Ga0181521_10591995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae521Open in IMG/M
3300014159|Ga0181530_10153510All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1310Open in IMG/M
3300014159|Ga0181530_10202094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1092Open in IMG/M
3300014159|Ga0181530_10598881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae539Open in IMG/M
3300014162|Ga0181538_10073293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2070Open in IMG/M
3300014162|Ga0181538_10517739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae627Open in IMG/M
3300014199|Ga0181535_10193087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1254Open in IMG/M
3300014489|Ga0182018_10061965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales2256Open in IMG/M
3300014489|Ga0182018_10751176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae507Open in IMG/M
3300014491|Ga0182014_10364417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae727Open in IMG/M
3300014492|Ga0182013_10020303All Organisms → cellular organisms → Bacteria → Acidobacteria6044Open in IMG/M
3300014493|Ga0182016_10018883All Organisms → cellular organisms → Bacteria6244Open in IMG/M
3300014495|Ga0182015_10566698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae722Open in IMG/M
3300014501|Ga0182024_10021505All Organisms → cellular organisms → Bacteria11706Open in IMG/M
3300014501|Ga0182024_10141000All Organisms → cellular organisms → Bacteria → Proteobacteria3408Open in IMG/M
3300014501|Ga0182024_10490448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1565Open in IMG/M
3300014502|Ga0182021_12016814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae695Open in IMG/M
3300014638|Ga0181536_10045537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2966Open in IMG/M
3300014654|Ga0181525_10459726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae702Open in IMG/M
3300015241|Ga0137418_10024919All Organisms → cellular organisms → Bacteria5529Open in IMG/M
3300016404|Ga0182037_12143100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae503Open in IMG/M
3300017823|Ga0187818_10475553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae559Open in IMG/M
3300017931|Ga0187877_1013401All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4852Open in IMG/M
3300017938|Ga0187854_10412292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae566Open in IMG/M
3300017938|Ga0187854_10446626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae540Open in IMG/M
3300017943|Ga0187819_10231386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1085Open in IMG/M
3300017946|Ga0187879_10247996All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae993Open in IMG/M
3300017948|Ga0187847_10041149All Organisms → cellular organisms → Bacteria → Acidobacteria2688Open in IMG/M
3300017948|Ga0187847_10522639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae659Open in IMG/M
3300017948|Ga0187847_10604852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae613Open in IMG/M
3300017955|Ga0187817_10044789All Organisms → cellular organisms → Bacteria2714Open in IMG/M
3300017973|Ga0187780_11403164All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae515Open in IMG/M
3300017995|Ga0187816_10131245All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1080Open in IMG/M
3300017995|Ga0187816_10311564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae692Open in IMG/M
3300018002|Ga0187868_1030422All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2478Open in IMG/M
3300018003|Ga0187876_1057334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1579Open in IMG/M
3300018004|Ga0187865_1052769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1624Open in IMG/M
3300018007|Ga0187805_10523122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae557Open in IMG/M
3300018008|Ga0187888_1101956All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1221Open in IMG/M
3300018014|Ga0187860_1343571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae569Open in IMG/M
3300018017|Ga0187872_10022039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3679Open in IMG/M
3300018017|Ga0187872_10204914All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae908Open in IMG/M
3300018017|Ga0187872_10329785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae660Open in IMG/M
3300018026|Ga0187857_10197094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae941Open in IMG/M
3300018033|Ga0187867_10700851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae552Open in IMG/M
3300018034|Ga0187863_10413289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae752Open in IMG/M
3300018034|Ga0187863_10774178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae543Open in IMG/M
3300018035|Ga0187875_10005868All Organisms → cellular organisms → Bacteria → Acidobacteria8227Open in IMG/M
3300018035|Ga0187875_10441176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae693Open in IMG/M
3300018038|Ga0187855_10007669All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum7474Open in IMG/M
3300018038|Ga0187855_10045468All Organisms → cellular organisms → Bacteria → Acidobacteria2749Open in IMG/M
3300018038|Ga0187855_10154848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G41366Open in IMG/M
3300018038|Ga0187855_10477708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae726Open in IMG/M
3300018038|Ga0187855_10719677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae582Open in IMG/M
3300018040|Ga0187862_10854677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae524Open in IMG/M
3300018042|Ga0187871_10685284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae570Open in IMG/M
3300018043|Ga0187887_10389893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae822Open in IMG/M
3300018043|Ga0187887_10521203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae701Open in IMG/M
3300018044|Ga0187890_10099367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1693Open in IMG/M
3300018044|Ga0187890_10260270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae976Open in IMG/M
3300018046|Ga0187851_10205223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1169Open in IMG/M
3300018046|Ga0187851_10491855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae697Open in IMG/M
3300018047|Ga0187859_10530930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae657Open in IMG/M
3300018047|Ga0187859_10630464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae605Open in IMG/M
3300018047|Ga0187859_10779438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae548Open in IMG/M
3300018057|Ga0187858_10892835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae523Open in IMG/M
3300018062|Ga0187784_10027916All Organisms → cellular organisms → Bacteria → Acidobacteria4555Open in IMG/M
3300018085|Ga0187772_10618450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae772Open in IMG/M
3300018090|Ga0187770_10266477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1329Open in IMG/M
3300018090|Ga0187770_11663395Not Available521Open in IMG/M
3300019786|Ga0182025_1310586All Organisms → cellular organisms → Bacteria1934Open in IMG/M
3300020579|Ga0210407_10022375All Organisms → cellular organisms → Bacteria → Proteobacteria4697Open in IMG/M
3300020579|Ga0210407_10871416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae692Open in IMG/M
3300020580|Ga0210403_10730830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae791Open in IMG/M
3300020580|Ga0210403_10791802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae754Open in IMG/M
3300020582|Ga0210395_10493559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae921Open in IMG/M
3300020583|Ga0210401_10226179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1729Open in IMG/M
3300020583|Ga0210401_10762095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae828Open in IMG/M
3300021168|Ga0210406_10165946All Organisms → cellular organisms → Bacteria1848Open in IMG/M
3300021402|Ga0210385_10748360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae749Open in IMG/M
3300021406|Ga0210386_11042932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae696Open in IMG/M
3300021407|Ga0210383_11451789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae569Open in IMG/M
3300021420|Ga0210394_10235678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1601Open in IMG/M
3300021432|Ga0210384_10346662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1337Open in IMG/M
3300021433|Ga0210391_10357617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1146Open in IMG/M
3300021474|Ga0210390_11492794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae535Open in IMG/M
3300021478|Ga0210402_10780400All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae880Open in IMG/M
3300021479|Ga0210410_10111898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2416Open in IMG/M
3300022557|Ga0212123_10166262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1680Open in IMG/M
3300022557|Ga0212123_10803393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae565Open in IMG/M
3300022724|Ga0242665_10307889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae556Open in IMG/M
3300022726|Ga0242654_10070772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1036Open in IMG/M
3300023030|Ga0224561_1025742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae524Open in IMG/M
3300025134|Ga0207416_1138154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae825Open in IMG/M
3300026551|Ga0209648_10452566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae795Open in IMG/M
3300026551|Ga0209648_10760947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae529Open in IMG/M
3300027604|Ga0208324_1148997All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae637Open in IMG/M
3300027660|Ga0209736_1204752All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae511Open in IMG/M
3300027662|Ga0208565_1019077All Organisms → cellular organisms → Bacteria2504Open in IMG/M
3300027662|Ga0208565_1086022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345959Open in IMG/M
3300027667|Ga0209009_1088383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae785Open in IMG/M
3300027737|Ga0209038_10042400All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1359Open in IMG/M
3300027767|Ga0209655_10112838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae904Open in IMG/M
3300027795|Ga0209139_10023869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2191Open in IMG/M
3300027842|Ga0209580_10604792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae543Open in IMG/M
3300027854|Ga0209517_10360376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae830Open in IMG/M
3300027857|Ga0209166_10608807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae555Open in IMG/M
3300027860|Ga0209611_10440681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae740Open in IMG/M
3300027867|Ga0209167_10000556All Organisms → cellular organisms → Bacteria26014Open in IMG/M
3300027867|Ga0209167_10546586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae634Open in IMG/M
3300027889|Ga0209380_10391701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae815Open in IMG/M
3300027911|Ga0209698_10053094All Organisms → cellular organisms → Bacteria3540Open in IMG/M
3300027986|Ga0209168_10083743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1660Open in IMG/M
3300028536|Ga0137415_10396847All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1184Open in IMG/M
3300028572|Ga0302152_10128854All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae804Open in IMG/M
3300028746|Ga0302233_10145235All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae919Open in IMG/M
3300028747|Ga0302219_10225624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae724Open in IMG/M
3300028762|Ga0302202_10365984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae677Open in IMG/M
3300028789|Ga0302232_10049387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2238Open in IMG/M
3300028795|Ga0302227_10341850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae568Open in IMG/M
3300028800|Ga0265338_11101903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae535Open in IMG/M
3300028801|Ga0302226_10380964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae591Open in IMG/M
3300028806|Ga0302221_10190591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae899Open in IMG/M
3300028882|Ga0302154_10350646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae717Open in IMG/M
3300028906|Ga0308309_10289739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1381Open in IMG/M
3300028906|Ga0308309_11370453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae607Open in IMG/M
3300029883|Ga0311327_10105226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum → Acidobacterium capsulatum ATCC 511962073Open in IMG/M
3300029907|Ga0311329_10790927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae606Open in IMG/M
3300029911|Ga0311361_11011376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae694Open in IMG/M
3300029914|Ga0311359_10738705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae700Open in IMG/M
3300029914|Ga0311359_10879747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae618Open in IMG/M
3300029939|Ga0311328_11073799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae521Open in IMG/M
3300029943|Ga0311340_10576211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae989Open in IMG/M
3300029943|Ga0311340_11007295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae684Open in IMG/M
3300029951|Ga0311371_11055492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae959Open in IMG/M
3300029953|Ga0311343_10554682All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1002Open in IMG/M
3300029953|Ga0311343_11292912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae550Open in IMG/M
3300029954|Ga0311331_11240192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae626Open in IMG/M
3300029956|Ga0302150_10345845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae552Open in IMG/M
3300029982|Ga0302277_1333465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae545Open in IMG/M
3300029999|Ga0311339_10054964All Organisms → cellular organisms → Bacteria5295Open in IMG/M
3300029999|Ga0311339_10208180All Organisms → cellular organisms → Bacteria2202Open in IMG/M
3300029999|Ga0311339_11699850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae553Open in IMG/M
3300029999|Ga0311339_11899357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae513Open in IMG/M
3300030007|Ga0311338_11964863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae521Open in IMG/M
3300030020|Ga0311344_11143250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae593Open in IMG/M
3300030042|Ga0302300_1133102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae725Open in IMG/M
3300030043|Ga0302306_10289444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae628Open in IMG/M
3300030520|Ga0311372_10616262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1545Open in IMG/M
3300030520|Ga0311372_13049694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae505Open in IMG/M
3300030688|Ga0311345_10202665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2012Open in IMG/M
3300030688|Ga0311345_10514229All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans1024Open in IMG/M
3300030707|Ga0310038_10201873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae949Open in IMG/M
3300031028|Ga0302180_10134390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1385Open in IMG/M
3300031090|Ga0265760_10038867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1415Open in IMG/M
3300031234|Ga0302325_10253866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2923Open in IMG/M
3300031234|Ga0302325_11845213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae755Open in IMG/M
3300031236|Ga0302324_100304760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae2440Open in IMG/M
3300031236|Ga0302324_102626976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae611Open in IMG/M
3300031261|Ga0302140_10473431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae981Open in IMG/M
3300031261|Ga0302140_11111681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae535Open in IMG/M
3300031525|Ga0302326_12214153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae701Open in IMG/M
3300031708|Ga0310686_102857569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1994Open in IMG/M
3300031708|Ga0310686_107353935All Organisms → cellular organisms → Bacteria → Acidobacteria2582Open in IMG/M
3300031708|Ga0310686_108865264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae743Open in IMG/M
3300031708|Ga0310686_117138739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae575Open in IMG/M
3300031708|Ga0310686_117854855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1100Open in IMG/M
3300031715|Ga0307476_11399711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae509Open in IMG/M
3300032160|Ga0311301_11703002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae759Open in IMG/M
3300032160|Ga0311301_11921436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae696Open in IMG/M
3300032160|Ga0311301_12050049All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae665Open in IMG/M
3300032770|Ga0335085_11849659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae617Open in IMG/M
3300032782|Ga0335082_10523807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1047Open in IMG/M
3300032782|Ga0335082_11627527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae519Open in IMG/M
3300032783|Ga0335079_11973299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae563Open in IMG/M
3300032805|Ga0335078_10252480All Organisms → cellular organisms → Bacteria → Acidobacteria2405Open in IMG/M
3300032805|Ga0335078_10296959All Organisms → cellular organisms → Bacteria → Acidobacteria2175Open in IMG/M
3300032805|Ga0335078_10490691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1581Open in IMG/M
3300032805|Ga0335078_10550677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1468Open in IMG/M
3300032828|Ga0335080_10003069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia16816Open in IMG/M
3300032897|Ga0335071_10957003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae803Open in IMG/M
3300032898|Ga0335072_11157894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae691Open in IMG/M
3300032955|Ga0335076_11224165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae635Open in IMG/M
3300032955|Ga0335076_11255502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae625Open in IMG/M
3300033134|Ga0335073_11548416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae636Open in IMG/M
3300033402|Ga0326728_10946863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae604Open in IMG/M
3300033803|Ga0314862_0068722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae788Open in IMG/M
3300033807|Ga0314866_053900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae664Open in IMG/M
3300033888|Ga0334792_168903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae543Open in IMG/M
3300033977|Ga0314861_0026832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae3502Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.45%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.72%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog7.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.69%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.44%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.03%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.03%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.22%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.22%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.22%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.22%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.63%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.41%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.41%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.41%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.41%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.41%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.41%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.41%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.41%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003352Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023030Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1007543923300000567Peatlands SoilLLAVAHYLIGHLPHSQVPILAKRHKVETEKAAKTPQELLAKRVGTYDEPALCGILLEISLLDSAYQRSGTSDDFLTDAAKRYRVDVEKLQKTVAAEFAAKRERSNAKEKAKGKAVA*
JGI12269J14319_1032024913300001356Peatlands SoilTILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVETKKDSASAQELLAKQVSTYDEAELCKLILEISLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAVAKELAAKRDQKAIKQKVRKTAD*
JGI12635J15846_1035620723300001593Forest SoilVRDCALATILQRVSAPLKKADLLAVAYYLIGHLSYSQVPALAKRHKVEAKKDSASAQEHLAKQVGTYDEAELSKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKDFAAKRDKKTVKPKVRRSAA*
C688J18823_1044160513300001686SoilLARVSAPLKKADLLTVAHYLISHLSYNQIPAVAKRHKVEETKDSDSGQELLAKQVGNYDESELCRVLLEISLLDSAYRRTATDGEDTLLSVAKRYXVDVEKLQKAVAAEFAAKRDKKTKPKAESVA*
JGI26345J50200_104198313300003352Bog Forest SoilLPKSSRFEVLPEVHTILQRVSAPLKKADLLAVTHYLIGHLSYSQVPALAKRHKVEAKKDSASAQGLLAKQVSKYDESELCKLLLEISLLDSAYQRSTPSRDDVLMDAAKRYRVDTEKLQKVVAKE
Ga0062385_1013331113300004080Bog Forest SoilILATILQRVSAPLKKADLLAVADYLIGHLSYSQVPALAKRHKVETKRDSESAQGLMVKQAGKYDESELCKLLLEISLLDSAYQRSTASQDDVLMDAAKRYRVDAEKLQKAAAGELAAKRDKKTKGGAKPKNRKTA*
Ga0062384_10011769213300004082Bog Forest SoilIEKEKLAITTRHRVLATILQRVSAPLKKADLLAVAHYVIGHLSYSQVPAVAKRHKVEANKDSASAQELLAKQVSKYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFETKRKNTTTKARARNKTTV*
Ga0062386_10119391723300004152Bog Forest SoilSAPLKKADLLAVAHYLIGHLPHSQVPILAKRHKVETEKAAKTPQELLAKRVGTYDEPALCGILLEISLLDSAYQRSGTSDDFLTDAAKRYRVDVEKLQKTVAAEFAAKRERSNAKEKAKGKAVA*
Ga0062388_10018835423300004635Bog Forest SoilEKLAITTRHRVLATILQRVSAPLKKADLLAVAHYVIGHLSYSQVPAVAKRHKVEANKDSASAQELLAKQVSKYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFETKRKNTTTKARARNKTTV*
Ga0070710_1136749013300005437Corn, Switchgrass And Miscanthus RhizosphereAILQRVSAPLKKSDLLTVAYHLVSRLSYNQIPTIAKRHKVEVKKDSDSAQELLAKQVGNYDELELCKLVLEISLLDSAYHRLASGQTDVLMEAAKRFRVDTDKLHKLVAEEIAAKQEKSRIRETTTRKKGSP*
Ga0070735_1007220613300005534Surface SoilSAPLKKADLLAIGHYLLGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSTASRDDVLMDTAKRYRVDTEKLQKAVTEELAAKRDKKTKSKPRARSKTAG*
Ga0070733_10003743123300005541Surface SoilMGGAYGSAPLKKADLLAVAHYLIGHLSYSQVPTLAKRHRVEAKKDSASAQERLAKQVGTYDDAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKVQKAVAEELATKRDRKAKAKPKPNGRKTAA*
Ga0066691_1079720013300005586SoilDLLTVADYLIGHLSYSQIPTLAKRHKAEAKKDSASAQELLAKQVSKYDDAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKTVAKEFVAKRDKKTIKSKVRQTTA*
Ga0070763_1047994513300005610SoilVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKPQKAVAEELAAKRDKRTKAGAKPKNRQTA*
Ga0075029_10121014013300006052WatershedsPLKKADLLAVAQYLISRLSYNQIPALAKRHKVELKKDSDSGQELLAKQVGNYDESELCRMLLEISLHDSAYRRTTAGGEDTLLSVAKRYRVDVEKLQKAVAAEFAAKRDKKTKPKAEAAA
Ga0075017_10008138733300006059WatershedsMRTFLAVAHYLIGHLSYSQLPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLIDAAKRYRVDTEKVQKAVAKEFASKRDKKTVKPKARTVAG*
Ga0075030_10003550563300006162WatershedsMRTFLAVAHYLIGHLSYSQLPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVVMDAAKRYRVDTEKLQKAVAEELAAKREKETKAGARRKNRKTA*
Ga0075030_10076300123300006162WatershedsAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELVAKQLGTYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEGLAAKRDKKTRAGAKPKNRKTA*
Ga0070716_10008625223300006173Corn, Switchgrass And Miscanthus RhizosphereVLATILQQVSAPLKKADLAVAHYLISRLSNNQIPAVAKRHKVETKKDASSAQELLVKQVEGYEESELCRVLMEISLLDSAYQRMNLRADLRLDAAKRYRIDVEKVQKAVSVELATKRDKKSTKSKKNAVTLWVNSLD*
Ga0075014_10002530313300006174WatershedsKLAITTRHRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQERLAKQVSTYDETELCKLVLEISLLDSAYERSTASRNDVLTDVAKRYRVDTEKLQKDVAKEFGTKRDRKATTKAKLSGRKTAT*
Ga0070765_10022582223300006176SoilMANLSFSMLLATILQRVSAPLKKADLLTVANYFIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSPTSRDDVLIGAAKRYRVDNDKIQKAVATAFVAKHGKKSKAKPRGPRRTAV*
Ga0066659_1151566913300006797SoilVSAPLKKADLLAVAHYLIGHLSYSQVPILAKRHKAEAKKDSASAQELLAKQVSKYDDAELCKLLLEISLLDSAYQRNIASRNDILIDAAKRYRVDTEKLQKGVAKEFAAKRDQKAIKQKVRKTAD*
Ga0099793_1008758423300007258Vadose Zone SoilLATILERVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQGLLVKQVGSYDESELCKLLLEMSLLDSAYQRSSISRDDVLMEAAKRYRVDAEKLQKAVAKEFAAKRDKKTIKPKSGKAAA*
Ga0102924_106349523300007982Iron-Sulfur Acid SpringMASVILQIIAQYLVAHLSYNQVPALARRHKVEVKKDSDSAHELLAKQVGTYDESELCKLLLEVALLDSAYQRSTANGDDVLMSAAKRYRVDAHKLQKAVAGEIAAKLAKTGKNKSTVRSKGEA*
Ga0066710_10084921023300009012Grasslands SoilLLAVAHYLIGHLVYSQVPTLAKRHKLETKKDSESAQELLARQVSKYDESELSKLLLEISLLDSTYQRSGSSGDPLMDAAKRYRVDTEKIQKAVAEDFAAKQNAKTQVAKKVKAATAKA
Ga0099829_1081491613300009038Vadose Zone SoilSILQRVSAPLKKADLLTVAHYLIGHLSYSLVPALAKRHKVEAKKDSVSAQELLAKQVTKYEEAELCKLLLEISLLDSAYQRSTASRDDILMDAAKRYRVDTEKLQKAVTAEFVAKRGKKAKAKPDGVRKTTV*
Ga0066709_10014187143300009137Grasslands SoilLKKADLLAVAHYLIGHLVYSQVPTLAKRHKLETKKDSESAQELLARQVSKYDESELSKLLLEISLLDSTYQRSGSSGDPLMDAAKRYRVDTEKIQKAVAEDFAAKQNAKTQVAKKVKAATAKA*
Ga0105242_1303410613300009176Miscanthus RhizosphereSTPLKKADLLAVAHYLIGHLSYGQVPALAKRHRVEEKKGSAAPQETLAKQVVSYDESGLCRLLLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDTEKLQKAVAKDFAAKRDKKTIKPKVRTVAR*
Ga0116128_122709813300009518PeatlandITTRHRVLSTILQRVSAPLKKAALLAVAHYLIGHLPYSQIPALAKRHKVEPKKDSASAQEPLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTDKLQKAVAQEIAAKRDKKTKARTRPKSGKTAA*
Ga0116222_107849713300009521Peatlands SoilATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEVKKDSASAQELLDKQVGTYDEAELCKLLLEISLLDSAYQRSTSSGDDILMDAAKRYRVDAEKLQKAVSVELAAKRGNKTKTTAKPQDRKTAA*
Ga0116222_136523413300009521Peatlands SoilKADLLAVADYLIGHLAYSQVPTLAKRHKVEAKKDSESAQELLAKQVSKYDEPELCKLLLEISLLDSAYQRSGASGDVLMEAAKRYRVDAEKIQKAVVADFAAKQKAKTQLAKKPRAVTAKA*
Ga0116137_117986923300009549PeatlandHRILATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKESASAQELLAKRVRTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVANEFAAKRDKKTIKPKGRAAAA*
Ga0116111_104099123300009616PeatlandLTSATPALAFSLAGFSTILQRASAPLKKADLLAVAHYLIGHLPYSQVPALAKRHKVETKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASREDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKSLKAKGRKTAA*
Ga0116113_118202813300009638PeatlandAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSAYDESELCKLLLEISLLDSAYQRSTASSDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTVKAKTRKAA*
Ga0116135_101666513300009665PeatlandATILQRVSAPLKKADLLAVAQYLIGHLSYSQVPALAKRHKVEAKKDSESAQELLAKQVSKYEEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRNKKTKATAKPNGRKTAA*
Ga0116135_117299713300009665PeatlandATILQRVSAPLKKADLQVVAQYLVEHLSYNQVPTLAKRHKVEIKKDSDSAHEILVKQVNTYDEAGLCKLLLEISLLDSAYQRSTGNGNDVLMSAAKRYRVDADKLQKAVAEELAAKLGKTGKDKAKARSETVA*
Ga0116215_103633913300009672Peatlands SoilRILATVLQRVSAPLKKADLQAVAQYLVAHLSYNQVPALAKRRKVEVKKDSDSAQELLAKQVGTYDESELCKLLLEISLLDSAYQRASANGDDALMNAAKRYRIDAEKLQKAVAGEIAAKLAKTGGSAERVK*
Ga0116215_126011923300009672Peatlands SoilMKKADLLAIAHYLIGHLSYSQVAALAKRHKVEAKKDSASAQEFLAKGVSEYDESELCKLLLEISLLDSAYQRSTTSHDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTLKAKPRKTT
Ga0116224_1035616913300009683Peatlands SoilLAITTRHRVLATILLRVSAPLKKADLLAVAHYLIAHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTSSRDDVLMDASKRYRVDAEKLQKTVAAELAAKRDKKTNAKAKPKSRKAAA*
Ga0116223_1052178913300009839Peatlands SoilKLAITTRHRVLATILQRASAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVCTYDEAELCKLLLEISLLDSAYQRSTTSREDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKSLKAKGRKTAA*
Ga0074045_1095191013300010341Bog Forest SoilLATILQRVSAPLKKADLLAVAHYLIGHLSYSLVPALAKRHKVDAKKDSASASAQELLAKQVSGYDEAELCKLLLEISLLDSAYQRSTTSRDDVLADAAKRYRVDTEKLQKAVSAELSAKRDKKTKTTAKPKDRKTAA*
Ga0126370_1117553013300010358Tropical Forest SoilRVSAPLKKADLLTVAHYLISRLSYNQIPAVAKRHKIEVKKEANSGQELLAKQIGNYDESELCKLLLEISLLDSAYQRSTAGRADALMETAKRYRVDTDKICRVVAEEITAKQEKIKIKKATTKRKDTA*
Ga0136449_10086592523300010379Peatlands SoilAITTRHRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKLEAKKDSVSAQELLAKQVGSYDEAELCKLLLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDAEKLQKAVAEELTAKREKKTKAGANPKSRKTA*
Ga0136449_10179459523300010379Peatlands SoilMKADLLAVAHYLIGHLSYSQVPVLAKRHKVEAKKDSASGQELLAKQVGKYEEAELCKLLLEISLLDSAYQRSIAGRDDILMDAAKRYRVDTEKLQKAVAKELATKRDKKTLKPKVRKATA
Ga0136449_10275354523300010379Peatlands SoilLALAHYLIGHLSYRQVPALAKRHKVEAQKDSTSAQELLAKQVSTYDESELCKLLLEISLLDSAYQRSTASRDDALMEAAKRYRVDTEKVQKAVAKEFAAKRDKKTVKAKAHKTAA*
Ga0137392_1031554923300011269Vadose Zone SoilLAVADYLICHLSYSQVPALAKRHKVETKKDSASAQALLAKQVGTYDESELSKLLLEISLLDSAYQRSTASRDDILFDAAKRYRVDTEKLQKSVAKEFAAKRDKKAVKPKVRRSAA*
Ga0137388_1190344213300012189Vadose Zone SoilLSTVLQRVSAPLKKADLQVVAQYLVAHLSYNQVPALAKRHRVEVKKGSDSAQEPLAKQVSTYDEPALCKLLLEVCLLDSAYQRSTTNGDDVLMSAAKRYRVDAEKLQKAVAEEFSAKLVKTGKDKAMVRNKAVV*
Ga0137382_1102278213300012200Vadose Zone SoilHRILATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKQDSASAQELLVKQVGTYDEAELCKLLLEISLLDSAYQRSPASRNDVLMDAARRYRVDAEKLQRAVAEERVTKRERKTKGKANARGKTPA*
Ga0137363_1079527423300012202Vadose Zone SoilSVKEGRFIGRRHYLIGHLSYNQVPALAKWLKVEAKKDSTSAQELLAKQVSGYDESELCKLLLEISLLDSAYQRSTASRDDILMDAAKRYRVDTEKLQKAIAKEFAAKRDQKAIKQKVRNSAD*
Ga0137362_1085788423300012205Vadose Zone SoilERVSAPLKKADLLAVANYLIGHLSYNQIPALAKRHKVEPKNSDSAPEMLAKQVSKYDEAAVSKLLLEISLLDAAYQRSGASDGVLMDAARRYRVDTEKLQKAVAEDLVLKRNKRGTSVAKKTKAKAVTA*
Ga0137390_1063224213300012363Vadose Zone SoilKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSTYDESELCKLVLEISLLDSAYQRSTASHDDVLMDAAKRYRVDAERLQKAVAEELEAKRDKKTKAKAKPKARNSGIAHHP*
Ga0137396_1003774423300012918Vadose Zone SoilLATILERVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQGLLVKQVGSYDESELCKLLLEMSLLDSAYQRSSISRDDVLMEAAKRYRVDAEKLQKAVAKEFAAKRDKKTIKPKGRTAAA*
Ga0137419_1044903813300012925Vadose Zone SoilPLKKADLQLIAQYLVEHLSYNQVPVLAKRHKVEVKKDASSAHELLAKQVGAYDEADLCKLLLEVSLLDSAYQRSTANGDDVLMSAAKRYRVDAEKLQKAVAQEFVAKLAKTGKGKTAVRSREVA*
Ga0181518_1027178523300014156BogAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSGYDEAELCKLLLEISLLDSAYQRSTTSRDDVLADAAKRYRVDTEKLQKAVSAELSAKRDKKTKTTAKPKDRKTAA*
Ga0181518_1028239613300014156BogCMIRVKKADLLTVAHYLIGHLSCSQVPALAKRHKVEAKKDSASAQELLVKKVGACDEADLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKPQKAVAEELAAKRDKRTKAGAKPKNRQTA*
Ga0181518_1059384713300014156BogTILQRVSVPLKKADLLAVAQYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKRVGTYDEAELCKLLLEISLLDSAYQRSTTSRNDVLMDAAKRYRVDTERLQKIVAEELATKRDKKTKAKAQPKNRKTAA*
Ga0181521_1059199513300014158BogKKADLLAVAHYLIGHLSYSQVPPLAKRHKVEAKKDSASAQELLARQVGRYDEAELCKLLLEISLLDSAYQRSSASRDDVLMDAAKRYRVDNDKIQKAVATEFVAKHGKKSNAKPGGARRTTV*
Ga0181530_1015351023300014159BogKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSGYDEAELCKLLLEISLLDSAYQRSTTSRDDVLADAAKRYRVDTEKLQKAVSAELSAKRDKKTKTTAKPKDRTTAA*
Ga0181530_1020209413300014159BogLAVGHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDILMDTAKRYRVDAEKLQKAVAKEFAAKRDKKAIRPTRTSAT*
Ga0181530_1059888113300014159BogEKEKLAITTRHRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSTGSRADVLFDAAKRYRVDVEKLQKAVAKDLATNRKKTKTTLKSQGDVD*
Ga0181538_1007329313300014162BogTRHRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSTYDETELCKLVLEINLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAVAKEFAAKRDQKAIKQKVRKTAD*
Ga0181538_1051773913300014162BogKKADLLTVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLVKQVGTYDESELCKLLLEIRLLDSAYQRSSTSREDVLMDAAKRYRVDTERLQKAVAKEFAAKREKKTRVKPKGRNKTAA*
Ga0181535_1019308713300014199BogLKKADLLAVAHYLICHLSYSQVPALAKRHKVETKKDSASAQELLAKQVSTYDETELCKLVLEINLLDSAYQRSTASRDDILIDAAKRYRVDVEKLEKLVVAEFAAKHGKEAKPKTKLKTKSVG*
Ga0182018_1006196513300014489PalsaLTVAHYLIGHLSYSQVPALAKRHKVEAKKESASALELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLTDAAKRYRVDSEKLQKAVAGELAAKRTKKTDNGKARRT*
Ga0182018_1075117613300014489PalsaMVLQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKIEAKKDSAFAQELLAKEVGKYEEAELCKLLLEISLLDSAYQRSTASHDDVLMDTAKRYRVDTERLQKSVAEELATKRKNKTKGKSKMRRRTAA*
Ga0182014_1036441723300014491BogVSAPLKKADLLAVAYYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKREKKTKTKPKARGTAA*
Ga0182013_1002030313300014492BogEKEKLAITTRHRVLATILQRVSAPLKKADLLAVAYYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDSEKLQKAVAEELAGKREKKAKLKPNARTKTTG*
Ga0182016_1001888313300014493BogQRVSAPFKKADLLAVAHYLIAHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSMYDEADLCKLLLEISLLDSAYQRSIASRDDVLMDAAKRYRVDVEKLQKAVAEELAVKRDKKTKARVKPKGRKTAA*
Ga0182015_1056669813300014495PalsaILATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPTLAKRHKVEAKKDSASAQELLAKQVGAYDESELCKLLLEISLLDSAYQRSTASSNDVLMDAAKRYRVDAEKLQKAVAVEIAATRNKKTKVKTKLEGRTTAA*
Ga0182024_1002150513300014501PermafrostLLAVAHYLIGHLSYSQVPALGKRHKVEAKKDSASAQELLAKQVSTYDEAELCKLLLEISLLDSAYQRSTASRGDVLMDSAKRYRIDSEKLQKAVAEELAAKREKTFKAKPTVRGKTAAVAS*
Ga0182024_1014100013300014501PermafrostTILQRVSAPLKKADLLAIAHYLIGHLSYSQVPALAKRHKVETKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKGVAEELAVKREKATKAKPKARGKTGLAS*
Ga0182024_1049044833300014501PermafrostLQRVSAPLKKADLLAVAHYLIGHLSYSQIPALAKRHKVEAKKDSASAQELLAKQVSSYDESELSKLLLEISLLDSAYQRSTTSRDDVLMDTTKPYRVDTEKLQKAVAEELAAKRDEKTKAKAKPKSRKTAV*
Ga0182021_1201681413300014502FenLLAVAHYLIGHLSYSQVPALAKRHKVEVKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSSSSRDDVLMDAAKRYRVDTEKLQKAVSAELSAKRDKKTKTTAKPKDRKTAA*
Ga0181536_1004553723300014638BogVLATILQRASAPLKKADLLAVAHYLIGHLSYSQLPALAKRHKVEAKKDSASAQELLARQVSKYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFASKARNEIRKHASRRSVRQ*
Ga0181525_1045972613300014654BogILATILQRVSVPLKKADLLAVAHYLIGHLSYSQVPVLAKRHKVEAKRDSASAQELLAKRVGTCDEAELCKLLLEISLLDSAYQRTAGSRDDILMDAAKRYRVDTEKLQKAVAEELTAIREKKTKAGAKPKTRKTA*
Ga0137418_1002491953300015241Vadose Zone SoilLKKADLLTVGHYLIGHLSYSQVPALAKRHKVEVKKDSSSAHELLVKQVGTYDEADLCKLLLEVSLLDSAYQRSTANGDDVLMSAAKRYRVDAEKLQKAVAQEFVAKLAKTGKGKTAVRSREVA*
Ga0182037_1214310013300016404SoilTVRHRVLATILQRVSAPLKKADLLAIVHHLIGHLSYSQVPALAKRHKVEAKKDSASAHELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASREDVLMDAAKRYRVDAEKLQKAVAEDLAVKREKATKAKPKARGKMGSAS
Ga0187818_1047555313300017823Freshwater SedimentKKADLLTVADYLIGHLSYSQVPTLAKRHKIEAKKDSTSAQELLAKQVSKYHDAELCKLVLEISLLNSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAVELAGKRDKKTKAKAKPKSCKTA
Ga0187877_101340133300017931PeatlandLTSATPALAFSLAGFSTILQRASAPLKKADLLAVAHYLIGHLPYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASREDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKSLKAKGRKTAA
Ga0187854_1041229213300017938PeatlandRVSAPLKKADLLAVAHYLIGHLSYSQVPTLAKRHKVEAKKDAASAQELLAKQLGTCDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTIKPKGRKAAA
Ga0187854_1044662613300017938PeatlandVLATILQRVSAPLKKADLLTVGHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSTYDEAKLCKLVLEISLLDSAYQRSSTSRDDVLMDAAKRYRVDAEKLQKVVAEELSARREKETKSKPKTRRQD
Ga0187819_1023138623300017943Freshwater SedimentEKEKLAITTRHRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPAVAKRHKIEAKKDSASAQELLAKELGTYDEAELCKLLLEISLLDSAYQRSTVSRDDVLMDAAKRYRVDTEKLQKVVAKEFAAKRDQKAIKQKVRKTAD
Ga0187879_1024799613300017946PeatlandDLLTVAHYLIGHLSYSQVPALMKRHKVEAKKDSASAQELLAKQVSTYDETELCKLVLEINLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAVAKEFAAKRDQKAIKQKVRKTAD
Ga0187847_1004114913300017948PeatlandITTRHRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSAYDESELCKLLLEISLLDSAYQRSTASSDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTVKAKTRKAA
Ga0187847_1052263913300017948PeatlandLAITTRHRVLATILQRVSAPLKKADLLVVAHYLIGHLSYSQVPALAKRHKVEPKKGSASAQELLAKQVGTYDEAELCKLLIEVSLLDSAYQRPAASRDDVLMDAAKRYRVDSEKLQKAVAAEFAAKRDKKTKAKAKPTSR
Ga0187847_1060485213300017948PeatlandKLAITTRHRVLATILQRVSAPLKKADLLTVADYLIRHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSTYDETELCKLVLEINLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAVAKEFAAKRDQKAIKQKVRKTAD
Ga0187817_1004478923300017955Freshwater SedimentLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSATAQELLAKQVSTYDEAELCKLVLEISLLDSAYQRSIASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRDKKTKAGAKPKNRKTA
Ga0187780_1140316413300017973Tropical PeatlandRASAPLKKADLLADAHYLIVHLSYSQVPALAKRHKIEAKKDSASAQELLVRQVGTYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRFRVDTEKLQKAVAKEFAAKRDKKTIKPKVRTVAG
Ga0187816_1013124533300017995Freshwater SedimentLKKADLLAVAYYLIVHLSYSQVPALAKRHKVETKKDSASAQELLAKQVGSHDEAELCKLLLEISLLDSAYQRSTGSRDDVLMDAAKRYRLDTEKLQKAVAEELAAKREKKTKAGAKPRTRNTA
Ga0187816_1031156423300017995Freshwater SedimentLLTVAHYLISRLSYNQIPAVAKRHKVEVKKDSDSGQELLAKQVGNYDETELCKVLLEISLLDSAYRRSATDGEDTLLSVGKRYRVDVEKLQKAVAVEFAAKRDKKKAKPKAETAA
Ga0187868_103042243300018002PeatlandLTSATPALAFSLAGFSTILQRASAPLKKADLLAVAHYLIGHLPYSQVPALAKRHKVETKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSIASREDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKSLKAKGRKTAA
Ga0187876_105733423300018003PeatlandLTSATPALAFSLAGFSTILQRASAPLKKADLLAVAHYLIGHLPYSQVPALAKRHKVETKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASREDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKSLKAKGRKTAA
Ga0187865_105276913300018004PeatlandTRHRVLATILQRASAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSIASREDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKSLKAKGRKTAA
Ga0187805_1052312213300018007Freshwater SedimentPLKKADLLAVAHYLIGHHSYSQVPTLAKRHKVEAKKDAASAQDLLAKRVGTYDESELCKLLLEISLLDSAYQRSAASRDDVLMDAAKRYRVDTDKLQKAVAKEFAAKRDKKTIKPKGRKAAA
Ga0187888_110195613300018008PeatlandRILATILQRVSAPFKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSGYDEAELCKLLLEISLLDSAYQRSTTSRDDVLADAAKRYRVDTEKLQKAVSAELSAKRDKKTKTTAKPKDRKTAA
Ga0187860_134357113300018014PeatlandVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSGYDEAELCKLLLEISLLDSAYQRSTTSRDDVLADAAKRYRVDTEKLQKAVSAELSAKRDKKTKTTAKPKDRKTAA
Ga0187872_1002203933300018017PeatlandAITTRHRVLATILQRVSAPLKKADLLAVAHYLIGQLPYSQIPALAKRHKVEPKKDSASAQEPLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTDKLQKAVAQEIAAKRDKKTKARTRPKSGKTAA
Ga0187872_1020491423300018017PeatlandLKKGDLLAVAHYLIGHLSYSQVPALAKRHKIEANKDSTSAQELLAKQVTKYDESELCKLLLEISLLDSAYQRSTASRDDVLADAAERYRVDTEKLQKAVAAELAAKRETKTRAKAKARNKTAA
Ga0187872_1032978513300018017PeatlandLATILQRVSAPLKKADLLTVARYLIGHLSYGQVPALAKRHKVEAKKDSASAQELLAKQVGTYDESELCKLLLEVSLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTIKPKGRTAAA
Ga0187857_1019709423300018026PeatlandLKKPDLLAVAHYLIGYLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSGYDEAELCKLLLEISLLDSAYQRSTTSRDDVLADAAKRYRVDTEKLQKAVSAELSAKRDKKTKTTAKPKDRKTAA
Ga0187867_1070085113300018033PeatlandRILATILQRVSAPLKKADLLTVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTCDESELCKLLLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDTERLQKVVAKEFAAKRDKKRIKPKVRKPAA
Ga0187863_1041328913300018034PeatlandKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKEVSKYDDAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDSEKLQKAVAGELAAKRAKKTNNEKARRT
Ga0187863_1077417813300018034PeatlandRHRVLATILQRVSAPLKKADLLTVGHYLIGHLSYGQVPALAKRHKVEAKKDSSSAQELLVKQVAEFDESELSKLLLEISLLDSAYQRTATTRDDVLMDAAKRYRVDAEKLQKAVATEFVAKRDKKTKVTSKPRNKTAG
Ga0187875_10005868123300018035PeatlandLATILQRVSAPLKKADLLAVANHLIGHLSYSQVPALAKRHKVEAKKDAASAQELLAKQVGSYDEPELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTDKLQKAVAEELAAKRDKKTMGKAKPKSRRTAV
Ga0187875_1044117613300018035PeatlandLLTVGHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLKKAVAEELAATQEKKTKAGAKSKGGKTA
Ga0187855_1000766913300018038PeatlandRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAHELLDKQVSKYDESELCKLLLEISLLDSAYQRGTASCDDALMDAAKRYRVDAEKLQKAVAEELAAKRDKKTKVGAEPKSRKTA
Ga0187855_1004546813300018038PeatlandTTRHRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSAYDESELCKLLLEISLLDSAYQRSTASSDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTVKAKTRKAA
Ga0187855_1015484813300018038PeatlandHRILATILQRIAPPLKKADLLAVAHYLIGHLSYSQVPALAKRHRVEAKKDSASAQELLTKQVSKYDESELCKLLLEISLLDSAYQRSTASRDDVLTDAAKRYRADTEKVQKAVAKEFAAKRDRKTLKAKTRKMAA
Ga0187855_1047770813300018038PeatlandVAHYLIGHLSYSQVPALAKRHKIETKKDSAAAQEVLAKQVGTYDEAELCKLLLEISLLDSAYQRSGASRDDVLMDAAKRYRVDAEKLQKAVAREFVAKRDKKTKVTSKPRNKTAG
Ga0187855_1071967713300018038PeatlandEKEKLAITTRHRAFATILQRVSVPLKKADLLAVAQYLIGHLSYSQVPALAKRHKVEAKKGSASEQEILAKQVGTYDESELCKLLLEISLLDSAYQRSAANRDDVLMDTAKRYRVDTEKLQKAVEKEFAAKRGEKTLKAKPRRTAV
Ga0187862_1085467713300018040PeatlandKADLLAVADYLIGHLSYSQVPALAKRHKVETKKDSASAQELLAKQVGKYEEADLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKVQKAVAKEFAAKRDKKTVKPKARKTA
Ga0187871_1068528423300018042PeatlandSAPLKKTDLLAVAYYLMGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLHKAVAKEFAAKRDKKTRVTPKARKTAA
Ga0187887_1038989313300018043PeatlandLKKADLLAVAHYLIGHLAYSQVPALAKRHKVEAKKDSASTQELLAKRVGNYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAAELAAKQDRTTKAGAKPKTHKTA
Ga0187887_1052120313300018043PeatlandLQRASAPLKKADLLTVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKKLGTYDEAELCKLLLEISLLNSAYQRSTARRDDVLMDAAKRYRVDTEKLQKAVTAEIVAKREKKPKVKPERARKPTA
Ga0187890_1009936713300018044PeatlandTILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAHELLDKQVSKYDESELCKLLLEISLLDSAYQRGTASCDDALMDAAKRYRVDAEKLQKAVAEELAAKRDKKTKVGAEPKSRKTA
Ga0187890_1026027013300018044PeatlandMIRVKKADLLTVAHYLIGHLSCSQVPALAKRHKVEAKKDSASAQELLVKKVGADEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKPQKAVAEELAAKRDKRTKAGAKPKNHQTA
Ga0187851_1020522323300018046PeatlandKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSATAQELLAKRVGTYDESELCRILLEISLLDSAYQRSGTSDDFLTDAAKRYRVDVEKLQKAVAAELTAKKERNKVKVKVKGKPVA
Ga0187851_1049185513300018046PeatlandHRVLAAILQRASSPLKKADLTTVAHYLIGHLSYSQVPALAKRHKVEARKDAASAQELLTKQVGTYDESELCKLLLEISLLDSAYQRSTASRDDVLIDTAKRYRVDADRLQKAVAKEFAAKRDKKAIKPKARKTAA
Ga0187859_1053093023300018047PeatlandLAAILHRASSPLKKADLTTVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAHELLAKQVGTYDEAELCKLLLEISLLDSAYQRPTASRDDVLMDVAKRYRVDAEKLQKAVAEDLAVKRENATKAKPQARGRMGSAS
Ga0187859_1063046413300018047PeatlandVSAPLKKADLLAVGHYLIGHLSYSQVPTLAKRHKVEAKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSAASRDDVLMDTAKRYRVDTEKLQKAVTAEFVAKRMKKPKAKPHGVRKTAV
Ga0187859_1077943813300018047PeatlandSAPLKKADLQVVAQYLVEHLSYNQVPTLAKRHKVEIKKDSDSAHEILVKQVNTYDEAGLCKLLLEISLLDSAYQRSTGNGNDVLMSAAKRYRVDADKLQKAVAEELAAKLGKTGKDKAKARSETVA
Ga0187858_1089283513300018057PeatlandRHRVLATILQRVSAPLKKADLLTVAYYLIGHLSYSQVPALAKRHKVEAKKDSATAHELLAKQVSKYDESELCKLLLEISLLDSAYQRSTASRDDILIDAAKRYRVDTEKLQKAAAKEFAAKRSKKTVKQKAPKTAS
Ga0187784_1002791613300018062Tropical PeatlandLAVAHFLIGHLSYSQVPVLAKRHKVEAKKDSTSAQELLVKQVATYDESELCKLLLEISLLDSAYQRSKGGRDDVLADAAKRYRVDAEKLQKAVAEELAVKREKTVKAKPKARGKTAAVAS
Ga0187772_1061845013300018085Tropical PeatlandAHYLISRLSYNQIPAVAKRHKVEVKKDSDSGQELLAKQVGNYDESDLCRVLLEISLLDSAYRRSATDDEDTLLSVAKRYRVDVEKLQKAVATELAAKRDRKKAKPKAETAA
Ga0187770_1026647713300018090Tropical PeatlandLQVIAQYVVEHLPHNEVPALAKRHKVEVKKGSASSVHQLLLKQVGTYDDSEICKLLLEVALLDSAYQRSTRGDDVLMGAAKRYRVDTEKLQKAVADEFAAKLNKRQQQPDVKKTAV
Ga0187770_1166339513300018090Tropical PeatlandLLVIAQYVVEHLSYNQIPALAKRHKVEVKKGSASSAHELLLKQIGTYEESELCNLLLEVSLLDSAYQRSSTNGTDVLMSAAKRYRVDAEKLQKAAAKELAAKLAKKEGGRIKRVK
Ga0182025_131058623300019786PermafrostVSAPLKKADLLAVAHYPGWPPLLQPSPPLAKRHKVEAKDSASAQELLAKQVGTYDESELCKLFLEISLLDSAYQRSTAGRDDVLMDTAKRYRVDTEKLQKAVAKEFAAKRDKKTVKPKARKTAA
Ga0210407_1002237543300020579SoilVQKSNAPILQRVSAPLKKADLLAVAHYLIGHLSYGQVPALAKRHKVEVKKDPASAQELLVKQVGTYDEAELCKLLLEMSLLDSAYQRSSTSRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKAIKQKVRKTAD
Ga0210407_1087141613300020579SoilASTTRHRVLATILQRVSAPLKKADLLAVAHYLIGQLSYSQVPALAKRHKVEAQKDSTSAQELLAKQVTTYDESELCKLLLEIGLLDSAYQRSTARRDDVLMDTAKRYRVDTEKLQKAVAKEFVAKRDKKTIKSKVRQTTA
Ga0210403_1073083013300020580SoilAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQEILAKQVGSYDESELCKLLLEISLLDSAYQRSTGSRDDVLMDAAKRYRVDSEKLQKAVAVELAAKREKTVKAKPKA
Ga0210403_1079180223300020580SoilMLAVAHYLIGHLSYSQIPALAKRHKVETKKDSSSAQSLLAKQVGKYEEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAEELAAKRDKKRMKPKVRTAAN
Ga0210395_1049355913300020582SoilEKEKLAITTRHRVLATILRRVSAPLKKADLLTVADYLISHLSYSQVPTLAKRHKVEAKKDSASAQELLAKQVSTYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKGVAKEFAAKRDQKAIKQKVRKTAD
Ga0210401_1022617913300020583SoilDLLTVGHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSAASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTIKPKTRKTVA
Ga0210401_1076209523300020583SoilRILATILERVSAPLKKADLLALAHYLIGHLAYSQVPTLAKRHKVEAKKDSDSAQELLAKQVSKYDEPELSKLLLEISLLDSAYQRSGSSGDVLMDAAKRYRVDTDKIQKAVAEDFAAKQKAKTQVAKKAKVAAAKA
Ga0210406_1016594623300021168SoilLATIFQRVSAPLKKADLLEVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLVKQVDTYDESELCMLLLEISLLDPAYQRSTASRDDVLMDTAKRYRVDAEKLQRPLSSCT
Ga0210385_1074836023300021402SoilLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASRQELLVKRVGACDEAELCKLLLEISLLYSAYPRSTASRDDVLMDAAKRYRVDTEKPQKAVAEELAAKRDKRTKAGAKPKNRQTA
Ga0210386_1104293213300021406SoilVSAPLKKADLLTVGHYLIGHLSCSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSAASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTIKPKTRKTVA
Ga0210383_1145178913300021407SoilLKKADLLAVADYLIGHLAYSQVPTLAKRHKVEAKKDSESAQELLAKQVSKYDEPELCKLLLEISLLDSAYQRSGTSGDVLMETAKRYRVDADKIQKAVVEDFAAKQKAKTQLAKKPKAATAKA
Ga0210394_1023567813300021420SoilRKRIEKEKLTITTRHRVLATILQRASAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKHVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDTAKRYRVDTEKLQKAVAKEFATRRDKKTVKPKARKTA
Ga0210384_1034666233300021432SoilKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSAPAQELLAKQVSTYDEAELCKLVVEISLLDSAYQRSTASRDDILIDAAKRYRVDTAKLQRAVAKESAAKRDQKAIKQKVRKTAD
Ga0210391_1035761713300021433SoilRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVETKKDSASAQELLAKQVGKYEEADLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRDKKTKATAKPKGRKTAA
Ga0210390_1149279413300021474SoilDLLAVAHYLICHLSYSQVPALAKRHKVEAKKDSASAQELLSKQVGAYDESELSKLLLEISLLDSAYQRSTQSRDDVLMDAAKRYRVDSERLHKTVAKELATKREKKTNKPKTRKTPA
Ga0210402_1078040013300021478SoilKEKLAITTRHRVLATILQRVSAPLRKADLLTVAEYLIGHLSYSQVPALAKRHKVETKRDSASAQELLAKQVSKYDEAELCKLFLEISLLDSAYQRSTSSRDDVLIDAAKRYRVDTEKLQKAVAEELAAKREKKTKTGAKPKNRRTA
Ga0210410_1011189813300021479SoilTRHRVLATILQRVSAPLKKADLLTVSDYLIGHLSYSQVPTLAKRHKVEAKKDSASAQELLAKQVSKFDESELCKLLLEISLLDSAYQRPTASRDDVLMDAAKRYRVDTEKLQKDVAKEFAAKRDKKTIKPKGRKAAA
Ga0212123_1016626213300022557Iron-Sulfur Acid SpringMCPRLPPSVTMASVILQIIAQYLVAHLSYNQVPALARRHKVEVKKDSDSAHELLAKQVGTYDESELCKLLLEVALLDSAYQRSTANGDDVLMSAAKRYRVDAHKLQKAVAGEIAAKLAKTGKNKSTVRSKGEA
Ga0212123_1080339313300022557Iron-Sulfur Acid SpringPLKKADMQVIAQYLVAHLSYNQVPALAKRHRVEVKNDSDSAQELLAKQVATYDEAELCKLLLEITLLDSAYQRSTANGDDVLMSAAKRYRVDADKLQKAVAEEFAAKHVNSGKDKAKLRSETVA
Ga0242665_1030788913300022724SoilADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSTYDEAELCKLVLEVSLLDSAYQRSAASRDDVLMDAAKRYRVDTEKLQTAVAKEFAAKRDKKAIKPKARKTAD
Ga0242654_1007077213300022726SoilTILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEVKKDSASAQELLAKQVSRYDDSELCKLLLEISLLDSAYQRSTSSRDNVLMDAAKRYRVDAEKLQKAVAKDFAAKRDKKTIKPKVRKSAA
Ga0224561_102574213300023030SoilASAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSVSAQELLAKQVGAYDESKLCKLLLEISLLDSAYQRSTASRNDVLMDAAKRYRVDTEKLEKAVAVEIAAKRENKSKAKTKANNRNTTT
Ga0207416_113815423300025134Iron-Sulfur Acid SpringMASVILQIIAQYLVAHLSYNQVPALARRHKVEVKKDSDSAHELLAKQVGTYDESELCKLLLEVALLDSAYQRSTANGDDVLMSAAKRYRVDAHKLQKAVAGEIAAKLAKTGKNKSTVRSKGEA
Ga0209648_1045256613300026551Grasslands SoilQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKAEAKKDSASAQELLAKQVGKYEEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKELAAKRDKKTVKPKVRRSAA
Ga0209648_1076094713300026551Grasslands SoilLQVIAQYSVAHLSYNQVPALAKRHKVEVKKNSDSAQDLLVKQVSACDESELCKLLLEISLLDSAYQRSAANGDDVLMSAAKRYRVDPEKLQKAVAGELAAKLAKEGGRAKRVK
Ga0208324_114899713300027604Peatlands SoilAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEVKKDSASAQELLDKQVGTYDEAELCKLLLEISLLDSAYQRSTSSGDDILMDAAKRYRVDAEKLQKAVSVELAAKRGNKTKTTAKPQDRKTAA
Ga0209736_120475213300027660Forest SoilRTSAGPTVEAFFQLTNDVSKVRDCALATILQRVSAPLKKADLLAVAYYLIGHLSYSQVPALAKRHKVEAKKDSASAQEHLAKQVGTYDEAELSKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAKDFAAKRDKKTVKPKVRRSAA
Ga0208565_101907713300027662Peatlands SoilTILLRVSAPLKKADLLAVAHYLIAHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTSSRDDVLMDASKRYRVDAEKLQKTVAAELAAKRDKKTNAKAKPKSRKAAA
Ga0208565_108602223300027662Peatlands SoilDLQAVAQYLVAHLSYNQVPALAKRRKVEVKKDSDSAQELLAKQVGTYDESELCKLLLEISLLDSAYQRASANGDDALMNAAKRYRIDAEKLQKAVAGEIAAKLAKTGGSAERVK
Ga0209009_108838323300027667Forest SoilKEKLAITTRHRVLAAILQRVSAPLKKADLLTVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQDLLDKQVSTYDEAEVCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDADKLQEAVAKEFAVKRGKKTIKPKTRKTAA
Ga0209038_1004240023300027737Bog Forest SoilLPKSSRFEVLPEVHTILQRVSAPLKKADLLAVTHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGSYDEPELCKLLLEISLLDSAYQRSTPSRDDVLMDAAKRYRVDTEKLQKVVAKEFAAKRDKKTIKPKARKTAA
Ga0209655_1011283813300027767Bog Forest SoilLPKSSRFEVLPEVHTILQRVSAPLKKADLLAVTHYLIGHLSYSQVPALAKRHKVEAKKDSASAQGLLAKQVSKYDESELCKLLLEISLLDSAYQRSTPSRDDVLMDAAKRYRVDTEKLQKVVAKEFAAKRDKKTIKPKARKTAA
Ga0209139_1002386933300027795Bog Forest SoilMILQRVSAPLKKADLLVSHYLIGHLSYSQVPALAKRHKIEAKKDSPSAQELLAKQVGRYDESELCKLLLEISLLDSAYQRSTANRGDDLLLDVAKRYRVDTEKLQTAVAKDFAAKRDKKARVKPKPRTKTAA
Ga0209580_1060479223300027842Surface SoilEKLAITTRHRVLAAILQRVSAPLKKADLLTVSDYLIGHLSYSLVPTLAKRHKVEAKKDSASAQELLAKQVSKFDESELCKLLLEISLLDSAYQRSTSSRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTVKPKDRKTAA
Ga0209517_1036037613300027854Peatlands SoilRHRVLATILQRVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKESASAQELLAKKVSTYDEAELCKLLLEISLLDSAYQRSTTSRNDVLMDAAKRYRLDTEKLQKAVAKEFAAKRDKKTIKPKARKTAA
Ga0209166_1060880713300027857Surface SoilHYLISRLSYNQIPAVTKRHKVEVKKDSDSGQELLAKQVGNYDESDLCRVLLEISLLDSAYRRTATDGEDTLLGVAKRYRVDVEKLQKAVAVEFAAKRDKKKAKPKAETAV
Ga0209611_1044068113300027860Host-AssociatedMMLKKAPVSSTKRVSAPLKKADLMTVAHYLIDRLSHNQVPALAKRHKVEVKKDSESAQDSLVKQVSTYDESELCKLLLEISLLDSAYHRTTTTRDDVLMDTAKRYRVDTEKLQKAVADEIAAKRDKTTKAKTKPKNRKPAA
Ga0209167_10000556113300027867Surface SoilMGGAYGSAPLKKADLLAVAHYLIGHLSYSQVPTLAKRHRVEAKKDSASAQERLAKQVGTYDDAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKVQKAVAEELATKRDRKAKAKPKPNGRKTAA
Ga0209167_1054658613300027867Surface SoilEKLAITTRHRVLATILQRVSAPLKKADLLTVADYLIGHLSYSQVPALAKRHKVEAKKDSATAHELLAKQVSKYDESELCKLLLEISLLDSAYQRSTSSHDDVLMDAAKSYRVDIEKLQKAVAVELSAKRDKKTKAKAKPKGQKTAE
Ga0209380_1039170113300027889SoilQRVSAPLKKTDLLAVAQYLIGHLSYSQVPALAKRHKVEAKKESASAQELLAKQVGTYDEAELCKLLLEISLLDSAYHRSTASRDDVLMDAAKRYRVDSEKLQKAVAGELAAKRTKKTDNGKARRT
Ga0209698_1005309433300027911WatershedsMRTFLAVAHYLIGHLSYSQLPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVVMDAAKRYRVDTEKLQKAVAEELAAKREKETKAGARRKNRKT
Ga0209168_1008374323300027986Surface SoilLAVGHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSTASRDDVLMDTAKRYRVDTEKLQKAVTEELAAKRDKKTKSKPRARSKTAG
Ga0137415_1039684713300028536Vadose Zone SoilQLIAQYLVEHLSYNQVPALAKRHKVEVKKDSSSAHELLVKQVGTYDEADLCKLLLEVSLLDSAYQRSTANGDDVLMSAAKRYRVDAEKLQKAVAQEFVAKLAKTGKGKTAVRSREVA
Ga0302152_1012885413300028572BogLAITTRHRVLATILHRVSAPLKKADLLAVAHYLIGHLSYSQVPNLAKRHKVEVKGDSASAQELLVKQVAAFDESELSKLLLEISLLDSAYQRSTTSRDDVLTDAAKRYRVDIEKLHKAVAKEFATKQDKKTIKPKTPKTAT
Ga0302233_1014523513300028746PalsaAVAHYLIGHLSYSQVPALAKRHKVETKKDSASAQEVLAKQVGKYEEAELCKLLLEISLLDSAYQRSTGSREDVLMDAAKRYRVDGAKLHKAVAEELAAKREKTTKSKTDTRSKATL
Ga0302219_1022562423300028747PalsaKKADLLAVAHYLIGHLSYSQVPALAKRHKVETKKDSASAQEVLAKQVGKYEEAELCKLLLEISLLDSAYQRSTGSREDVLMDAAKRYRVDGAKLHKAVAEELAAKREKTTKSKTDTRSKATL
Ga0302202_1036598413300028762BogHRILATILQRVSAPLKKADLLAVGHYLIGHLSYSQVPTLAKRHKVEARKDSASVQELLTKQVDTYDESELCKLVLEISLLDSAYQRSTASRDDVLTDTAKRYRVDAERLQKAVAKELAAKRDKRTVKARPRKTVA
Ga0302232_1004938743300028789PalsaMILQRVSAPLRKADLLAIANYLIDHLSYSQVPALAKRHKVEPKKDSASAQEPLAEQVATYDEADLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAAAEGLATKRAKKTKVKARTKGRKSAE
Ga0302227_1034185013300028795PalsaVSAPLKKADLLAVAHYLIGHLSYSQVPTLAKRHKVEAKKDSASAQELLAKQVGAYDESELCKLLLEISLLDSAYQRSTASSNDVLMDAAKRYRVDAEKLQKAVAVEIAATRNKKTKVKTKLEGRTTAA
Ga0265338_1110190313300028800RhizosphereVSAPLKKADLLAVAHYLIGHLPYSQVPALAKRHKLEAKKDSVSAQELLAKQVGSYDEAELCKLLLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDAEKLQKAVAEELTAKREKKTKAGANPKSRKTA
Ga0302226_1038096423300028801PalsaTRHRVLATILQRVSAPLKKADLLAVAHYLIVHLSYSQIPALAKRHKVKAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSSSRDDVLMDAAKRYRVDAEKLQKAVAKEVAAKRDNKTKTNANPKKRETAA
Ga0302221_1019059153300028806PalsaMAAHYLIGHLSYSQVPALAKRHKVEANKDSVSGQDVLVKQVGTYDEAGLCKLLLEISLLDSAYQRSTVGRDDVLMDAAKRYRVDTEELQKAVAKEFATKRDKKTVKYKPRKTAE
Ga0302154_1035064613300028882BogLQRVSAPLKKADLLAVGHYLIGHLSYSQVPTLAKRHKVEARKDSASVQELLTKQVDTYDESELCKLVLEISLLDSAYQRSTASRDDVLTDTAKRYRVDAERLQKAVAKELAAKRDKRTVKARPRKTVA
Ga0308309_1028973923300028906SoilMANLSFSMLLATILQRVSAPLKKADLLTVANYFIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSPTSRDDVLIGAAKRYRVDNDKIQKAVATAFVAKHGKKSKAKPRGPRRTAV
Ga0308309_1137045313300028906SoilLTVGHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVSTYDEAELCKLLLEISLLDSAYQRSTTSRDDALMDAAKRYRVDTEKLQKAVAKEFATKRDKKTLKAKPRKTTS
Ga0311327_1010522613300029883BogLAVGHYLIGHLSYSQVPTLAKRHKVEARKDSASVQELLTKQVYTYDESELCKLVLEISLLDSAYQRSTASRDDVLTDTAKRYRVDAERLQKAVAKELAAKRDKRTVKARPRKTVA
Ga0311329_1079092713300029907BogLLAVGHYLIGHLSYSQVPNLAKRHKVDVKKDSASAQELMVKQVATFDESELSKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDADKLQKAVAREFVVKRDRKTKVTPKPRNKMAG
Ga0311361_1101137613300029911BogIEKEKLVITTRHRVLATILQRVSAPLKKADLLAVGHYLIGHLSYSQVPNLAKRHKVDVKKDSASAQELMVKQVATFDESELSKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDADKLQKAVAREFVVKRDRKTKVTPKPRNKMAG
Ga0311359_1073870513300029914BogAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTHDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAEELAAKRDKKIKATAKAKGRKTAA
Ga0311359_1087974713300029914BogQRVSTPLKKADLLAIAHYLVGHLSYSQVPALAKRHKVEAKKDSATAQELLIKQVSKYDESELCKLLLEISLLDSAYQRSTASRDDVLIDAAKRYRVDTEKVQKAVAKEFAAKRDRKTLKAKTPKTAA
Ga0311328_1107379913300029939BogLTVAHYLIGHLSYNQVPALAKRHKVEAKKDSASAQELLAKQLRTYDEAELCKLLLEISLLDSAYQRSSAGRDDVLMDAAKRFRVDTERLQSVVAEEFTKKREKKVKIKPESQNKPAR
Ga0311340_1057621113300029943PalsaEERKRIEKEKLAITTRHRVLATILQRVSAPLKKADLQAVAHYLIGHLSYSQVPALAKRRKVEAKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSAVSRDDVLMNAAKRYRVDTEKLQKAVVAELAAKRDKRTKTK
Ga0311340_1100729513300029943PalsaTILQRVSAPLKKADLLEVAHYLIGHLSYSQVPTLAKRHKVEAKKDSPSAQELLAKQIIGYDESELSKLLLEISLLDSAYRRSFISGCDVLMEASKRYRVDTDKIQKAVLKEFGSKRNKKTIKPKAGKTAA
Ga0311371_1105549213300029951PalsaLKKADLLAVAHYLIGHLSCGQVPALAKRHKVEAKKDFSSAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSTASRDDVLIDAAKRYRVDTEKLQKAVGKEFAVKRDQKALK
Ga0311343_1055468213300029953BogAAILQRVSAPLKKADLLAVAHYLICHLSYSQVPALAKRHKLEAKKDSASAQELLAKQVSTYGESDLCKLLLEISLLDSAYQRSTASRDDVLIDAAKRYRVDTEKVQKAVAKEFAAKRDRKTLKAKTPKTAA
Ga0311343_1129291213300029953BogAVAHYLIGHLSYSQVPALAKRHKIGAKRDSTSAQELLAKQVGRYDESELCKLLLEMSLLDSAYQRSATRRDDILMDTAKRYRVDAEKLQKAVAEELAAKRHKKTKVRAKPKDGKTAA
Ga0311331_1124019223300029954BogRILATILQRIAAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQVLLAKQAGSCDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTERLQKAVAKEFIAKRDKKTLKAKPRKTAA
Ga0302150_1034584513300029956BogVSAPLKKADLLTVAHYLIGHLSYSQVPVLAKRHRVEARKDSASPQDLLGKQVGKYEEAELCKLVLEISLLDSAYQRSATSRDDVLMDAAKRYRVDTDRLQKAVAQGLTAKRDKKTKATPKPKGQKTTA
Ga0302277_133346513300029982BogTILQRVSGPLKKVDLHVVAEYLVAHLSYSQVPALAKRHKVEVTKDSDSAQELLLKQVGTYEEPELCKLLLEIALLDSAYHRSTANGDDVLMSAAKRYRVDAEKLQKAVSEELSAKLAKKGKAKAKVQDSK
Ga0311339_1005496423300029999PalsaLLAVAHYLIGHLSYSQVPALAKRHKVEAKTNSTSAPELLAKQVGTYDESELCKLLLEISLLDSAYQRSTTSRDDVLLNTAKRYRVDAEKVQKAVGKEFAAKRDKKTIKPKTPKTAA
Ga0311339_1020818023300029999PalsaLATILQRVSAPLKKADLLAVAQYLIGHLSYSQVPALAKRHKIETKNDSAAAQELLAKQVSKYDDAELCKLLLEISLLDSAYQRSAASRDDVLMDAAKRYRVDAEKLQKALAKEFAAKRDKKTLKAKARKTAA
Ga0311339_1169985023300029999PalsaGHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAGGFASKRDKQIKEKRKVRKAKAV
Ga0311339_1189935713300029999PalsaILATILQRVSAPLKKADLLAVSEYLIGHLSYSQVPALAKRHKVETKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRPGKSDDFLTNAAKRYRVDVEKLQKAVTAEFAAKRERSKATAKGKAVA
Ga0311338_1196486313300030007PalsaVLATILQRVSAPLKKADLLTVADYLIGHLSYSQVPTLAKRQKVEAKKDSASAQELLAKKVSKYDDAELCKLLLEISLLDSAYQRSTTSRDDVLMDAAKRYRVDTEKLQKAVAKEFAAKRDKKTIKPKDRKGAA
Ga0311344_1114325013300030020BogRVSAPLKKADLLTVAHYLIGHLSYNQVPALAKRHKVEAKKDSASAQELLAKQLRTYDEAELCKLLLEISLLDSAYQRSSAGRDDVLMDAAKRFRVDTERLQSVVAEEFTKKREKKVKIKPESQNKPAR
Ga0302300_113310213300030042PalsaDLLAVAHYLIVHLSYSQIPALAKRHKVKAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSSSRDDVLMDAAKRYRVDAEKLQKAVAKEVAAKRDNKTKTNANPKKRETAA
Ga0302306_1028944413300030043PalsaPLKKADLLAVAHYLIGHLSYSQVPTLAKRHKVEAKKDSASAQELLAKQVGAYDESELCKLLLEISLLDSAYQRSTASSNDVLMDAAKRYRVDAEKLQKAVAVEIAATRNKKTKVKTKLEGRTTAA
Ga0311372_1061626223300030520PalsaEKLAITTRHRVLATILQRVSAPLKKADLLAVAHYLIVHLSYSQIPALAKRHKVKAKKDSASAQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSSSRDDVLMDAAKRYRVDAEKLQKAVAKEVAAKRDNKTKTNANPKKRETAA
Ga0311372_1304969413300030520PalsaQRISAPLKKADLLTVAEYLIGHLSYSQVPALAKRHKVEAKKDSATAHELLAKQVSKYDESELCKLLLEISLLDSAYQRSSASRNDVLMEAAKRYRVDAEKLQIAVAKEFAVKRDKKTIKPKGRKAAG
Ga0311345_1020266513300030688BogRVSAPLKKADLLAVGHYLIGHLSYSQVPNLAKRHKVDVKKDSASAQELMVKQVATFDESELSKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDADKLQKAVAREFVVKRDRKTKVTPKPRNKMAG
Ga0311345_1051422923300030688BogPLKKADLLAVAHYLIGHLSYSQVPALAKRHKIGAKRDSTSAQELLAKQVGRYDESELCKLLLEMSLLDSAYQRSATRRDDILMDTAKRYRVDAEKLQKAVAEELAAKRHKKTKVRAKPKDGKTAA
Ga0310038_1020187323300030707Peatlands SoilEKEKLAITTRHRVLATILQRASAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVCTYDEAELCKLLLEISLLDSAYQRSTTSREDVLMDAAKRYRVDAEKLQKTVAKEFAAKRDKKSLKAKGRKTAA
Ga0302180_1013439023300031028PalsaLATILQRVSAPLKKTDLLAVAHYLIGHLSYSQVPALAKRHKVEAKTNSTSAPELLAKQVGTYDESELCKLLLEISLLDSAYQRSTTSRDDVLLNTAKRYRVDAEKVQKAVGKEFAAKRDKKTIKPKTPKTAA
Ga0265760_1003886713300031090SoilRILATILQRVSAPLKKADLLAVAHYLLGHLSYSQVPTLAKRHKVEAKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSAASRDDVLMDTAKRYRVDTEKLQKAVTAEFVGKRMKKPKAKPHAVRKTAV
Ga0302325_1025386633300031234PalsaAPLKKADLLEVAHYLIGHLSYSQVPTLAKRHKVEAKKDSASAQELLVKQVGTYDESELCKLLLEISLLDSAYQRSTASRGDVLMDAAKRYRVDTGKLQKVVVEELAAKRDKKTKAKAKPKSCKTAA
Ga0302325_1184521313300031234PalsaLLAAITTRHRVLATILQRVSAPLKKADLAAVAHYLIGHLSYSQVPALAKRHKVEAKKDSASAQEVLAKQVSKYDESELCKMLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAGELAAKRDKETKGGAKPKNRKTA
Ga0302324_10030476033300031236PalsaKLAITTRHRVLATILQRVSAPLKKADLLEVAHYLIGHLSYSQVPTLAKRHKVEAKKDSASAQELLVKQVGTYDESELCKLLLEISLLDSAYQRSTASRGDVLMDAAKRYRVDTGKLQKVVVEELAAKRDKKTKAKAKPKSCKTAA
Ga0302324_10262697623300031236PalsaLATILQRVSAPLKKADLLAVGHYLIGHLSYSQVPNLAKRHKVEVKGDSASAQELLVKQVAAFDESELSKLLLEISLLDSAYQRSTTSRDDVLTDAAKRYRVDIEKLHKAVAKEFATKQDKKTIKPKTPKTAT
Ga0302140_1047343113300031261BogAHYLIGHLSYSQVPALAKRHKVEAKKDSGSAQEPLAKQVGTYDEPELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVTAEIVAKREKRPKVKPERARKPTA
Ga0302140_1111168113300031261BogVSAPLKKADLLTVGHYLIGHLSYSQVPALAKRHKVEAKKDSASVQELLAEQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLADAAKRYRVDAEKLQKAVAEDLAVKREKATKAKPKAPRKTGLAS
Ga0302326_1221415313300031525PalsaAPLKKADLLAVSEYLIGHLSYSQVPALAKRHKVETKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRPGKSDDFLTNAAKRYRVDVEKLQKAVTAEFAAKRERSKATAKGKAV
Ga0310686_10285756913300031708SoilMIRVKKADLLAVAHYLIGHLSYSQVPALAKGHKVEAKKDSASAQELLVKKVGACDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAVAEELAAKRDKKTKAGAKPKNRQTA
Ga0310686_10735393533300031708SoilLVAHLSYNQVPDLAKRHKVEVKKDSDSAQQLLAEQVGTYDEAQLCKLLLEISYQRSTANGDDVLTSAAKRYRVDAENLQKVVAEELAAKLAKTGKAKSPVRSKDAA
Ga0310686_10886526413300031708SoilILQRVSAPLKKADLLAVAHYLIGHLSYSQVPAVAKRHKVEAKKDSASAQELLAKQVGTYDESELCKLLLEITLLDSAYLRSTASHDNVLTDAAKRYRVDTDKIQKAVAAEFVAKHLKTTKAKPGGVRKAV
Ga0310686_11713873913300031708SoilRIEKEKLAITTRHRVLATILQRASAPLKKADLLAVAHYLIGHLSYSQVPALSKRHKVEAKKDSASAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSGSSRDDVLMDAAKRYRVDSEKLQKAVAGELAAKRTKKTNNGKARRTPA
Ga0310686_11785485513300031708SoilRVSAPLKKADLLAVAHYLIGHLSYSQVPTLAKRHKVEAKKDSASAQELLAKQVSKYDDAELCKLLLEISLLDSAYQRSAASRDDVLMDTAKRYRVDTEKLQKAVTAEFVAKGMKKRKAQPHGVRKTAV
Ga0307476_1139971113300031715Hardwood Forest SoilPLKKADLLTVADYLIGHLSYSQVPALAKRHKVEAKDSASAQGLLAKQVGTYDESDLCKLLLEISLLDSAYQRSTASRDDILIDAAKRYRVDAEKLQKAVAKEFAAKRDQKALKQKVRKTA
Ga0311301_1170300213300032160Peatlands SoilSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKVEAKKDSSSAQELLAKQVGTYDESELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKLQKAAAKEFAAKRDKKTIKPKTPKTVA
Ga0311301_1192143613300032160Peatlands SoilLALAHYLIGHLSYRQVPALAKRHKVEAQKDSTSAQELLAKQVSTYDESELCKLLLEISLLDSAYQRSTASRDDALMEAAKRYRVDTEKVQKAVAKEFAAKRDKKTVKAKAHKTAA
Ga0311301_1205004913300032160Peatlands SoilKKTDLQLVAQYLVTHHLVTHLSNNQVPALARRHKVEVKKDSDSAQELLANQVSTYDEAALCKLVLEICLLDSAYQRSTASRDDGLMEAAKCYRVDTEKLQKAVAKELATKLAKKEKGSVKGMK
Ga0335085_1184965913300032770SoilAPLKKADLLAVAHYLIGHLSYSQVPALAKRHTVEAKKDSASAQELLAKKVGTYDDAQLCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKIQKAVAEDLAAKREKRTKGKKPRSRKTAA
Ga0335082_1052380723300032782SoilVLVTILQRVSAPLKKADLLTVAHYLISRLSYNQIPAVAKRHKIEVKKDSDSGQELLAKQVGNYDETELCRVLLEISLLDSAYRRSATDGEDTLLGVAKRYRVDVEKLQKAVAAEFAAKRDKKKVKPKAEAVA
Ga0335082_1162752713300032782SoilHYLISRLSYNQIPAVAKRHKVEVKKDSDSGQELLAKQVGNYDESDLCRVLLEISLLDSAYRRSATDGEDTLLSVGKRYRVDVEKLQKAVAVEFAAKRDKKKAKPKAETAA
Ga0335079_1197329913300032783SoilSAPLKKADLLTVAHYLISRLSYNQIPAVAKRHKVESKKDAASAQELLAKQIGGYDEAELCKLLLEISLLDSAYHRSATSRDDILIDAAKRYRVDTEKLQKAVAKEFAAKRDKKTRVNPKTRDKTAA
Ga0335078_1025248023300032805SoilLQRVSAPLKKADLLTVAHYLISRLSYNQIPAVAKRHKIELKKDSDSGQELLAKQVGNYDETELCRVLLEISLLDSAYRRSATDGEDTLLGVAKRYRLDVEKQQKVVAAEFAAKRDKKKVKPKAETAA
Ga0335078_1029695913300032805SoilVSAPLKKADLLAIAHYLIGHLSYSQVPALAKRHKVEATKDSASAQELLAKQMGTYDEAELCRALLEISLLDSAYQRSTTRRDDVLMEAAKRYRVDAEKLQRAVAEELAAKREKKTKTPAKPRNSKTA
Ga0335078_1049069113300032805SoilLQRVSAPLKKADLLTIAHHLISRLSYNQIPALAKRHKVEAKKDSTSSQELLAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRGDVLMDAAKRYRVDAEKLQKAVAKDFAAKRDKKTMKPKVRTVAS
Ga0335078_1055067713300032805SoilRVSAPLKKADLLTVAHYLISRLSYNQIPAVAKRHKVEVKKDSDSGQELLAKQVGNYDEAELCRVLLEISLLDSAYRRSAPDGEDILLTVAKRYRVDVEKVQKAVAAEFATKRDKKKAKPKTDAVA
Ga0335080_1000306923300032828SoilMIRCHRVLVTILQRVSAPLKKADLLTVAHYLISRLSYNQIPAVAKRHKIEVKKDSDSGQELLAKQVGNYDETELCRVLLEISLLDSAYRRSATDGEDTLLGVAKRYRVDVEKLQKAVAAEFAAKRDKKKVKPKAEAVA
Ga0335071_1095700323300032897SoilSAPLKKADLLTVAHYLISRLSYNQIPAVAKRHKVEVKKDSDSGQELLAKQAGNYDESDLCRVLLEISLLDSAYRRSATDGEDTLLSVAKRYRVDVEKLQKTVAAEFAAKRDKKKAKPKAETAV
Ga0335072_1115789423300032898SoilTTRHRVLATILQRVSAPLKKADLLAIAYYLIGHLSYSQVPALAKRHKVEAKKDSASAQELLAKQVGAYDEPELCKLLLEISLLDSAYQRSAASRDDVLMDAAKRYRVDTEKLQKAVAKEIAAKRDKKTIKPKGRKAAA
Ga0335076_1122416513300032955SoilKEKLAITTRHRVLATILQRVSAPLKKADLLTIAHYLIGHLSYSQVPALAKRHKVEATKDSASAQELLAKQMGTYDEAELCRALLEISLLDSAYQRSTTRRDDVLMEAAKRYRVDAEKLQRAVAEELAAKREKKTKTPAKPRNSKTA
Ga0335076_1125550213300032955SoilKLAITLRHRVLATILQRVSAPLKKSDLLTVAHYLISRLSYNQIPAVAKRHKVEVKKDSDSGQELLAKHVGDYDETELCRVLLEVSLLDSAYRRTATDGEDTLLGVAKRYRVDVEKLQKAVAVEFAAKREKKKAKPKAETAV
Ga0335073_1154841623300033134SoilTVLQQVSAPLKKADLLAVAHYLIGHLSYSQVPALAKRHKIETKKDSASAHELLAKQVGTYDEAELCKLLLEISLLDSAYQRSATSRDDVLMDAAKRYRVDAEKLQKVVAKEFAAKRDKKTVKPKTRTTAVRA
Ga0326728_1094686323300033402Peat SoilDLLTVATYLIGHLSYSQVPALAKRHKVEAKKDSPSAQELLAKQASTYDEAELCKLALEISLLDSAYQRSTASRDDVLMDAAKRYRVDTEKVQKAVAKEFASKRDKKTVKPKARKTAA
Ga0314862_0068722_374_7723300033803PeatlandVLATILQRVSAPLKKADLLTVAHYLISRLSYNQIPAVAKRHKVEVKKDSDSGQELLAKQAGNYDEAELCRVLLEISLLDSAYRRSATDGEDTLLSVAKRYRVDVEKLQKAVAAEFATKRDKKKAKPKAETAA
Ga0314866_053900_4_4023300033807PeatlandVLATILQRVSAPLKKADLLSVAHYLISRLSYNQIPAVAKRHKVEVKKDSDSGQELLAKQVGNYDESDLCRVLLEISLLDSAYRRSATDDEDTLLSVAKRYRVDVEKLQKAVATELAAKRDRKKAKPKAETAA
Ga0334792_168903_170_5353300033888SoilLKKPDLLAVAHYLIGHLSYSQVPALAKRHKVETKKDSSSAQEILAKQVGTYDEAELCKLLLEISLLDSAYQRSTASRDDVLMDAAKRYRVDAEKLQKAVAKEFAAKRDKKTLKAKARKTA
Ga0314861_0026832_823_11883300033977PeatlandLKKADLQVIAQYVVEHLPHNEVPALAKRHKVEVKKGSASSVHQLLLKQVGTYDDSEICKLLLEVALLDSAYQRSTRGDDVLMGAAKRYRVDTEKLQKAVADEFAAKLNKRQQQPDVKKTA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.