Metagenome / Metatranscriptome Family F016152

Overview

Basic Information

• Family ID: F016152
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 249
• Average Sequence Length: 37 residues
• Representative Sequence: MISVETGLSPVDLLDAPDGVLEAIVIYLKEKNKDASR
• Number of Associated Samples: 143
• Number of Associated Scaffolds: 249

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Viruses
• % of genes with valid RBS motifs: 14.52 %
• % of genes near scaffold ends (potentially truncated): 13.25 %
• % of genes from short scaffolds (< 2000 bps): 55.82 %
• Associated GOLD sequencing projects: 131
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Duplodnaviria (67.871 % of family members)
• NCBI Taxonomy ID: 2731341
• Taxonomy: All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.671 % of family members)
• Environment Ontology (ENVO): Unclassified (62.651 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (62.651 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 33.85%
  β-sheet: 0.00%
  Coil/Unstructured: 66.15%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 249 Family Scaffolds
PF05065	Phage_capsid	4.02
PF05135	Phage_connect_1	3.21
PF05257	CHAP	2.01
PF04586	Peptidase_S78	1.20
PF06199	Phage_tail_2	0.80
PF03354	TerL_ATPase	0.40
PF01555	N6_N4_Mtase	0.40
PF09250	Prim-Pol	0.40
PF00575	S1	0.40
PF16861	Carbam_trans_C	0.40
PF00534	Glycos_transf_1	0.40
PF13640	2OG-FeII_Oxy_3	0.40
PF14279	HNH_5	0.40
PF11160	Hva1_TUDOR	0.40
PF11397	GlcNAc	0.40
PF04860	Phage_portal	0.40

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 249 Family Scaffolds
COG4653	Predicted phage phi-C31 gp36 major capsid-like protein	Mobilome: prophages, transposons [X]	4.02
COG3740	Phage head maturation protease	Mobilome: prophages, transposons [X]	1.20
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.40
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.40
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.40
COG4626	Phage terminase-like protein, large subunit, contains N-terminal HTH domain	Mobilome: prophages, transposons [X]	0.40

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.72 %
Unclassified	root	N/A	19.28 %

Level 2

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	70.68 %
Unclassified	root	N/A	19.28 %
cellular organisms	root	All Organisms → cellular organisms	10.04 %

Level 3

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	67.87 %
Unclassified	root	N/A	19.28 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	10.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.81 %

Level 4

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	67.87 %
Unclassified	root	N/A	19.28 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	7.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.81 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.40 %

Level 5

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	67.87 %
Unclassified	root	N/A	19.28 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	7.23 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.81 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.40 %

Level 6

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	67.87 %
Unclassified	root	N/A	19.28 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4.42 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.81 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.40 %

Level 7

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	67.87 %
Unclassified	root	N/A	19.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.81 %
Gammaproteobacteria bacterium LSUCC0112	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium LSUCC0112	0.40 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.40 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.80 %

Level 8

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	67.87 %
Unclassified	root	N/A	19.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.81 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.40 %
Gammaproteobacteria bacterium LSUCC0112	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium LSUCC0112	0.40 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.80 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000756|JGI12421J11937_10171246	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	523
3300001282|B570J14230_10103217	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	856
3300002199|metazooDRAFT_1252801	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	769
3300004836|Ga0007759_10071466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	601
3300005517|Ga0070374_10199198	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1031
3300005517|Ga0070374_10263087	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	880
3300005581|Ga0049081_10015896	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2843
3300005581|Ga0049081_10024128	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2309
3300005581|Ga0049081_10068605	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1333
3300005581|Ga0049081_10281287	Not Available	577
3300005581|Ga0049081_10322120	Not Available	529
3300005582|Ga0049080_10224585	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	617
3300005583|Ga0049085_10021462	All Organisms → Viruses → Predicted Viral	2444
3300005662|Ga0078894_10022640	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5103
3300005662|Ga0078894_10144797	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2130
3300005662|Ga0078894_10158014	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2040
3300005662|Ga0078894_10389169	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1260
3300005662|Ga0078894_10542650	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1041
3300005662|Ga0078894_10549106	Not Available	1033
3300005758|Ga0078117_1008576	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7779
3300005758|Ga0078117_1103330	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5137
3300005805|Ga0079957_1001874	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	18968
3300005805|Ga0079957_1002100	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17715
3300005805|Ga0079957_1005398	All Organisms → cellular organisms → Bacteria	10409
3300005805|Ga0079957_1010203	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7112
3300005805|Ga0079957_1010784	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6882
3300005805|Ga0079957_1033252	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	3383
3300005805|Ga0079957_1033264	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3382
3300005805|Ga0079957_1053340	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2458
3300005805|Ga0079957_1098079	Not Available	1605
3300005805|Ga0079957_1114722	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1437
3300005805|Ga0079957_1271107	Not Available	777
3300006484|Ga0070744_10009092	All Organisms → Viruses → Predicted Viral	2954
3300006484|Ga0070744_10085746	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	913
3300006641|Ga0075471_10332309	Not Available	769
3300006805|Ga0075464_10167441	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1296
3300006805|Ga0075464_10486083	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	755
3300006920|Ga0070748_1277140	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	599
3300007165|Ga0079302_1002506	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5088
3300007169|Ga0102976_1058691	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1432
3300007171|Ga0102977_1056162	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5374
3300007202|Ga0103274_1209795	All Organisms → Viruses → Predicted Viral	1336
3300007363|Ga0075458_10138379	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	754
3300007516|Ga0105050_10016730	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7042
3300007538|Ga0099851_1016960	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2957
3300007541|Ga0099848_1025683	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2482
3300007541|Ga0099848_1026778	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2425
3300007541|Ga0099848_1150774	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	861
3300007622|Ga0102863_1180436	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	621
3300007636|Ga0102856_1046760	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	680
3300007708|Ga0102859_1201627	Not Available	591
3300007708|Ga0102859_1277829	Not Available	505
3300007735|Ga0104988_10433	All Organisms → cellular organisms → Bacteria	15092
3300007735|Ga0104988_10666	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21564
3300008107|Ga0114340_1006381	All Organisms → cellular organisms → Bacteria	6172
3300008110|Ga0114343_1005736	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6547
3300008110|Ga0114343_1013611	All Organisms → Viruses → Predicted Viral	3827
3300008116|Ga0114350_1009547	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6165
3300008116|Ga0114350_1023578	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2523
3300008117|Ga0114351_1001923	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17876
3300008259|Ga0114841_1037614	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2440
3300008448|Ga0114876_1063907	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1597
3300008450|Ga0114880_1093924	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1173
3300009009|Ga0105105_10596352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	644
3300009068|Ga0114973_10000781	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	23888
3300009085|Ga0105103_10700726	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	582
3300009152|Ga0114980_10032205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3237
3300009152|Ga0114980_10149154	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1387
3300009152|Ga0114980_10552731	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	653
3300009155|Ga0114968_10002678	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13510
3300009155|Ga0114968_10089204	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1902
3300009155|Ga0114968_10118220	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1603
3300009155|Ga0114968_10315354	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	871
3300009158|Ga0114977_10152033	Not Available	1378
3300009158|Ga0114977_10724450	Not Available	528
3300009159|Ga0114978_10346054	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	900
3300009160|Ga0114981_10710125	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	531
3300009163|Ga0114970_10243198	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1043
3300009169|Ga0105097_10162731	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1227
3300009170|Ga0105096_10467230	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	654
3300009181|Ga0114969_10023468	All Organisms → cellular organisms → Bacteria	4322
3300009181|Ga0114969_10359561	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	843
3300009183|Ga0114974_10702412	Not Available	549
3300009469|Ga0127401_1152886	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	582
3300010157|Ga0114964_10072720	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1744
3300010354|Ga0129333_10002391	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17436
3300010354|Ga0129333_10007706	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10158
3300010354|Ga0129333_10013340	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7796
3300010354|Ga0129333_10033453	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4855
3300010354|Ga0129333_10038140	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4536
3300010354|Ga0129333_10041993	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4299
3300010354|Ga0129333_10106886	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2584
3300010354|Ga0129333_10227373	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1690
3300010354|Ga0129333_10240547	All Organisms → Viruses → Predicted Viral	1635
3300010354|Ga0129333_10337237	Not Available	1343
3300010354|Ga0129333_10462293	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1116
3300010354|Ga0129333_10858167	Not Available	770
3300010354|Ga0129333_11544594	Not Available	543
3300010370|Ga0129336_10735955	Not Available	521
3300010885|Ga0133913_10477929	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3286
3300010885|Ga0133913_11490636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1714
3300011009|Ga0129318_10022508	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1428
3300011010|Ga0139557_1050688	Not Available	706
3300012471|Ga0129334_1058044	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2255
3300012666|Ga0157498_1035893	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	763
3300012732|Ga0157549_1277754	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1065
3300012773|Ga0138290_1138264	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1019
3300012962|Ga0129335_1165858	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1517
3300012968|Ga0129337_1023951	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1198
3300012970|Ga0129338_1125291	Not Available	661
3300012970|Ga0129338_1220434	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	752
3300012970|Ga0129338_1374280	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	885
3300013004|Ga0164293_10039724	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3857
3300013004|Ga0164293_10380982	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	955
3300013004|Ga0164293_10516542	Not Available	786
3300013004|Ga0164293_10553514	Not Available	753
3300013005|Ga0164292_10126902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1891
3300013005|Ga0164292_10351302	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	995
3300013006|Ga0164294_10084150	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	2385
3300013087|Ga0163212_1225953	Not Available	583
(restricted) 3300013126|Ga0172367_10101952	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2018
(restricted) 3300013126|Ga0172367_10316601	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	914
(restricted) 3300013130|Ga0172363_10583105	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	709
(restricted) 3300013131|Ga0172373_10094603	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2285
(restricted) 3300013132|Ga0172372_10077438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2952
(restricted) 3300013132|Ga0172372_10916311	Not Available	535
3300013295|Ga0170791_10306057	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	910
3300013372|Ga0177922_10080850	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	721
3300013372|Ga0177922_11301476	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	725
3300017722|Ga0181347_1203700	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	519
3300017723|Ga0181362_1120399	Not Available	514
3300017754|Ga0181344_1105524	Not Available	817
3300017754|Ga0181344_1127044	Not Available	733
3300017774|Ga0181358_1264776	Not Available	535
3300017780|Ga0181346_1089666	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1203
3300017785|Ga0181355_1194922	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	799
3300017788|Ga0169931_10049102	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4576
3300017788|Ga0169931_10056984	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4123
3300017788|Ga0169931_10212506	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1631
3300017788|Ga0169931_10220797	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1586
3300019784|Ga0181359_1003318	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4907
3300019784|Ga0181359_1005897	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4043
3300019784|Ga0181359_1013126	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3011
3300019784|Ga0181359_1022699	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2386
3300019784|Ga0181359_1051104	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1594
3300019784|Ga0181359_1107209	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1017
3300019784|Ga0181359_1210961	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	618
3300019784|Ga0181359_1229019	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	579
3300020048|Ga0207193_1053720	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4168
3300020048|Ga0207193_1060937	All Organisms → Viruses → Predicted Viral	3803
3300020048|Ga0207193_1061001	Not Available	3800
3300020048|Ga0207193_1421862	Not Available	888
3300020141|Ga0211732_1425533	Not Available	537
3300020141|Ga0211732_1557734	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2576
3300020151|Ga0211736_10979672	Not Available	639
3300020159|Ga0211734_11243382	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2395
3300020172|Ga0211729_10229374	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6735
3300020172|Ga0211729_11106648	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1779
3300020183|Ga0194115_10004572	All Organisms → cellular organisms → Bacteria	14806
3300020183|Ga0194115_10006324	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12037
3300020220|Ga0194119_10360821	Not Available	953
3300020498|Ga0208050_1002437	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2497
3300020498|Ga0208050_1003498	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2008
3300020506|Ga0208091_1026059	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	666
3300020570|Ga0208465_1002866	Not Available	3117
3300020570|Ga0208465_1004836	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2162
3300020578|Ga0194129_10235742	Not Available	1080
3300021093|Ga0194123_10210652	Not Available	986
3300021962|Ga0222713_10002463	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19813
3300021962|Ga0222713_10086097	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2284
3300021962|Ga0222713_10199411	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1340
3300021963|Ga0222712_10023140	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5104
3300022190|Ga0181354_1018729	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2172
3300022190|Ga0181354_1050682	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1382
3300022198|Ga0196905_1010374	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3088
3300022198|Ga0196905_1048215	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1220
3300022407|Ga0181351_1146559	Not Available	854
3300022407|Ga0181351_1151225	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	834
3300022752|Ga0214917_10008278	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10252
3300023174|Ga0214921_10003328	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	24755
3300023174|Ga0214921_10003667	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	23315
3300024289|Ga0255147_1030687	Not Available	1091
3300024346|Ga0244775_10042939	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3973
3300024346|Ga0244775_10356722	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1206
3300024346|Ga0244775_10669489	Not Available	838
3300024481|Ga0256330_1126056	Not Available	540
3300024866|Ga0255272_1183364	Not Available	518
3300025896|Ga0208916_10024621	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	2394
3300027380|Ga0208432_1015865	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1370
3300027563|Ga0209552_1076729	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	917
3300027627|Ga0208942_1074123	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1004
3300027644|Ga0209356_1005034	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4897
3300027659|Ga0208975_1015731	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2537
3300027721|Ga0209492_1015310	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2600
3300027736|Ga0209190_1001065	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19457
3300027754|Ga0209596_1003810	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11697
3300027754|Ga0209596_1008765	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6939
3300027754|Ga0209596_1011857	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5678
3300027754|Ga0209596_1018215	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4300
3300027754|Ga0209596_1041578	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2481
3300027759|Ga0209296_1114902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1262
3300027759|Ga0209296_1118654	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1235
3300027764|Ga0209134_10157531	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	782
3300027769|Ga0209770_10000238	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32847
3300027805|Ga0209229_10163999	Not Available	999
3300027805|Ga0209229_10253503	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	782
3300027805|Ga0209229_10523382	Not Available	504
3300027808|Ga0209354_10216425	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	774
3300027892|Ga0209550_10443827	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	792
(restricted) 3300027970|Ga0247837_1056920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium LSUCC0112	2251
3300027971|Ga0209401_1000321	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32921
3300027974|Ga0209299_1354853	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	500
3300027976|Ga0209702_10013195	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8080
3300028394|Ga0304730_1269100	Not Available	604
(restricted) 3300029286|Ga0247841_10535821	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	738
3300029753|Ga0135224_1043082	Not Available	503
3300029930|Ga0119944_1000221	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10137
3300029930|Ga0119944_1041967	Not Available	564
3300031758|Ga0315907_10043584	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3977
3300031758|Ga0315907_10195312	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1698
3300031857|Ga0315909_10014006	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8317
3300031857|Ga0315909_10079318	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2902
3300031857|Ga0315909_10388699	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1004
3300031951|Ga0315904_10076231	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3611
3300031951|Ga0315904_10257969	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1665
3300032050|Ga0315906_10639619	Not Available	867
3300033981|Ga0334982_0007987	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6382
3300033981|Ga0334982_0043121	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2524
3300033981|Ga0334982_0052425	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2250
3300033996|Ga0334979_0018676	All Organisms → cellular organisms → Bacteria	4701
3300033996|Ga0334979_0051599	All Organisms → Viruses → Predicted Viral	2665
3300033996|Ga0334979_0105523	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1749
3300034012|Ga0334986_0027579	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3781
3300034061|Ga0334987_0089833	Not Available	2396
3300034066|Ga0335019_0149744	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1538
3300034073|Ga0310130_0252203	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	556
3300034082|Ga0335020_0001101	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19375
3300034082|Ga0335020_0035948	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2681
3300034101|Ga0335027_0251275	Not Available	1222
3300034104|Ga0335031_0081833	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2294
3300034104|Ga0335031_0227311	Not Available	1249
3300034104|Ga0335031_0701517	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	581
3300034106|Ga0335036_0017589	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5789
3300034106|Ga0335036_0558263	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	702
3300034116|Ga0335068_0043635	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2653
3300034116|Ga0335068_0386680	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	672
3300034120|Ga0335056_0044798	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2924
3300034168|Ga0335061_0485918	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	631

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.80%
Terrestrial	Environmental → Terrestrial	1.20%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	79.52%
Marine	Environmental → Aquatic → Marine	18.88%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.20%
Unclassified	Environmental → Aquatic → Unclassified	0.40%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	49.00%
Lentic	Environmental → Aquatic → Freshwater → Lentic	22.09%
Coastal	Environmental → Aquatic → Marine → Coastal	13.25%
Unclassified	Environmental → Aquatic → Marine → Unclassified	3.61%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	3.21%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.01%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.61%
River	Environmental → Aquatic → Freshwater → River	1.20%
Ice	Environmental → Aquatic → Freshwater → Ice	1.20%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.20%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.80%
Harbor	Environmental → Aquatic → Marine → Harbor	0.40%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.40%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	46.99%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	18.88%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	13.25%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	3.61%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	3.21%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.81%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.01%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.01%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.61%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.20%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.20%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.80%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.80%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.40%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.40%
Unclassified	Environmental → Aquatic → Marine → Harbor → Unclassified	0.40%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.40%

Habitat

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	17.67%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	13.65%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	12.85%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	7.23%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	6.02%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	4.42%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	4.42%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.61%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	3.61%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	3.21%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	2.81%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.41%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.01%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.01%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	1.61%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.61%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.61%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.20%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.20%
Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water	0.80%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	0.80%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.80%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.80%
Lake	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake	0.40%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.40%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.40%
Freshwater, Surface Ice	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice	0.40%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.40%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.40%
Marine Harbor	Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor	0.40%
Meromictic Pond	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond	0.40%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.40%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental
3300002199	Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013	Environmental
3300004836	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)	Environmental
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental
3300005758	Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore	Environmental
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental
3300006920	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12	Environmental
3300007165	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16	Environmental
3300007169	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects	Environmental
3300007171	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects	Environmental
3300007202	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects	Environmental
3300007363	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA	Environmental
3300007516	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01	Environmental
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental
3300007622	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02	Environmental
3300007636	Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3	Environmental
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental
3300007735	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct	Environmental
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental
3300008117	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA	Environmental
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental
3300009469	Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD	Environmental
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental
3300010885	northern Canada Lakes Co-assembly	Environmental
3300011009	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA	Environmental
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental
3300012471	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)	Environmental
3300012666	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2	Environmental
3300012732	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome)	Environmental
3300012773	Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome)	Environmental
3300012962	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)	Environmental
3300012968	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)	Environmental
3300012970	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)	Environmental
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental
3300013087	Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L	Environmental
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental
3300013130 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2	Environmental
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental
3300020183	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface	Environmental
3300020220	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m	Environmental
3300020498	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)	Environmental
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental
3300020570	Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)	Environmental
3300020578	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m	Environmental
3300021093	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface	Environmental
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental
3300022198	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)	Environmental
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental
3300024346	Whole water sample coassembly	Environmental
3300024481	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome)	Environmental
3300024866	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome)	Environmental
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental
3300027380	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 (SPAdes)	Environmental
3300027563	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)	Environmental
3300027627	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)	Environmental
3300027644	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)	Environmental
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental
3300027970 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m	Environmental
3300027971	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)	Environmental
3300027974	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)	Environmental
3300027976	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)	Environmental
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental
3300029286 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m	Environmental
3300029753	Marine harbor viral communities from the Indian Ocean - SRH3	Environmental
3300029930	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727	Environmental
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental
3300034120	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172	Environmental
3300034168	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12421J11937_101712462	3300000756	Freshwater And Sediment	VETGIDPISLLDAPEGILEAIVIYLKERAKAVNKNGG*
B570J14230_101032172	3300001282	Freshwater	MISVESGLSPNDLLDAPDGVLEAIVIYLKERNKGND*
metazooDRAFT_12528013	3300002199	Lake	VETGIDPISLLDAPDGILEAIVIYLKERAKAVNKNGG*
Ga0007759_100714662	3300004836	Freshwater Lake	MLAVEYGLSTNDLLDAPDGILEAMLAYLKEKAKANKNGR*
Ga0070374_101991983	3300005517	Freshwater Lake	MISVETGLSPNDLLDAPDGVLEAITIYLKERAKEANRQ*
Ga0070374_102630872	3300005517	Freshwater Lake	MVSVETGLSPVDLLEAPDGILEAIVIYLKEKSKNASRQ*
Ga0049081_100158961	3300005581	Freshwater Lentic	MLAVEYSISPNELLDAPDGILEAMLAYLKEKAKANKNGR*
Ga0049081_100241281	3300005581	Freshwater Lentic	SLTYTVAMISVETGLSPVDLLEAPDGILEAIVIYLKEKSKNASRK*
Ga0049081_100686052	3300005581	Freshwater Lentic	MISVETGLSPLDLLDAPDGVLEAIVIYLKEKNKNASR*
Ga0049081_102812872	3300005581	Freshwater Lentic	VETGIDPISLMDAPDGILEAIVIYLKQRAKAANKDG*
Ga0049081_103221202	3300005581	Freshwater Lentic	MVSVETGISPNDLLEAPDGVLEAIVIYLKQKAKEASRK*
Ga0049080_102245852	3300005582	Freshwater Lentic	MISVETGLSPTDLLDAPDGVLEAIVVYLKERSKDAGR*
Ga0049085_100214626	3300005583	Freshwater Lentic	MLSVETGISPIDLMDAPDGILEAIVIYLKQKNKDASR*
Ga0078894_100226406	3300005662	Freshwater Lake	MISVETGISPLDLMEAPDGVLEAMVIYLKEQSKK*
Ga0078894_101447971	3300005662	Freshwater Lake	MISVETGISPVDLLEAPDGVLESIVIYLKERSKEASR*
Ga0078894_101580141	3300005662	Freshwater Lake	MISVETGIAPTDLMDAPDGILESMVIYLKQRSKDASKQ*
Ga0078894_103891693	3300005662	Freshwater Lake	MVSVETGISPNDLLEAPEGILEAIVIYLKQKAKEASRK*
Ga0078894_105426503	3300005662	Freshwater Lake	MVSVETGLSPIDLLEAPDGILEAIVIYLKERNKNADR*
Ga0078894_105491063	3300005662	Freshwater Lake	MISVESGLSPNDLLDAPDGVLEAIVIYLKEKNKGND*
Ga0078117_10085763	3300005758	Lake Water	VETGISPVDLLEAPDGVLEAMVIYLKEKNKDASRK*
Ga0078117_11033303	3300005758	Lake Water	VETGIDPISLLDAPDGILEAIVIYLKEKAKAANKHGQ*
Ga0079957_100187426	3300005805	Lake	MISVETGLSPIDLLEAPDGVLEAIVVYLKERSKNASR*
Ga0079957_100210021	3300005805	Lake	MISVETGLSPTDLLEAPDGVLEAIVIYLKERSKNAGR*
Ga0079957_10053985	3300005805	Lake	VETGLPIADLLDAPDGILEAVFAYLKERAKARNK*
Ga0079957_101020310	3300005805	Lake	MVSVETGLSPNDLLEAPDGILEAIVIYLKERSKNASRQ*
Ga0079957_10107847	3300005805	Lake	MISVETGLSPIDLLEAPEGILEAIVIYLKERSKNASRK*
Ga0079957_10332523	3300005805	Lake	MLSVETGISPIDLLEAPDGVLEAIVIYLKERSKDAGRQ*
Ga0079957_10332643	3300005805	Lake	MISVETGISPIDLIEAPDGVLESIVIYLKEKSKNASRQ*
Ga0079957_10533402	3300005805	Lake	VETGIDPISLLDAPDGILEAIVIYLKERAKAAKKHGG*
Ga0079957_10980793	3300005805	Lake	MVSVETGISPVDLLEAPDGILEAIVIYLKERSKNASRQ*
Ga0079957_11147221	3300005805	Lake	TYTVATVSVETGLSPNDLLEAPDGILEAIVIYLKEKSKNASRK*
Ga0079957_12711072	3300005805	Lake	MISVETGISPIDLIEAPDGVLEAIVIYLKEKARDASRK*
Ga0070744_100090922	3300006484	Estuarine	MISVETGLSPTDLIDAPDGVLEAIVIYLKEKSKNASR*
Ga0070744_100857463	3300006484	Estuarine	VEYGISPNELLDAPDGILEAMLAYLKEKAKANKNGR*
Ga0075471_103323091	3300006641	Aqueous	MVSVETGLSPNDLLEAPDGILEAIVIYLKERSKDAGR*
Ga0075464_101674414	3300006805	Aqueous	VETGIDPISLLDAPDGILEAIVIYLKERAKAAKKNGG*
Ga0075464_104860832	3300006805	Aqueous	VETGIDPIALLDAPDGILEAIVIYLKEKAKAANKHGQ*
Ga0070748_12771402	3300006920	Aqueous	VETGIDPISLLDAPEGILEAIVIYLKERAKAVSKNGG*
Ga0079302_10025065	3300007165	Deep Subsurface	YNVAAISVETGISPIDLIDAPEGILEAITIYLKERAKGG*
Ga0102976_10586914	3300007169	Freshwater Lake	MISVETGISPIDLLEAPDGVLEAIVIYLKEKNKAMEKASRKR*
Ga0102977_10561624	3300007171	Freshwater Lake	VETGISPVDLLEAPDGVLEAIVIYLKEKSKNASR*
Ga0103274_12097952	3300007202	Freshwater Lake	VETGISPIDLLEAPDGVLEAIVIYLKEKNKAMEKASRKR*
Ga0075458_101383793	3300007363	Aqueous	VETGISPNDLLDSPPGILEAIVIYLKERAKAYERGR*
Ga0105050_100167303	3300007516	Freshwater	MVSVETGISPVDLLEAPDGVLEAIVIYIKERSKDAGR*
Ga0099851_10169607	3300007538	Aqueous	VETGVSPVDLLEAPDGVLEAMVIYLKEKHKETSRK*
Ga0099848_10256837	3300007541	Aqueous	MVSVETGISPSDLLEAPDGVLEAIVIYLKERSKNASRQ*
Ga0099848_10267782	3300007541	Aqueous	VETGISPNDLLDAPEGVLEAIVIYLKEKSKNASR*
Ga0099848_11507743	3300007541	Aqueous	MISVETGLSPVDLLEAPDGVLEAIVIYLKERSRNASR*
Ga0102863_11804363	3300007622	Estuarine	VETGIDPISLMDAPDGILEAIVIYLKEKAKAANKHGQ*
Ga0102856_10467603	3300007636	Estuarine	MISVETGLSPTDLLDAPDGVLEAIVIYLKQKSKDAGG*
Ga0102859_12016272	3300007708	Estuarine	MISVETGISPVDLLEAPEGVLEAIVIYLKERSKEASR*
Ga0102859_12778291	3300007708	Estuarine	SLTYSLAMISVETGLSPTDLLDAPDGVLEAIVIYLKERSKNASK*
Ga0104988_1043316	3300007735	Freshwater	MLSVETGISPNDLLDAPDGVLESIVIYLKQKNKDAGG*
Ga0104988_1066619	3300007735	Freshwater	VELGISPIDLIDAPDGVLEAIFAYLKERAKANKNGR*
Ga0114340_10063811	3300008107	Freshwater, Plankton	AAVSVETGISPIDLLDAPDGILEAIVIYMKERAKARSK*
Ga0114343_10057367	3300008110	Freshwater, Plankton	MISVETGLSPIDLLDAPDGVLEAIVIYLKQKNKDAGG*
Ga0114343_10136112	3300008110	Freshwater, Plankton	MISVETGIAPNDLMDAPDGVLESMVIYLKQRSKDASKQ*
Ga0114350_10095474	3300008116	Freshwater, Plankton	MISVETGISPIALIDAPDGVLEAIVIYLKQRNKDASR*
Ga0114350_10235783	3300008116	Freshwater, Plankton	MVSVETGLSPNDLLEAPDGVLEAIVIYLKERSKNASR*
Ga0114351_100192312	3300008117	Freshwater, Plankton	MVSVETGISPNDLLEAPSGILEAIVIYLKEKAKEASRK*
Ga0114841_10376143	3300008259	Freshwater, Plankton	VESGLSPLDLLDAPDGILEAIVAYIKERNKARSK*
Ga0114876_10639073	3300008448	Freshwater Lake	MISVETGISPLDLIEAPDGVLEAIVIYLKEQSKKQRNM*
Ga0114880_10939241	3300008450	Freshwater Lake	ISVETGISPIALIDAPDGVLEAIVIYLKQRNKDASR*
Ga0105105_105963522	3300009009	Freshwater Sediment	MISVETGLSPNDLLDAPDGVLEAITIYLKERAKEASR*
Ga0114973_1000078123	3300009068	Freshwater Lake	VETGIDPGALMDAPDGILEAIVIYLKEKAKAANKHGQ*
Ga0105103_107007262	3300009085	Freshwater Sediment	VETGLDPISLLDAPDGILEAIVIYLKEKAKAANKHGK*
Ga0114980_100322053	3300009152	Freshwater Lake	MISVETGLSPVDLLDAPDGVLEAIVIYLKEKNKKAGA*
Ga0114980_101491542	3300009152	Freshwater Lake	MLSVETGISPNDLLDAPDGVLESIVIYLKQKNKDAGA*
Ga0114980_105527312	3300009152	Freshwater Lake	MISVETGISPIDLLEAPEGVIESIVIYLKERSKEASRQ*
Ga0114968_1000267817	3300009155	Freshwater Lake	VELGISPIDLIDAPDGILEAMFAYLKERAKANKYG*
Ga0114968_100892043	3300009155	Freshwater Lake	MISVETGLSPVDLLDAPDGVLESIVIYLKERQKNASR*
Ga0114968_101182205	3300009155	Freshwater Lake	VETGIDPISLMDAPDGILEAIVIYLKEKAKAANKYGQ*
Ga0114968_103153543	3300009155	Freshwater Lake	MLAVEYSISPNELLDAPDGILEAMLAYLKEKAKANKYGR*
Ga0114977_101520333	3300009158	Freshwater Lake	VSVETGLSPTDLLDAPDGILEAIVIYMKERAKARSK*
Ga0114977_107244502	3300009158	Freshwater Lake	MLSVETGISPIDLIDAPDGVLEAIVIYLKQKNKDASR*
Ga0114978_103460543	3300009159	Freshwater Lake	LAVISVETGISPIDLMDAPDGILEAMSIYLKEKSRKR*
Ga0114981_107101252	3300009160	Freshwater Lake	MISVETGLSPVDLIEAPDGVLESIVVYLKERSKNASRQ*
Ga0114970_102431981	3300009163	Freshwater Lake	MISVETGLSPTDLMDAPDGVLEAIVIYLKEKNKKAGA*
Ga0105097_101627313	3300009169	Freshwater Sediment	VEFGISPNDLLDAPDGILEAMLAYLKEKAKANKNG*
Ga0105096_104672302	3300009170	Freshwater Sediment	VETGLDPISLLDAPDGILEAIVIYLKEKAKAANKHGQ*
Ga0114969_100234683	3300009181	Freshwater Lake	MISVETGLSPVDLMDAPDGVLEAIVIYLKEKNKDH*
Ga0114969_103595613	3300009181	Freshwater Lake	MISVETGISPIDLLEAPDGVLESIVIYLKERSKEASRQ*
Ga0114974_107024121	3300009183	Freshwater Lake	LTYTVAMLSVETGISPIDLIDAPDGVLEAIVIYLKQKNKDASR*
Ga0114976_101340863	3300009184	Freshwater Lake	ELGISPIDLIDAPDGVLEAMFAYLKERAKANKYG*
Ga0127401_11528862	3300009469	Meromictic Pond	VETGISPVALLDAPDGILEAIVIYLKEKAKAANKHGQ*
Ga0114964_100727203	3300010157	Freshwater Lake	VELGISPNELLDAPDGVLEAIVAYLEQRNKQRER*
Ga0129333_100023915	3300010354	Freshwater To Marine Saline Gradient	MISVETGISPIDLLEAPDGVLEAIVIYIKEKNKNVGK*
Ga0129333_100077069	3300010354	Freshwater To Marine Saline Gradient	VETGVSPVALLEAPDGILEAMVIYLKEKNKEASRK*
Ga0129333_100133404	3300010354	Freshwater To Marine Saline Gradient	VETGISPVDLLEAPDGVLEAIVIYLKEKSKNAGRK*
Ga0129333_100334537	3300010354	Freshwater To Marine Saline Gradient	VETGISPVALLDAPDGVLEAMVIYLREKNKDARKK*
Ga0129333_100381409	3300010354	Freshwater To Marine Saline Gradient	MISVETGLSPTDLIEAPDGVLEAIVIYLKERSKDASR*
Ga0129333_100419934	3300010354	Freshwater To Marine Saline Gradient	MISVETGLSPNDLLEAPDGILEAVVIYLKERSKNAGRQ*
Ga0129333_101068863	3300010354	Freshwater To Marine Saline Gradient	MISVETGISPIDLLEAPDGVLESIVIYLKEKNKAMERASRK*
Ga0129333_102273732	3300010354	Freshwater To Marine Saline Gradient	VETGLPLNDLLDAPDGVLEAVFAYIKERARAREK*
Ga0129333_102405473	3300010354	Freshwater To Marine Saline Gradient	MISVETGLSPVDLLEAPDGVLEAIVIYLKERSKNAGR*
Ga0129333_103372373	3300010354	Freshwater To Marine Saline Gradient	MVSVETGLSPNDLLEAPDGILEAIVIYLKERSKNASGQ*
Ga0129333_104622933	3300010354	Freshwater To Marine Saline Gradient	MLSVETGISPNDLIDAPDGVLESIVIYLKQKNKDVGG*
Ga0129333_108581672	3300010354	Freshwater To Marine Saline Gradient	VETGISPVALVDAPDGILEAMFVYVKERAKARNK*
Ga0129333_115445942	3300010354	Freshwater To Marine Saline Gradient	MISVETGLSPTDLLDAPDGVLEAIVIYLKEKSKDAGGK*
Ga0129336_107359552	3300010370	Freshwater To Marine Saline Gradient	MISVETGISPVDLLEAPDGVLESIVVYLKEKSKNASRK*
Ga0133913_104779294	3300010885	Freshwater Lake	MISVETGISPNELLEAPDGILEAIVVYIKEKNKDADR*
Ga0133913_114906362	3300010885	Freshwater Lake	VETGIDPISLMDAPDGILEAIVIYLKEKAKAANKHGK*
Ga0129318_100225082	3300011009	Freshwater To Marine Saline Gradient	LSVELGIAPNELLDAPDGVLEGMFAYLSEKYPEQ*
Ga0139557_10506882	3300011010	Freshwater	MISVETGLSPLDLLDAPDGVLEAIVIYLKEKNKDASR*
Ga0129334_10580442	3300012471	Aqueous	MLSVETGLSPVDLLEAPDGVLEAIVIYLKERSRNASR*
Ga0157498_10358932	3300012666	Freshwater, Surface Ice	VETGISPIDLLDAPDGILEAIVIYMKERAKARSK*
Ga0157549_12777542	3300012732	Freshwater	VETGIDPISLLDAPEGILEAIVIYLKERAKAANKHGQ*
Ga0138290_11382643	3300012773	Freshwater Lake	VELGISPIDLIDAPDGVLEAMFAYLKERAKANKYG*
Ga0129335_11658585	3300012962	Aqueous	MVSVETGISPNDLLEAPSGVLEAIVIYLKEKAKEA
Ga0129337_10239512	3300012968	Aqueous	MVSVETGISPNDLLEAPSGVLEAIVIYLKEKAKEASRK*
Ga0129338_11252913	3300012970	Aqueous	VETGISPNDLLDAPEGVLEAIVIYLKEKSKNASRQ*
Ga0129338_12204343	3300012970	Aqueous	MISVETGLSPTDLIEAPDGVLEAIVIYLKEKAKNASRQ*
Ga0129338_13742802	3300012970	Aqueous	VETGISPVDLLEAPDGVLEAIVIYLKERSKNAGR*
Ga0164293_100397244	3300013004	Freshwater	MISVEFGLSPIDLLDAPDGVLEAIVAYIKERNKARSK*
Ga0164293_103809823	3300013004	Freshwater	MISVETGISPVDLMDAPDGVLEAIVIYLKEKNKDH*
Ga0164293_105165422	3300013004	Freshwater	MISVETGLSPNDLLDAPDGVLEAITIYLKERSKEASRQ*
Ga0164293_105535142	3300013004	Freshwater	MISVETGISPNELLEAPDGILEAIVIYIKEKNKDAGN*
Ga0164292_101269023	3300013005	Freshwater	MLSVETGISPNDLLEAPDGILEAIVIYLKEKNKEANK*
Ga0164292_103513022	3300013005	Freshwater	MISVEYGLSPTALLDAPDGVLEAIVAYIKERNKARSK*
Ga0164294_100841507	3300013006	Freshwater	VETGIDPISLMDAPDGILEAIVIYLKERAKAANKHGQ*
Ga0163212_12259531	3300013087	Freshwater	MISVETGISPVDLLEAPDGVLEAIVIYLKERSKNASR*
(restricted) Ga0172367_101019524	3300013126	Freshwater	VEFGISPNDLLDAPDGILEAMLAYLKEKAKANKYGR*
(restricted) Ga0172367_103166012	3300013126	Freshwater	MISVETGISPIDLIEAPDGVLESIVIYLKEKSKNASR*
(restricted) Ga0172363_105831052	3300013130	Sediment	VETGLSPNDLLEAPDGVLEAIVIYLKERSKNASR*
(restricted) Ga0172373_100946031	3300013131	Freshwater	LTYTVAMVSVETGISPNDLLEAPQGILEAIVIYLREKAKEASRK*
(restricted) Ga0172372_100774383	3300013132	Freshwater	MVSVETGISPNDLLEAPQGILEAIVIYLREKAKEASRK*
(restricted) Ga0172372_109163112	3300013132	Freshwater	VETGISPIDLIEAPDGVLESIVIYLKEKSKNASR*
Ga0170791_103060571	3300013295	Freshwater	VETGIDPISLMDAPDGILEAIMIYLKEKAKAANKH
Ga0177922_100808502	3300013372	Freshwater	VEYGISPNELLDAPDGILEAMLAYLKEKAKANKYGR*
Ga0177922_113014761	3300013372	Freshwater	SIAAVSVETGIDPISLLDAPDGILEAIVIYLKEKAKAANKHGQ*
Ga0181347_12037002	3300017722	Freshwater Lake	MISVETGISPIDLIDAPDGVLEAIVIYLKQKNKDASRQ
Ga0181362_11203992	3300017723	Freshwater Lake	MISVETGISPIDLMDAPDGVLEAIVIYLKQKNKDASRQ
Ga0181344_11055243	3300017754	Freshwater Lake	MVSVETGISPNDLLEAPDGILEAIVIYLKEKSKNASRQ
Ga0181344_11270442	3300017754	Freshwater Lake	MVSVETGLSPIDLLEAPDGILEAIVIYLKERNKNADR
Ga0181358_12647762	3300017774	Freshwater Lake	MVSVETGLSPNDLLEAPDGVFEAIVIYLKEKNKEANR
Ga0181346_10896663	3300017780	Freshwater Lake	MLSVETGISPIDLMDAPDGVLEAIVIYLKQKNKDASRQ
Ga0181355_11949222	3300017785	Freshwater Lake	MISVETGISPIDLMDAPDGILEAIVIYLKQKNKDASR
Ga0169931_100491029	3300017788	Freshwater	MISVETGLSPIDLLDAPDGVLEAIVVYLKERSKNASR
Ga0169931_100569843	3300017788	Freshwater	MISVETGISPIDLIEAPDGVLESIVIYLKEKSKNASR
Ga0169931_102125062	3300017788	Freshwater	MISVETGLSPTDLLEAPDGVLEAIVVYLKERSKNASR
Ga0169931_102207973	3300017788	Freshwater	VEFGISPNDLLDAPDGILEAMLAYLKEKAKANKYGR
Ga0181359_10033187	3300019784	Freshwater Lake	MISVETGLSPVDLMDAPDGVLEAIVIYLKEKNKDHK
Ga0181359_10058976	3300019784	Freshwater Lake	VETGIDPISLLDAPEGILEAIVIYLKERAKAVNKNGG
Ga0181359_10131263	3300019784	Freshwater Lake	MISVETGLSPNDLLDAPDGVLEAITIYLKERAKEANRQ
Ga0181359_10226993	3300019784	Freshwater Lake	VETGIDPISLLDAPDGILEAIVIYLKERAKAAKKHGG
Ga0181359_10511043	3300019784	Freshwater Lake	MLAVEYGLSTNDLLDAPDGILEAMLAYLKEKAKANKNGR
Ga0181359_11072092	3300019784	Freshwater Lake	MLSVETGISPIDLIDAPDGVLEAIVIYLKQKNKDASRR
Ga0181359_12109612	3300019784	Freshwater Lake	MISVETGISPIDLMDAPDGILEAIVIYLKQKNKDASRQ
Ga0181359_12290192	3300019784	Freshwater Lake	MISVETGLSPLDLLDAPDGVLEAIVIYLKEKNKNASR
Ga0207193_10537205	3300020048	Freshwater Lake Sediment	MISVETGLSPNDLLEAPDGILEAIVIYLKEKNKDAGG
Ga0207193_10609378	3300020048	Freshwater Lake Sediment	MISVETGISPVDLLEAPDGVLESIVIYLKERSKEASR
Ga0207193_10610014	3300020048	Freshwater Lake Sediment	MLSVETGLSPIDLLDAPDGVLEAIVIYLKEKNKDASR
Ga0207193_14218622	3300020048	Freshwater Lake Sediment	MISVETGLSPTDLLDAPDGILESIVIYLKEKNKDA
Ga0211732_14255332	3300020141	Freshwater	MISVETGLSPTDLLDAPDGVLEAIVIYLKQKSKDAGGQ
Ga0211732_15577343	3300020141	Freshwater	MISVETGLSPTDLLDAPDGVLEAIVIYLKERSKDAGRQ
Ga0211736_109796721	3300020151	Freshwater	SLTYTVAMISVETGLSPVDLIEAPDGVLESIVVYLKERSKNASRQ
Ga0211734_112433823	3300020159	Freshwater	MISVETGLSPTDLLDAPDGVLEAIVIYLKEKSKKAGA
Ga0211729_102293745	3300020172	Freshwater	MISVETGLSPTDLLDAPDGVLEAIVIYLKERAKDAGRQ
Ga0211729_111066485	3300020172	Freshwater	MISVETGLSPTDLLDAPDGVLEAIVIYLKQKSKDAGG
Ga0194115_100045726	3300020183	Freshwater Lake	VEFGLSPNDLLDAPDGILEAMLAYLKEKAKANKYGR
Ga0194115_1000632410	3300020183	Freshwater Lake	MISVETGLSPMDLLDAPDGVLEAIVVYLKERSKNASR
Ga0194119_103608211	3300020220	Freshwater Lake	SVESGISPVALLDAPDGVLEAIFVYVKERAKARNK
Ga0208050_10024377	3300020498	Freshwater	MISVESGLSPNDLLDAPDGVLEAIVIYLKERNKGND
Ga0208050_10034984	3300020498	Freshwater	MISVETGISPLDLIEAPDGVLEAMVIYLKEQSKKQRNI
Ga0208091_10260592	3300020506	Freshwater	VELGISPIDLIDAPDGVLEAMFAYLKERAKANKYG
Ga0208465_10028663	3300020570	Freshwater	SVESGISPVALLDAPDGVLEAIFVYVKERAKARDR
Ga0208465_10048361	3300020570	Freshwater	LTYTVAMISVETGISPIDLLEAPDGVLEAIVIYIKEKNKNVGK
Ga0194129_102357422	3300020578	Freshwater Lake	MISVETGLSPMDLLDAPDGVLEAIVVYLKERSKNASRK
Ga0194123_102106523	3300021093	Freshwater Lake	ALSVESGISPVALLDAPDGVLEAIFVYVKERAKARNK
Ga0222713_1000246337	3300021962	Estuarine Water	VETGIDPISLIDAPDGILEAIVIYLKEKAKAANKHGQ
Ga0222713_100860972	3300021962	Estuarine Water	MISVETGISPVDLMDAPDGILEAMVIYLKEKSKNAGRQ
Ga0222713_101994112	3300021962	Estuarine Water	VETGIDPVSLLDAPDGILEAIVIYLKEKAKAANKYGQ
Ga0222712_100231403	3300021963	Estuarine Water	VEFGISPNDLLDAPDGILEAMLAYLKEKAKANKHGR
Ga0181354_10187291	3300022190	Freshwater Lake	MVSVETGISPNDLLEAPEGILEAIVIYLKQKAKEASRK
Ga0181354_10506823	3300022190	Freshwater Lake	SVETGIDPISLLDAPDGILEAIVIYLKERAKAAKKHGG
Ga0196905_10103744	3300022198	Aqueous	VETGVSPVDLLEAPDGVLEAMVIYLKEKHKETSRK
Ga0196905_10482153	3300022198	Aqueous	MVSVETGISPSDLLEAPDGVLEAIVIYLKERSKNASRQ
Ga0181351_11465591	3300022407	Freshwater Lake	SVESGISPVALLDAPDGILEAMFVYVKERAKARSK
Ga0181351_11512253	3300022407	Freshwater Lake	MLAVEYGLSTNDLLDAPDGILEAMLAYLKEKAKANKYGR
Ga0214917_100082782	3300022752	Freshwater	MASVELGISPIDLIDAPDGVLEAMFAYLKERAKANKYG
Ga0214921_1000332833	3300023174	Freshwater	LAAISVETGISPIDLMDAPDGILEAMIIFLKERNKARSK
Ga0214921_1000366710	3300023174	Freshwater	MISVETGLSPVDLLDAPDGVLESIVIYLKEKQKNASR
Ga0255147_10306873	3300024289	Freshwater	MVSVETGLSPVDLLEAPDGILEAIVIYLKERSKNASRQ
Ga0244775_100429399	3300024346	Estuarine	MISVETGLSPTDLIDAPDGVLEAIVIYLKEKSKNASR
Ga0244775_103567224	3300024346	Estuarine	VEYGISPNELLDAPDGILEAMLAYLKEKAKANKNGR
Ga0244775_106694892	3300024346	Estuarine	MVSVETGLSPNDLLEAPDGILEAVVIYLKERSKNASRQ
Ga0256330_11260562	3300024481	Freshwater	MVSVETGISPVDLLEAPDGILEAIVIYLKERSKNASRQ
Ga0255272_11833642	3300024866	Freshwater	MISVETGLSPVDLLQAPEGVLEAIVIYLKERSKNAGRK
Ga0208916_100246212	3300025896	Aqueous	MLAVEYSISPNELLDAPDGILEAMLAYLKEKAKANKNGR
Ga0208432_10158653	3300027380	Deep Subsurface	TYNVAAISVETGISPIDLIDAPEGILEAITIYLKERAKGG
Ga0209552_10767291	3300027563	Freshwater Lake	TYTIAMISVETGLSPNDLLDAPDGVLEAITIYLKERAKEANRQ
Ga0208942_10741232	3300027627	Freshwater Lentic	MLSVETGISPIDLMDAPDGILEAIVIYLKQKNKDASR
Ga0209356_10050343	3300027644	Freshwater Lake	MVSVETGLSPVDLLEAPDGILEAIVIYLKEKSKNASRQ
Ga0208975_10157312	3300027659	Freshwater Lentic	MISVETGLSPVDLLEAPDGILEAIVIYLKEKSKNASRK
Ga0209492_10153107	3300027721	Freshwater Sediment	VETGLDPISLLDAPDGILEAIVIYLKEKAKAANKHGK
Ga0209190_100106511	3300027736	Freshwater Lake	VELGISPIDLIDAPDGILEAMFAYLKERAKANKYG
Ga0209596_100381014	3300027754	Freshwater Lake	MLSVETGISPNDLLDAPDGVLESIVIYLKQKNKDAGA
Ga0209596_10087655	3300027754	Freshwater Lake	MISVETGLSPTDLMDAPDGVLEAIVIYLKEKNKKAGA
Ga0209596_10118575	3300027754	Freshwater Lake	MISVETGLSPVDLLDAPDGVLESIVIYLKERQKNASR
Ga0209596_10182153	3300027754	Freshwater Lake	MISVETGLSPVDLMDAPDGVLEAIVIYLKEKNKDH
Ga0209596_10415781	3300027754	Freshwater Lake	VETGIDPISLLDAPDGILEAIVIYLKERAKAAKKH
Ga0209296_11149021	3300027759	Freshwater Lake	SIAAVSVETGIDPISLIDAPDGILEAIVIYLKEKAKAANKHGQ
Ga0209296_11186542	3300027759	Freshwater Lake	MISVETGLSPVDLLDAPDGVLEAIVIYLKEKNKKAGA
Ga0209134_101575313	3300027764	Freshwater Lake	ISVESGLSPTALLDAPDGILEAIVAYIKERNKARSK
Ga0209770_1000023835	3300027769	Freshwater Lake	MISVETGIAPTDLMDAPDGILESMVIYLKQRSKDASKQ
Ga0209229_101639992	3300027805	Freshwater And Sediment	VETGISPVALLDAPDGVLEAMVIYLREKNKDARKK
Ga0209229_102535032	3300027805	Freshwater And Sediment	MISVETGISPLDLIEAPDGVLEAMVIYLKEQSKKQGKA
Ga0209229_105233822	3300027805	Freshwater And Sediment	MISVETGLSPVDLLDAPDGVLEAIVIYLKEKNKDASR
Ga0209354_102164252	3300027808	Freshwater Lake	MISVETGISPNELLEAPDGILEAIVVYIKEKNKDADR
Ga0209550_104438273	3300027892	Freshwater Lake	MISVETGLSPLDLLDAPDGVLEAIVIYLKEKSKNASRQ
(restricted) Ga0247837_10569201	3300027970	Freshwater	LSVESGISPVALLDAPDGVLEAIFVYVKERAKARNK
Ga0209401_100032117	3300027971	Freshwater Lake	VETGIDPGALMDAPDGILEAIVIYLKEKAKAANKHGQ
Ga0209299_13548532	3300027974	Freshwater Lake	MISVETGISPIDLLEAPEGVIESIVIYLKERSKEASRQ
Ga0209702_100131953	3300027976	Freshwater	MVSVETGISPVDLLEAPDGVLEAIVIYIKERSKDAGR
Ga0304730_12691002	3300028394	Freshwater Lake	VSVETGLSPTDLLDAPDGILEAIVIYMKERAKARSK
(restricted) Ga0247841_105358212	3300029286	Freshwater	VETGLDPISLLDAPDGILEAIVIYLKEKAKAANKHGQ
Ga0135224_10430822	3300029753	Marine Harbor	MISVETGLSPNDLLEAPDGVLEAIVIYLKERSKNASRK
Ga0119944_10002216	3300029930	Aquatic	MISVETGLSPTDLLEAPDGVLEAIVIYLKERSKNAGR
Ga0119944_10419672	3300029930	Aquatic	MISVETGISPIDLLEAPDGVLEAIVIYLKERSKNASGQ
Ga0315907_100435844	3300031758	Freshwater	MISVETGISPIALIDAPDGVLEAIVIYLKQRNKDASR
Ga0315907_101953124	3300031758	Freshwater	MVSVETGISPNDLLEAPSGILEAIVIYLKEKAKEASRK
Ga0315909_100140069	3300031857	Freshwater	MVSVETGLSPNDLLEAPDGVLEAIVIYLKERSKNASR
Ga0315909_100793183	3300031857	Freshwater	MISVETGLSPIDLLDAPDGVLEAIVIYLKQKNKDAGG
Ga0315909_103886992	3300031857	Freshwater	VETGIDPISLMDAPDGILEAIVIYLKEKAKAANKHG
Ga0315904_100762314	3300031951	Freshwater	MISVETGISPNELIEAPNGVLEAIVIYLKERSKNASRK
Ga0315904_102579692	3300031951	Freshwater	VELHLSPIDLLDAPDGVLEAIFAYLKERAKANKYG
Ga0315906_106396191	3300032050	Freshwater	ALSVEFGISPVALLDAPDGVLEAIFVYVKERAKARNK
Ga0334982_0007987_1248_1361	3300033981	Freshwater	VETGIDPISLLDAPDGILESIVIYLKERAKAVNKNGG
Ga0334982_0043121_49_162	3300033981	Freshwater	MISVETGLSPTDLLDAPDGVLEAIVIYLKEKNKNASR
Ga0334982_0052425_1896_2012	3300033981	Freshwater	MISVETGLSPNDLLDAPDGVLEAITIYLKERSKEASRQ
Ga0334979_0018676_879_992	3300033996	Freshwater	MISVEYGLSPTALLDAPDGVLEAIVAYIKERNKARSK
Ga0334979_0051599_440_547	3300033996	Freshwater	MISVETGISPVDLMDAPDGVLEAIVIYLKEKNKDH
Ga0334979_0105523_1380_1493	3300033996	Freshwater	MISVETGISPNELLEAPDGILEAIVIYIKEKNKDAGN
Ga0334986_0027579_3150_3260	3300034012	Freshwater	VELSISPIDLIDAPDGVLEAMFAYLKERAKANKYGR
Ga0334987_0089833_831_944	3300034061	Freshwater	MISVETGLSPNDLLDAPDGVLEAITIYLKERAKEASR
Ga0335019_0149744_830_943	3300034066	Freshwater	MISVETGLSPIDLMDAPDGVLEAIVIYLKEKNKNAGG
Ga0310130_0252203_56_172	3300034073	Fracking Water	MVSVETGISPVDLLEAPDGVLEAIVIYLKERSRNASRK
Ga0335020_0001101_17260_17373	3300034082	Freshwater	MLSVETGISPNDLLEAPDGILEAIVIYLKEKNKEANK
Ga0335020_0035948_1141_1257	3300034082	Freshwater	MISVETGISPNDLLEAPDGILEAIVIYMKEKNKDAGGK
Ga0335027_0251275_809_925	3300034101	Freshwater	MVSVETGLSPNDLLEAPDGVLEAIVIYLKERSKNASRQ
Ga0335031_0081833_1489_1602	3300034104	Freshwater	VETGISPVALLDAPDGILEAIVIYLKEKAKAANKHGQ
Ga0335031_0227311_1126_1248	3300034104	Freshwater	SIAAVSVETGLSPTDLLDAPDGILEAIVIYMKERAKARSK
Ga0335031_0701517_359_466	3300034104	Freshwater	VEFGISPNDLLDAPDGILEAMLAYLKEKAKANKNG
Ga0335036_0017589_1982_2098	3300034106	Freshwater	MISVETGISPVDLLEAPEGILESIVIYLKERSKEASRQ
Ga0335036_0558263_294_404	3300034106	Freshwater	VELGISPIDLLDAPDGVLEAMFAYLKERAKANKYGR
Ga0335068_0043635_2049_2162	3300034116	Freshwater	MISVETGISPNELLEAPDGILEAIVIYIKEKNKDAGG
Ga0335068_0386680_564_671	3300034116	Freshwater	ISVETGISPTALLDAPEGVLEAITAYIKERAKKHG
Ga0335056_0044798_886_1002	3300034120	Freshwater	MISVETGLSPTDLLDAPDGVLESIVIYLKEKSKDAGGK
Ga0335061_0485918_2_118	3300034168	Freshwater	AAISVESGLSPTALIDAPDGVLEAIVAYIKERNKARSK