NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F015421

Metagenome Family F015421

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015421
Family Type Metagenome
Number of Sequences 254
Average Sequence Length 77 residues
Representative Sequence MRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLL
Number of Associated Samples 29
Number of Associated Scaffolds 254

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 66.54 %
% of genes from short scaffolds (< 2000 bps) 68.50 %
Associated GOLD sequencing projects 29
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (69.291 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(61.811 % of family members)
Environment Ontology (ENVO) Unclassified
(99.213 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(88.189 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.08%    β-sheet: 0.00%    Coil/Unstructured: 67.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 254 Family Scaffolds
PF03732Retrotrans_gag 14.57
PF03641Lysine_decarbox 2.76
PF00078RVT_1 1.57
PF08284RVP_2 0.79
PF14223Retrotran_gag_2 0.39
PF13650Asp_protease_2 0.39
PF05699Dimer_Tnp_hAT 0.39
PF00132Hexapep 0.39
PF00692dUTPase 0.39
PF00069Pkinase 0.39
PF14392zf-CCHC_4 0.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 254 Family Scaffolds
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 2.76
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.57
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.39
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 0.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.55 %
UnclassifiedrootN/A9.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300025167|Ga0209642_10464011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica703Open in IMG/M
3300025326|Ga0209342_11265511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica538Open in IMG/M
3300028786|Ga0307517_10038327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5310Open in IMG/M
3300028786|Ga0307517_10064010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3426Open in IMG/M
3300028786|Ga0307517_10082331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica2733Open in IMG/M
3300028786|Ga0307517_10090324All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2514Open in IMG/M
3300028786|Ga0307517_10117819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1980Open in IMG/M
3300028786|Ga0307517_10155353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1554Open in IMG/M
3300028786|Ga0307517_10238840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1080Open in IMG/M
3300028786|Ga0307517_10536666All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium587Open in IMG/M
3300028786|Ga0307517_10590284All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium548Open in IMG/M
3300028794|Ga0307515_10002032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta44708Open in IMG/M
3300028794|Ga0307515_10028899All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta9400Open in IMG/M
3300028794|Ga0307515_10087635All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica3947Open in IMG/M
3300028794|Ga0307515_10088054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max3930Open in IMG/M
3300028794|Ga0307515_10094742Not Available3683Open in IMG/M
3300028794|Ga0307515_10095611All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3654Open in IMG/M
3300028794|Ga0307515_10100596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3498Open in IMG/M
3300028794|Ga0307515_10129138All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2797Open in IMG/M
3300028794|Ga0307515_10135930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2673Open in IMG/M
3300028794|Ga0307515_10148660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2463Open in IMG/M
3300028794|Ga0307515_10177189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2097Open in IMG/M
3300028794|Ga0307515_10233142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1628Open in IMG/M
3300028794|Ga0307515_10236690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1605Open in IMG/M
3300028794|Ga0307515_10273464All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium1406Open in IMG/M
3300028794|Ga0307515_10280173Not Available1375Open in IMG/M
3300028794|Ga0307515_10360061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1096Open in IMG/M
3300028794|Ga0307515_10462570All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica882Open in IMG/M
3300028794|Ga0307515_10534000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica782Open in IMG/M
3300028794|Ga0307515_10641159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica674Open in IMG/M
3300030521|Ga0307511_10010059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae9408Open in IMG/M
3300030521|Ga0307511_10032323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium4651Open in IMG/M
3300030521|Ga0307511_10207392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium1006Open in IMG/M
3300030521|Ga0307511_10291771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica744Open in IMG/M
3300030521|Ga0307511_10362864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica615Open in IMG/M
3300030521|Ga0307511_10373909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium599Open in IMG/M
3300030521|Ga0307511_10394707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium572Open in IMG/M
3300030522|Ga0307512_10040412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3892Open in IMG/M
3300030522|Ga0307512_10081770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2315Open in IMG/M
3300030522|Ga0307512_10178501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium1199Open in IMG/M
3300030522|Ga0307512_10238760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica922Open in IMG/M
3300030522|Ga0307512_10271266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica821Open in IMG/M
3300030522|Ga0307512_10273863Not Available814Open in IMG/M
3300030522|Ga0307512_10284164All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica787Open in IMG/M
3300030522|Ga0307512_10333062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica681Open in IMG/M
3300030522|Ga0307512_10343883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica662Open in IMG/M
3300030522|Ga0307512_10374421All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica613Open in IMG/M
3300030522|Ga0307512_10409734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta565Open in IMG/M
3300030522|Ga0307512_10458053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica512Open in IMG/M
3300031456|Ga0307513_10005654All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta16470Open in IMG/M
3300031456|Ga0307513_10040305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5166Open in IMG/M
3300031456|Ga0307513_10053687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4328Open in IMG/M
3300031456|Ga0307513_10084765All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium3253Open in IMG/M
3300031456|Ga0307513_10094159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3041Open in IMG/M
3300031456|Ga0307513_10223083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1703Open in IMG/M
3300031456|Ga0307513_10329881All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1280Open in IMG/M
3300031456|Ga0307513_10552645All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica863Open in IMG/M
3300031456|Ga0307513_10555176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium860Open in IMG/M
3300031456|Ga0307513_10632845All Organisms → cellular organisms → Eukaryota777Open in IMG/M
3300031456|Ga0307513_10652303All Organisms → cellular organisms → Eukaryota759Open in IMG/M
3300031456|Ga0307513_10669142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium744Open in IMG/M
3300031456|Ga0307513_10739041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium689Open in IMG/M
3300031456|Ga0307513_10806678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica644Open in IMG/M
3300031456|Ga0307513_10949213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica568Open in IMG/M
3300031456|Ga0307513_11068044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica518Open in IMG/M
3300031456|Ga0307513_11115527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica501Open in IMG/M
3300031507|Ga0307509_10060264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max4012Open in IMG/M
3300031507|Ga0307509_10077084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3456Open in IMG/M
3300031507|Ga0307509_10095563Not Available3026Open in IMG/M
3300031507|Ga0307509_10133637Not Available2431Open in IMG/M
3300031507|Ga0307509_10195810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1865Open in IMG/M
3300031507|Ga0307509_10211014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium1766Open in IMG/M
3300031507|Ga0307509_10292199All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300031507|Ga0307509_10303339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium1343Open in IMG/M
3300031507|Ga0307509_10374877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1138Open in IMG/M
3300031507|Ga0307509_10380219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1125Open in IMG/M
3300031507|Ga0307509_10417514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1043Open in IMG/M
3300031507|Ga0307509_10432303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1014Open in IMG/M
3300031507|Ga0307509_10582305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica793Open in IMG/M
3300031507|Ga0307509_10639197All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300031507|Ga0307509_10695540All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica683Open in IMG/M
3300031507|Ga0307509_10710207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium671Open in IMG/M
3300031507|Ga0307509_10739336All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica649Open in IMG/M
3300031507|Ga0307509_10774427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica624Open in IMG/M
3300031507|Ga0307509_10795233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium610Open in IMG/M
3300031507|Ga0307509_10945542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium527Open in IMG/M
3300031507|Ga0307509_10980576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica511Open in IMG/M
3300031507|Ga0307509_10996917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica504Open in IMG/M
3300031616|Ga0307508_10043974All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3998Open in IMG/M
3300031616|Ga0307508_10090834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica2641Open in IMG/M
3300031616|Ga0307508_10124932All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica2175Open in IMG/M
3300031616|Ga0307508_10153565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1906Open in IMG/M
3300031616|Ga0307508_10357935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1050Open in IMG/M
3300031616|Ga0307508_10472311All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica847Open in IMG/M
3300031616|Ga0307508_10483994All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium831Open in IMG/M
3300031616|Ga0307508_10523022All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica782Open in IMG/M
3300031616|Ga0307508_10530173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium774Open in IMG/M
3300031616|Ga0307508_10568768All Organisms → cellular organisms → Eukaryota732Open in IMG/M
3300031616|Ga0307508_10813513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica552Open in IMG/M
3300031616|Ga0307508_10874143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica522Open in IMG/M
3300031649|Ga0307514_10034883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica4007Open in IMG/M
3300031649|Ga0307514_10229950All Organisms → Viruses → Predicted Viral1125Open in IMG/M
3300031649|Ga0307514_10382058All Organisms → cellular organisms → Eukaryota730Open in IMG/M
3300031649|Ga0307514_10393020All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica712Open in IMG/M
3300031649|Ga0307514_10441072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica644Open in IMG/M
3300031649|Ga0307514_10521667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica557Open in IMG/M
3300031649|Ga0307514_10531553All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium548Open in IMG/M
3300031649|Ga0307514_10536423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica544Open in IMG/M
3300031649|Ga0307514_10588496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica503Open in IMG/M
3300031730|Ga0307516_10099777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2719Open in IMG/M
3300031730|Ga0307516_10184261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae1818Open in IMG/M
3300031730|Ga0307516_10329634All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1195Open in IMG/M
3300031730|Ga0307516_10380273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1073Open in IMG/M
3300031730|Ga0307516_10547831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica810Open in IMG/M
3300031730|Ga0307516_10557649All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium799Open in IMG/M
3300031730|Ga0307516_10665857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica696Open in IMG/M
3300031730|Ga0307516_10739643All Organisms → cellular organisms → Eukaryota642Open in IMG/M
3300031730|Ga0307516_10739657All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium642Open in IMG/M
3300031730|Ga0307516_10779758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica616Open in IMG/M
3300031730|Ga0307516_10976996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica517Open in IMG/M
3300031838|Ga0307518_10027937All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica4070Open in IMG/M
3300031838|Ga0307518_10074226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2460Open in IMG/M
3300031838|Ga0307518_10148255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1626Open in IMG/M
3300031838|Ga0307518_10148929Not Available1621Open in IMG/M
3300031838|Ga0307518_10187848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1388Open in IMG/M
3300031838|Ga0307518_10270690All Organisms → cellular organisms → Eukaryota1060Open in IMG/M
3300031838|Ga0307518_10324659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica916Open in IMG/M
3300031838|Ga0307518_10382291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica797Open in IMG/M
3300031838|Ga0307518_10382313All Organisms → cellular organisms → Eukaryota797Open in IMG/M
3300031838|Ga0307518_10442955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica699Open in IMG/M
3300031838|Ga0307518_10445143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium696Open in IMG/M
3300031838|Ga0307518_10485579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica643Open in IMG/M
3300031838|Ga0307518_10493842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica633Open in IMG/M
3300031838|Ga0307518_10581547All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica542Open in IMG/M
3300032354|Ga0325403_1000309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida31611Open in IMG/M
3300032354|Ga0325403_1001331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae20314Open in IMG/M
3300032354|Ga0325403_1001474Not Available19652Open in IMG/M
3300032354|Ga0325403_1014580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7350Open in IMG/M
3300032354|Ga0325403_1016304Not Available6894Open in IMG/M
3300032354|Ga0325403_1018253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida6443Open in IMG/M
3300032354|Ga0325403_1028929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera4698Open in IMG/M
3300032354|Ga0325403_1036124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3942Open in IMG/M
3300032354|Ga0325403_1036822Not Available3879Open in IMG/M
3300032354|Ga0325403_1036958Not Available3868Open in IMG/M
3300032354|Ga0325403_1088287Not Available1440Open in IMG/M
3300032354|Ga0325403_1091623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1362Open in IMG/M
3300032354|Ga0325403_1097799All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1228Open in IMG/M
3300032354|Ga0325403_1104875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1099Open in IMG/M
3300032354|Ga0325403_1115107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium949Open in IMG/M
3300032354|Ga0325403_1123740All Organisms → cellular organisms → Eukaryota852Open in IMG/M
3300032354|Ga0325403_1131114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium786Open in IMG/M
3300032354|Ga0325403_1132526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica776Open in IMG/M
3300032354|Ga0325403_1137934All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica727Open in IMG/M
3300032354|Ga0325403_1141399Not Available697Open in IMG/M
3300032354|Ga0325403_1141605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium695Open in IMG/M
3300032354|Ga0325403_1145198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica665Open in IMG/M
3300032354|Ga0325403_1153046All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica609Open in IMG/M
3300032354|Ga0325403_1154428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica599Open in IMG/M
3300032354|Ga0325403_1160209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica565Open in IMG/M
3300032355|Ga0325401_1006453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida11333Open in IMG/M
3300032355|Ga0325401_1036594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4132Open in IMG/M
3300032355|Ga0325401_1048722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3278Open in IMG/M
3300032355|Ga0325401_1054426All Organisms → cellular organisms → Eukaryota2979Open in IMG/M
3300032355|Ga0325401_1059913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2721Open in IMG/M
3300032355|Ga0325401_1117614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1278Open in IMG/M
3300032355|Ga0325401_1131856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1103Open in IMG/M
3300032355|Ga0325401_1139611All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1026Open in IMG/M
3300032355|Ga0325401_1142978All Organisms → cellular organisms → Eukaryota995Open in IMG/M
3300032355|Ga0325401_1144273All Organisms → cellular organisms → Eukaryota984Open in IMG/M
3300032355|Ga0325401_1150213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium937Open in IMG/M
3300032355|Ga0325401_1241471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica527Open in IMG/M
3300032374|Ga0325400_1001569Not Available19027Open in IMG/M
3300032374|Ga0325400_1034773Not Available4470Open in IMG/M
3300032374|Ga0325400_1168650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium1082Open in IMG/M
3300032374|Ga0325400_1230497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica771Open in IMG/M
3300032374|Ga0325400_1302036All Organisms → cellular organisms → Eukaryota570Open in IMG/M
3300032389|Ga0325405_1008536Not Available10167Open in IMG/M
3300032389|Ga0325405_1017695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera6413Open in IMG/M
3300032389|Ga0325405_1034625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3721Open in IMG/M
3300032389|Ga0325405_1058255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2076Open in IMG/M
3300032389|Ga0325405_1066539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1710Open in IMG/M
3300032389|Ga0325405_1109461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium734Open in IMG/M
3300032389|Ga0325405_1109690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica731Open in IMG/M
3300032389|Ga0325405_1110473All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica720Open in IMG/M
3300032389|Ga0325405_1124346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium568Open in IMG/M
3300032389|Ga0325405_1124789All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium564Open in IMG/M
3300032389|Ga0325405_1129308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica528Open in IMG/M
3300032389|Ga0325405_1130855All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium516Open in IMG/M
3300032390|Ga0325404_1007323Not Available11511Open in IMG/M
3300032390|Ga0325404_1008885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida10276Open in IMG/M
3300032390|Ga0325404_1061306All Organisms → cellular organisms → Eukaryota1855Open in IMG/M
3300032390|Ga0325404_1088998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium958Open in IMG/M
3300032390|Ga0325404_1116706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium578Open in IMG/M
3300032735|Ga0325410_1006188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta13154Open in IMG/M
3300032735|Ga0325410_1020088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera6264Open in IMG/M
3300032735|Ga0325410_1021339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5971Open in IMG/M
3300032735|Ga0325410_1029485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida4498Open in IMG/M
3300032735|Ga0325410_1102157All Organisms → cellular organisms → Eukaryota748Open in IMG/M
3300032735|Ga0325410_1108925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica665Open in IMG/M
3300032735|Ga0325410_1118479All Organisms → cellular organisms → Eukaryota578Open in IMG/M
3300032740|Ga0325411_1004280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida16056Open in IMG/M
3300032740|Ga0325411_1093206All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica802Open in IMG/M
3300032740|Ga0325411_1095670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica770Open in IMG/M
3300032740|Ga0325411_1116746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica523Open in IMG/M
3300032741|Ga0325414_1003221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida16915Open in IMG/M
3300032741|Ga0325414_1055065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2457Open in IMG/M
3300032741|Ga0325414_1117079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica756Open in IMG/M
3300032741|Ga0325414_1134360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium586Open in IMG/M
3300032741|Ga0325414_1137220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica565Open in IMG/M
3300032741|Ga0325414_1146786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica501Open in IMG/M
3300033160|Ga0325402_1085785Not Available1468Open in IMG/M
3300033160|Ga0325402_1089917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1366Open in IMG/M
3300033160|Ga0325402_1123506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium816Open in IMG/M
3300033160|Ga0325402_1162567All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium501Open in IMG/M
3300033179|Ga0307507_10077742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium2948Open in IMG/M
3300033179|Ga0307507_10087759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium2687Open in IMG/M
3300033179|Ga0307507_10123339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium2062Open in IMG/M
3300033179|Ga0307507_10214039All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1308Open in IMG/M
3300033179|Ga0307507_10218115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica1287Open in IMG/M
3300033179|Ga0307507_10255099Not Available1127Open in IMG/M
3300033179|Ga0307507_10297160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica994Open in IMG/M
3300033179|Ga0307507_10379235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica815Open in IMG/M
3300033179|Ga0307507_10466667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium691Open in IMG/M
3300033179|Ga0307507_10583174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica581Open in IMG/M
3300033180|Ga0307510_10029482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida6245Open in IMG/M
3300033180|Ga0307510_10074820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium3342Open in IMG/M
3300033180|Ga0307510_10075932All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica3309Open in IMG/M
3300033180|Ga0307510_10193402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1579Open in IMG/M
3300033180|Ga0307510_10287807Not Available1110Open in IMG/M
3300033180|Ga0307510_10324682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium995Open in IMG/M
3300033180|Ga0307510_10346908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica935Open in IMG/M
3300033180|Ga0307510_10476561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica689Open in IMG/M
3300033180|Ga0307510_10489804All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium671Open in IMG/M
3300033180|Ga0307510_10508618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica647Open in IMG/M
3300033180|Ga0307510_10560685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica589Open in IMG/M
3300033180|Ga0307510_10561800All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium588Open in IMG/M
3300034389|Ga0325419_010303Not Available9736Open in IMG/M
3300034389|Ga0325419_088018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium1001Open in IMG/M
3300034389|Ga0325419_109843All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium730Open in IMG/M
3300034688|Ga0325420_049126All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2626Open in IMG/M
3300034688|Ga0325420_061927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2042Open in IMG/M
3300034688|Ga0325420_130122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica730Open in IMG/M
3300034689|Ga0325421_009092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta9391Open in IMG/M
3300034689|Ga0325421_055861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium2137Open in IMG/M
3300034689|Ga0325421_096173All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica984Open in IMG/M
3300034778|Ga0325423_138409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica503Open in IMG/M
3300034899|Ga0325407_095063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium983Open in IMG/M
3300034899|Ga0325407_131095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium594Open in IMG/M
3300034899|Ga0325407_145305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium507Open in IMG/M
3300034901|Ga0325409_018693Not Available6408Open in IMG/M
3300034901|Ga0325409_133043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica506Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza61.81%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem31.10%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf6.30%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034778Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M
3300034901Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0209642_1046401113300025167SoilMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKTGII
Ga0209342_1126551113300025326SoilMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKSGIIQ
Ga0307517_1003832753300028786EctomycorrhizaMRVWSRTLSGRLCRVSSSFSKNMAKEDNQSLHNENNENNCVRTLRDHMNPTRTSAPSCIVFPPNASHFNFKPDIIQLLPSFHGLDL
Ga0307517_1006401043300028786EctomycorrhizaSSYTCMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNEINQVKTLKDHMNPTRTSAPSCIVSPLMHLILILSQALFNFYLLFMA
Ga0307517_1008233133300028786EctomycorrhizaMRVWLCTLSGRLCRVSPSFSENMVEEDNQSLHNENNRVRTFRDHMNPTRTSAPSCIVFTPDASHFNFKPDIIQLLPSFHGLDLENS
Ga0307517_1009032443300028786EctomycorrhizaMRVWSCTLSGRLCRVSSSFPESMAEKDNHSFHNENNRVRILRDHMNPTRTSAPSCIVFPPDTSHFNFKPGIIQLLPSFHGLDL
Ga0307517_1011781913300028786EctomycorrhizaMRVWTRTLSGRLSKKSSSSSENMAEEDNQSLHNENNRVRTLRDHINPTRTSAPSCIVFSPEASQEVDVIEDT
Ga0307517_1015535313300028786EctomycorrhizaMRVWSRTLSGKLCRASSSFSENMAEVDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPCNASHFNFKSDIIQFLSSFHGLDL
Ga0307517_1023884013300028786EctomycorrhizaMRVWSHTLSGRLCRVSSSFSENIAEEDNQSLHNENNENNRVRTLGDHMNPTRTSAPSCIVFSPYTSHFNFKPDIIQLLSFFHGLDYLHL
Ga0307517_1053666623300028786EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPIRTSALSCIVFLADASHFNFKSDIIQLLPSFMA
Ga0307517_1059028413300028786EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKTGI
Ga0307515_10002032543300028794EctomycorrhizaMRVCSRTLSGRLFRKSSSFSENIAEEDNQSLYNENNRVRTLRNHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHGLDLEIHTYI
Ga0307515_1002889913300028794EctomycorrhizaSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSYIVFPPDASHFNFSQALFNFYLLFMA
Ga0307515_1008763513300028794EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTKTSAPSCIVFPPNASHFNFKPGMA
Ga0307515_1008805483300028794EctomycorrhizaMRVSSRTLSGRFSRKSSSFLENMAKEDNQSLHNENNENNRVRTLRDHMNPTKTSAPSCIVFP
Ga0307515_1009474213300028794EctomycorrhizaMRVWTRTLSGRLSRKSSSLSENMVEEDNQSLDDENNENNRVRTLRDHMNPTRTSAPSCIVFPHDAFHFNFKPDIIQLLATFMA
Ga0307515_1009561123300028794EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVPPLMHLILILSQALFNFYLPFMA
Ga0307515_1010059653300028794EctomycorrhizaMRVWSCTLSGRLCKVSSSFSENMAEEDNPSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDSSHFN
Ga0307515_1012913843300028794EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENIAEKDNQSLHNENNENNRVRTLRDHMNPIRTSALSCIVFPADASHFNFKPDIIQLLPSFMA
Ga0307515_1013593013300028794EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDAS
Ga0307515_1014866063300028794EctomycorrhizaMRVWTRTLSGRLFRKSSFSSENIVEKDNQSIHNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPSII
Ga0307515_1017718943300028794EctomycorrhizaMRVWSCTLSGRLCRVSSSFPESMAEKDNHSFHNENNRVRILRDHMNPTRTSAPSCIVFPPDTSHFNFKPSIIQLLPSFHGLDL
Ga0307515_1023314223300028794EctomycorrhizaMRVWSRTLSGKLCRASSSFSENMAEVDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPSNASHFNFK
Ga0307515_1023669023300028794EctomycorrhizaMRVWSRTLSGRLCRVSSSFLENMAEEDNQSLHNENNENNHLRTLKDHMNPTRTSAPSCIVFTPDASHFNFKPDIIQLAFKRI
Ga0307515_1027346413300028794EctomycorrhizaMRVWTRTLNGILSRKSSSFSENMAEKDNQSLHNENNRVRTLRDHMNPTRTSAPSCISFPPDASHFNFKPCI
Ga0307515_1028017313300028794EctomycorrhizaMRVWSRTLSGRLCKASSSFSENMAEEDNQSLYNENNRVTTLRDHMNPTRTSAPSCIVFPPDASHFNLSQTLFNFYLLFMT
Ga0307515_1036006113300028794EctomycorrhizaMRVWSRTLSGRLYMVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPHDASHFNFKPDIIQLLPSFHGLD
Ga0307515_1046257013300028794EctomycorrhizaMRVWSCTLSGRLCKVSSSFLENIAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPHIIQLLPFFHGLDLKN
Ga0307515_1053400013300028794EctomycorrhizaMRIWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIWVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHGLD
Ga0307515_1064115913300028794EctomycorrhizaMRVWSRTLSGRLCRVSSSFLENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPD
Ga0307511_10010059123300030521EctomycorrhizaMRVWSCILSGRLSKKSSSSLKNMAEKDNQSLYNDNNCLRTLRGHMNPIRINAPSCIVSPHDTSHFNFKPSII
Ga0307511_1003232343300030521EctomycorrhizaMRVWSRTLSGRLCRVSSSFLENIIEEDNQSLHNENNENNRVRTLRDHMNLTRTSAPLCIVFPPDASHFNFKPGIIQLLPSFHGLDLENPYLHLREF
Ga0307511_1020739213300030521EctomycorrhizaMRVWTRTLSGRLSKKSSSSSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDTSQEVDVIEDT
Ga0307511_1029177113300030521EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNQVRTLRDHMNPTRTSAPSCIVFPHDASHFNFKPGIIQLLPS
Ga0307511_1036286413300030521EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPTKTSAPSCIVFPPNASHFNFKPGMA
Ga0307511_1037390913300030521EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENIAEEDNQSLHNENNENNRVRTLRDHINPTRTSAPSCIV
Ga0307511_1039470713300030521EctomycorrhizaMRVWIRILSGRLSRKSLSFSENMAEEDNQSFHNENNENNRVRTLRDYINPTRISARSCIVFPHDASHFNFKP
Ga0307511_1042042123300030521EctomycorrhizaMRVWTRTLSGRLSRKSSSFSENVADENNQSIHKENNRVRTLRDYMNLTRTSARSCIIFPPDASHFNFTPD
Ga0307512_1004041253300030522EctomycorrhizaMRVWSHTLSGRLCRVSSSFSENMAEETNQSLHNKNNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHG
Ga0307512_1008177053300030522EctomycorrhizaMRVWSRTLSGKLCRASSSFSENMAEVDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPSNASHFNFKSDIIQFLSSFHGLDL
Ga0307512_1017850113300030522EctomycorrhizaMRVWSRTLSGRLCRLFSSSSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPYAF
Ga0307512_1023876013300030522EctomycorrhizaMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLYNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNF
Ga0307512_1027126613300030522EctomycorrhizaFYFVFFFLLFSSYTCMRVWSCTLSGRLCRVSSSFPESMAEKDNHSFHNENNRVRILRDHMNPTRTSAPSCIVFPPDTSHFNFKPGIIQLLPSFHGLDL
Ga0307512_1027386323300030522EctomycorrhizaRTLSGRLSKKSSSSSENMAEEDNQSLHNENNRVRTLRDHINPTRTSAPSCIVFSPEASQEVDVIEDT
Ga0307512_1028416413300030522EctomycorrhizaMRVWSHTLSGRLCRVSLSFLENMAEEDNQSLHNENNENNRVRTLRDHMNPISTSAPSYIIFPPDASHFNFKPGIIQLLPSFHDLDLENLYLYLREFDEVCN
Ga0307512_1033306213300030522EctomycorrhizaMRVWSRTLSGKLCKVSPSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKQDIIQL
Ga0307512_1034388313300030522EctomycorrhizaMRVWTRTLNGRLSRKSSSFSENMVEEDNQSLHDENNENNRVRTLRDHMNPTRTSAPSCIVFPHDAFHFN
Ga0307512_1037442113300030522EctomycorrhizaMRVWSCTLSGRLCKVSSSFLENIAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPNA
Ga0307512_1040973423300030522EctomycorrhizaMKVWLRTLSGRLCRVSSSFSENMTEEDNQSLHNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKSGIIQLYLLFMA
Ga0307512_1045805313300030522EctomycorrhizaMRVWSRTLSDRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPP
Ga0307513_1000565463300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCVVFPPDASHFNFKPDII
Ga0307513_1004030513300031456EctomycorrhizaMRVWSHILSGRFCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPIRTSASSCIVFSPNASHFNF
Ga0307513_1005368713300031456EctomycorrhizaMRVWSRTLSGKLCRASSSFSENMAEVDNQSLHNENNENNCVRTLRDHMNPTRTSAPSCIVFPSNASHFNFKSDIIQFLSSFHGLDL
Ga0307513_1008476513300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRILRDHMNPTRTSAPSCIVFPPDASHFNFKSGIIQLL
Ga0307513_1009415933300031456EctomycorrhizaMRVWSRTLSGRLCKVSSSFSENMAEEDNQSLYNENNRVTTLRDHMNPTRTSAPSCIVFPPDASHFNLSQTLFNFYLLFMT
Ga0307513_1017831713300031456EctomycorrhizaMRVWSHTLSGRLSRKSSSFSKNIAEEDDQLLHNENNKNNRVRTLRDHMNPIRISASSCIVFPPDASH
Ga0307513_1022308313300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTKTSAPSCIVFPPDASHFNFKPDMA
Ga0307513_1032988113300031456EctomycorrhizaMRVWSRTLSDRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPIRTSAISCIVFPADASHFNFKPDIIQLLPSFMA
Ga0307513_1055264513300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNKSLYNENNENIRVRTLRDHMNPTRTSAPSCIVFPPNASHFNFKP
Ga0307513_1055517613300031456EctomycorrhizaMRVXSRILSGRLCRVSSLFSKNIAEEDKSLHNENNENNRVRTLRDHMNPTRTSAPLCIVFPPDAFHF
Ga0307513_1063284523300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMVEEDNQSLHNENNENIRVRTLKDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHGLDLE
Ga0307513_1065230313300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNDNIRVRTLRDHMNPTRISAPSCIVFPPDASHFNFKSGIIQLLPSFHGLDLENP
Ga0307513_1066914223300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPLDASHFNFK
Ga0307513_1073904123300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLL
Ga0307513_1080667813300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQLLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDII
Ga0307513_1094921313300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFLENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFP
Ga0307513_1106804413300031456EctomycorrhizaWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSYIVFPPDASHFNFSQALFNFYLLFMA
Ga0307513_1111552713300031456EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLYNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPG
Ga0307509_1006026473300031507EctomycorrhizaMRVSSRTLSGRFSRKSSSFLENMAKEDNQSLHNENNENNRVRTLRDHMNPTKTSAPSCIVFPPDASHFNFKSGIIQ
Ga0307509_1007708413300031507EctomycorrhizaCRVSSSFSKNMAKEDNQSLHNENNENNCVRTLRDHMNPTRTSAPSCIVFPPNASHFNFKPDIIQLLPSFHGLDL
Ga0307509_1009556353300031507EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKSGIIQLLPSFHGLDLEN
Ga0307509_1013363713300031507EctomycorrhizaLFSSYTCMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPIRTSALSCIVFLADASHFNFKSDIIQLLPSFMA
Ga0307509_1019581043300031507EctomycorrhizaMRVWLCTLSSRLCRVSPSFSENMVEEDNQSLHNENNRVRTFRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHGLDLENS
Ga0307509_1021101413300031507EctomycorrhizaMRVWSRTLSGRLCRVCSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNLTRTSAPSCIVFPPDASLFNFKPDIIQLLPSFMA
Ga0307509_1029219913300031507EctomycorrhizaMRIWSRTLSGRLCRVSSSFLENMAEEDNQSLHNENNHVRTLRDHMNPTRTSAPTCIVSPPNA
Ga0307509_1030333923300031507EctomycorrhizaMRVWSGTLSGRLCRVSSSFSENIAEEDNQSLHNENNENIRVRTLRDHMNATRTSAPSCIVFPPDASHFNFKP
Ga0307509_1037487713300031507EctomycorrhizaSRTLSGRLFRKSSSFSENIAEEDNQSLYNENNRVRTLRNHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHGLDLEIHTYI
Ga0307509_1038021913300031507EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENIAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDAS
Ga0307509_1041751413300031507EctomycorrhizaMRVWSCTLSGRFSRKSSSFSENMAEEDIQSLHNDNNENNRVKTLRDHMNPTRTSAPSFIVFPPGASYFNFKPEIIKL
Ga0307509_1043230313300031507EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFK
Ga0307509_1058230513300031507EctomycorrhizaMRVWSRILSGRLCRVSSSFSENMVEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDAS
Ga0307509_1063919713300031507EctomycorrhizaSFAFFFLLFSSYTCMRVWSRTLSGRLCRVSSSFLENMAEEDNQSLHNENNENNHLRTLKDHMNPTRTSAPSCIVFTPDASHFNFKPDIIQLAFKRI
Ga0307509_1069554013300031507EctomycorrhizaMCTRVWSRTLSGRLCRVSLSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPCFHGLDL
Ga0307509_1071020713300031507EctomycorrhizaMRVWSRILSGRHCRVSSSFSENMAKEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDAS
Ga0307509_1073933613300031507EctomycorrhizaMRVWSHTLSGRLCRVSSSFSENMVEEDNQSLHNKNNENNHVRTLRDHMNPIRTSASSCIVFPPDASHYNFKPDIIQLLPSFHGL
Ga0307509_1077442713300031507EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCTVFSPDASHFNFKPSIIQLLPSFHDL
Ga0307509_1079523323300031507EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHGLD
Ga0307509_1094554213300031507EctomycorrhizaMCMRVWLCTVSGRLYRVSPSFSENMVEEDNQSLHNENNRVRTFRDHMNPTRTSAPSCIVFPPDASHFN
Ga0307509_1098057613300031507EctomycorrhizaMRVWSRTLSGRLCRVSSLFPENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHG
Ga0307509_1099691713300031507EctomycorrhizaMRVWSRTLTGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPG
Ga0307508_1004397423300031616EctomycorrhizaMRVWSHILSGILSRKSSSFLENMVAEDNQSLHNDNNCLRTFRDHMNPIRTSAPSCIVFPSNVSHLNFK
Ga0307508_1009083413300031616EctomycorrhizaMCKRGWSRTLSGRLCRVSSSSLENMAEENNQSLHKKNNENNHVRILRDHMNPTRTSAPSCIVFPPNASHFNF
Ga0307508_1012493213300031616EctomycorrhizaMRVWSHTLSGRLCRVSSSFSENMVEEDNQSLHNKNNENNHVRTLRDHMNPIRTSASSCIVFPPDASHYNFKPDIIQLLPSFHGLDL
Ga0307508_1015356513300031616EctomycorrhizaMRIWTRTLSGRLSKKSSSSSENMAEEDNQSLHNENNRVRTLRDHINPTRTSAPSCIVFSPEASQEVDVIEDT
Ga0307508_1035793523300031616EctomycorrhizaMRVWSRTLSGRLCKVSSSFSENMTEEDYQSLHNENNENNRVRTLRDHMNPTRTSASSCIVFPLDASHFNFKSGIIQLLLSFHGLDLENPY
Ga0307508_1047231113300031616EctomycorrhizaMRVWLRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDAS
Ga0307508_1048399423300031616EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLPNENNENIRVRTLRDHMNPTRTSAPSCIVFPPD
Ga0307508_1052302213300031616EctomycorrhizaMRVWSCTLSGRLCKVSSSFLENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFP
Ga0307508_1053017313300031616EctomycorrhizaMRVWSRTLSGRLCRVCSSFSENMAEKDNQSLHNENNENNRVRTLRDHINLTRTSAPSCIVFPPDASLFNFKPDIIQLLPSFMA
Ga0307508_1056876813300031616EctomycorrhizaMRVWSRTLSGRLGRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKLGIIQLLPSFHG
Ga0307508_1081351313300031616EctomycorrhizaFSSYTCMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNF
Ga0307508_1087414313300031616EctomycorrhizaMRVWSRTLSGRLCRVSSSVSENMAEKDNQSPHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHGLD
Ga0307514_1003488323300031649EctomycorrhizaMRVWTRTLSGRLSRKSSSFSENMVEEDNQSLDDENNENNRVRTLRDHMNPTRTSAPSCIVFPHDAFHFNFKPDIIQLLATFMA
Ga0307514_1022995013300031649EctomycorrhizaMRVWSHTLSGRLCRVSSSFSENMVEEDNQSLHNKNNKNNHVRTLRDHMNPIRTSASSCIVFPPDASHYNFKPYI
Ga0307514_1038205813300031649EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQLLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFK
Ga0307514_1039302013300031649EctomycorrhizaMRVWSRILSGRHCRVSSSFSENMAKEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPP
Ga0307514_1044107213300031649EctomycorrhizaMSVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPARTSAPSCIVFPPDASHFNFKSG
Ga0307514_1052166713300031649EctomycorrhizaMRVWSHTLSGRLCRVSSSFLENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPSII
Ga0307514_1053155323300031649EctomycorrhizaMKVWSRTLSGRLCRVSSSFSENMAKEDNQLLHNENNENIRVRTLRDHMNPTRTSAPSCIVFRPDG
Ga0307514_1053642313300031649EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRIRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGII
Ga0307514_1058849613300031649EctomycorrhizaMRVWSRTLSGRLCRVSSLFPENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKP
Ga0307516_1009977763300031730EctomycorrhizaYTCMRVWSCTLSGRLCRVSSSFPESMAEKDNHSFYNENNRVRILRDHMNPTRTSALSCIVFPPDTSHFNFKPDIIQLLPSFHGLDL
Ga0307516_1018426133300031730EctomycorrhizaMRVWSRTLSGRLCRVSLSFSENMAEEDNHSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPLDASHFNFKPDIIQLLPSFHG
Ga0307516_1032963413300031730EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNF
Ga0307516_1038027313300031730EctomycorrhizaMRVWSRTLSGRLCRVSSSVSENMVEKDNQSPHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHGLD
Ga0307516_1054783113300031730EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMTEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDA
Ga0307516_1055764913300031730EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNKNNRVRTLRDHMNPTRTSAPSCIVFPPDAS
Ga0307516_1066585713300031730EctomycorrhizaMRVWSRTLSGRLCRVSSSFAENMVEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDAS
Ga0307516_1073964333300031730EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPNVSHFNFKSGIIQ
Ga0307516_1073965723300031730EctomycorrhizaMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENIQVRTLRDHMNPTRISAPSCIVFPPDASHFNFKPGII
Ga0307516_1077975813300031730EctomycorrhizaMRVWSRILSGRLCRVSSSFSENMAEEVNQSLHNENNENNRVRTLRDYMNPTRTSAPSCIVFPPDASHFNFKPDI
Ga0307516_1097699613300031730EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHG
Ga0307518_1002793713300031838EctomycorrhizaMRVWTRILSGRISRKSSFSLENMADEDNQSIHNENNENNRVRTLKDHMNPIRTSAPSCIVFPPNASHFNFKPGII
Ga0307518_1007422623300031838EctomycorrhizaMRVWSHTLSGRLCRVSSSFSENITEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVLSPYTSHFNFKPNIIQ
Ga0307518_1014825513300031838EctomycorrhizaVSFSFAFFFILFSSYTCMRVWSRTLSGRLCRVCSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNLTRTSAPSCIVFPPDASLFNFKPDIIQLLPSFMA
Ga0307518_1014892943300031838EctomycorrhizaVSNFVSFSFSFFLLLFSSYTCMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPIRTSALSCIVFLADASHFNFKSDIIQLLPSFMA
Ga0307518_1018784823300031838EctomycorrhizaMRVWSRTLSGRLSRKSSSFLENMAEEDNQTLHNENNVNNRVRTLRDYMNPTRTSAPSCIVFPPDASHFNFKP
Ga0307518_1027069023300031838EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSF
Ga0307518_1032465913300031838EctomycorrhizaMRVWSRTLSGRLCRVSSSVSENMAEKDNQSPHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPALFNFY
Ga0307518_1038229113300031838EctomycorrhizaMRVWSRILSGRLCRVSSSFSENMVEEDNQSLHNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQ
Ga0307518_1038231313300031838EctomycorrhizaMRVWSRTLSGRLCMVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSYIVFPPDASHFNFKPGIIQLLPCFHGLDLENP
Ga0307518_1044295513300031838EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKTGIIQLLPSFHGLD
Ga0307518_1044514313300031838EctomycorrhizaMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLYNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPG
Ga0307518_1048557913300031838EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPLDA
Ga0307518_1049384213300031838EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENTAEEDKQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNF
Ga0307518_1058154713300031838EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVSTLRDHMNPTRTSAPSCIVFPPDASHFNFKTGIIQLLPS
Ga0325403_100030993300032354XylemMRVWSRTLSGRLCRVSSSFSENIAEEDNQSFHNEKNENNRVRTLRDHMNPTRTSAPSCIVFSPNASHFNFKPGIIQLYLLFMA
Ga0325403_100133133300032354XylemMRVWSCTFSSRLCRVSSPFSENMAEEDNQSLYNENNRVRTLRDHMNPTRTSASSCIVFSPDASQFNFKPDIIQILLKFYLLFMA
Ga0325403_100147463300032354XylemMRVWSRILNGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVSLLMHLILILSQTLFNFYLLFMA
Ga0325403_101458023300032354XylemMRVWSRTLNGRFYRVSSSFSENMAEEDNQLFHNENNRVSTLRDHMNPTRTSAPSCIVLPLDASYFNFKPGIA
Ga0325403_1016304103300032354XylemMGVWSRTLSGKLCRVSSFFSENMAEEDNQSLHNENNRVRTLRDHMNLTRTSAPLCIVFPPDASHFNFKQGIIQLSPSFHGLDLEN
Ga0325403_101825373300032354XylemMRVWSCTLSARLCRVSSSFSENMAEEDNQSLHNENHENNRVRTLRDHMNPTRISAPSCIVFPPDASHFNFKPDIIQL
Ga0325403_102892923300032354XylemMCMRVWSCTLSGKICRVYSSFLENMVEEDNQSLHNENNRVKTLKNHMKPIRTSAPSCIVFPPNASHFNFKSDII
Ga0325403_103612413300032354XylemMTVWSRTLSGRLCRVSLSFLENMAEEDNQSLHNKNNENNCVRTLRYHMNPTRTSAPSCIGFPPDASYFNFKLGIIQFLPSFMA
Ga0325403_103682233300032354XylemMRVCSRTLNGRLCRVSSSFSENMAEEDNQSLPNEHNENNRVRTLRDHMNPTRTSAPLCMVFPPDASHFNFMPGIIQLLPSFHGLDL
Ga0325403_103695823300032354XylemMRAWSCTLSGRLCRVSSSFSKNMAENDNQSLHNENNENIRVRTQRDHMNPTRTSAPSCIVFPPDASHFILSQTLFNFYLFMA
Ga0325403_108828713300032354XylemMRVWSRTLSGRLCRVSSLFSENMVEEDNQLLHNKNNKNNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNLSQALFNFYLLFMAQI
Ga0325403_109162323300032354XylemFSFYTCMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLYNENNRVRTLRDHMNPTRTSTPSCIVFPPDASHFNF
Ga0325403_109779913300032354XylemMRVWSRTLSGRLCRVSSLFSVNMAEEDNQSLHNENNENNRVRTLRDHMNPIRTSAPSCIVFPSDASHFNFKRGVI
Ga0325403_110487513300032354XylemMRVWSRTLSGRLCRVSLSFSENMAKEDNQSLHMRIMRIFGLEHLENENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGI
Ga0325403_111510723300032354XylemMRVWSHTLSGRLCRVSSLFSEIMAEEDNQSLYNENNENNQVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFH
Ga0325403_112374023300032354XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQ
Ga0325403_113111423300032354XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNKNNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGII
Ga0325403_113252613300032354XylemMRVWSRTLSGRLCRVSSSFSENMTEEDNQSLHNENIQVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLL
Ga0325403_113793413300032354XylemMRVWSRTLSGRLCRVSSSFSENMAEKDNQSLHNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNF
Ga0325403_114139923300032354XylemYNCMRVWSRTLSDRLCRVSSSFSENMAEEDNQLLHNENNENIHVRSLRDHLNPTRTSAPSCIFFPPDTSHFNLSQPLFNFYLLFMA
Ga0325403_114160523300032354XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLLNENDENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQL
Ga0325403_114519813300032354XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENSENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLL
Ga0325403_115304613300032354XylemMRVWSCTLSGRLCRVSSLFSENMAKEDNQSLHNENNENNRVRTLKDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQ
Ga0325403_115442813300032354XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRILRDHMNPTRTSAPSCIVFPPDASHFNFKPGII
Ga0325403_116020913300032354XylemFSSCTCMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNKNIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGTWEKVKVE
Ga0325401_100645333300032355XylemVRVCTRTLSGRLSRKSSSFSENMAKKDNQSLHNENNRVRKLRDYMNLTRTSARSCIIFPPDASHFNFKLDII
Ga0325401_103659413300032355XylemMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFK
Ga0325401_104872213300032355XylemMRVWSRTLSGILCRVSSSFSENMAEEDNQSLHNENNLVRTLRDHMNPTRTSAPSCMVFSPDASHFNFNFSTYFRQILLKKKITTFT
Ga0325401_105442633300032355XylemMRVWSRTLSGRLCRLSSSFSENITEEDNQSLHNENSRVRTLRDHMNPTRTSAPLCIVFPPDASHFNFKPGIIQLLPSF
Ga0325401_105991323300032355XylemMRVWSRTLRGRLCRVSSSFSENIAEEDNQSLHNENNENNRVRILRDHMNPTRTSAPSCIVFPPNASHFNFKPSIIQLLP
Ga0325401_111761433300032355XylemYTCMRVWSRTLSGRLCRVSSLFSVNMAEEDNQSLHNENNENNRVRTLRDHMNPIRTSAPSCIVFPSDASHFNFKRGVI
Ga0325401_113185613300032355XylemMRVWSRTLSGRLCRVSLSFSENMAKEDNQSLHMRIMRIFGLEHLENENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGII
Ga0325401_113961113300032355XylemMRVWSRTLSGRLCRVSSSFSENMTEEDNQSLHNENIQVRTLRDHMNPTRTSAPSCIVFPPDASHFNFK
Ga0325401_114297823300032355XylemMRVWSCTLSGRLCRVSSLFSENMAEEDNQSLHNENNRVRTLRDHVNPTRTSAPLCIVFPPDASLFNFKPGIIQLLPSFHGLDLENPYLHEHHQIKAFSFFIKR
Ga0325401_114427313300032355XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPP
Ga0325401_115021313300032355XylemMRVWSRTLSDRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNLTRTSAPSCIVFPPDASHFNFKPGIIQLL
Ga0325401_124147113300032355XylemMRVWSRTLSGRLCRVSSSFLENMAEEDNQSLHNENNENIRLRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFH
Ga0325400_100156923300032374XylemMRVWSHTLSGRLCRVSSSFSKNMVEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCMVFPPDASYFNFKPGIIQLLPFFMA
Ga0325400_103477343300032374XylemMRVWSRILGGRLCRVSSSFSENMAKEDNQSLHNENNKNIRVRTHRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPSFHGLDL
Ga0325400_116865013300032374XylemMRVWSRTLSGRLCRVSLSFSENMAKEDNQSLHMRIMRIFGLEHLENENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHF
Ga0325400_123049723300032374XylemLSSRLCRVSSSFSENMAEEDNQSLHNGNNENIRVRTLRDHMNPTRTSAPSCIVFPLMHLILILSEALFNFYLLFMA
Ga0325400_130203623300032374XylemMRVWSRTLSGRLCRVSSLFLENIAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFP
Ga0325405_100853693300032389XylemMRVWSCTLSARLCRVSSSFSENMAEEDNQSLHNENHENNRVRTLRDHMNPTRISAPSCIVFPPDASHFNFKPGIIQL
Ga0325405_101769573300032389XylemMRVWSGTLSGRLCRVSSSFSENMAEEDNQLLHNENNHFRTLRDHMNPTRTSAPTCIVSPPDASHFNFKPDIIQLLPSFHGLDFKNPY
Ga0325405_103462533300032389XylemMTVWSRTLSGRLCRVSLSFLENMAEEDNQSLHNKNNENNCVRTLRYHINPTRTSAPSCIGFPPDTSHFNFKLGIIQFLPSFMA
Ga0325405_105825513300032389XylemMRVWTCTLCDRLSGKSSSFSENMAEEDNQSLHNKNNYVRILXDNMNPTRISAPSCIVFPPDASQEIDVIEDA
Ga0325405_106653923300032389XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNF
Ga0325405_110946113300032389XylemMRVWSRTLSGRLCRVSSLFLENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIV
Ga0325405_110969013300032389XylemMRVWSRTLSGRLCRVSSSFLENMTKEDDQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKLCIIQL
Ga0325405_111047313300032389XylemMRVWSRTLSGRLCRVSSLFSENVAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPD
Ga0325405_112434623300032389XylemMRVWSRTLSGRLCRVSSLFLENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDA
Ga0325405_112478913300032389XylemMRVWSRTLSGRLCRVSSLFLENMAEEDNQSLHNENNKNNRVRTLRDHMNLTRTSAPSCIVFPPDASHFNFKPGIIQLL
Ga0325405_112930813300032389XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENSENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQL
Ga0325405_113085513300032389XylemMRVWSHTLSGRLCRVSSLFSENMAEEDNQSLYNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQ
Ga0325404_100732383300032390XylemMRVWSHTLSGRLCRVSSSFSKNMVEDDNQSLHNENNKNNRVRILRDHMNPTRTSAPSCMVFPPDASYFNFKPGIIQLLPFFMA
Ga0325404_100888583300032390XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNKNNCVRTLRDYMNPIRISASSCIVSPPDASHFNFKPGIIQLLPSFHGLDLENP
Ga0325404_106130623300032390XylemMKIWSRILSGRLCRVSSSFSENMAEEDNQSLHNENIRVRTLKDHMNPTRTSAPSCIVFPPDASHFNFKSGIIQLLPSFMA
Ga0325404_108899813300032390XylemMRIWSRTLSGRLCKVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTRAPSCIVFPPDASHFNFKPGIIQL
Ga0325404_111670613300032390XylemMRVWSRTLSDRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNLTRTSAPSCIVFPP
Ga0325410_100618863300032735XylemMRVWSSTLSGRLCRVSSSFLENMVEEDNQSLHNENNRVRTLKDHMNPTRISAPSCVVFPPDASHENCVRDHS
Ga0325410_102008823300032735XylemMRVWTRALSGRLSRKSLFSLENMAEEDNQSIHNEDNENNHVRKLRDYMNPTRTSSPSCIVFPPDASHFNFKPGIFNFYPLFMA
Ga0325410_102133983300032735XylemMRVWSRTLSGRLCRVSLSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKP
Ga0325410_102948533300032735XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPNASHFNFKPGIIQLLPSFKY
Ga0325410_110215723300032735XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKP
Ga0325410_110892513300032735XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLYNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQ
Ga0325410_111847923300032735XylemMRVWSRTLSGRLCRVSSLFLENIAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDA
Ga0325411_100428063300032740XylemMRVWSHILSGRLSRKSLSSLENMVVEDNQLLYNDNNCLRTFRDHMNPIRTSALSCIVFPSNVSHLNFKIGSIKLFQLFMA
Ga0325411_109320613300032740XylemMRVWSRTLSGRLCRVFSLFSENIAEEDNQSLHNENNENNRVRILRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHGLD
Ga0325411_109567013300032740XylemMRVWSRTLSGRLCRVSSSFLENMVEEDNQSFHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDCNNPAF
Ga0325411_111674613300032740XylemMRVWSRTLNGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKSGIIQ
Ga0325414_1003221183300032741LeafVVRVWSHTLSDRLCRVSSLFSENMVEEDNQSLHNENNHVRTLRDHMNPTRTSTPLYIVLPPDASHFNFKLDII
Ga0325414_105506533300032741LeafLAPLPGRVWSHTLSGRLCKVSSSFSENMAEEDNQSLHNENNENIRVRILRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFYGLDL
Ga0325414_111707913300032741LeafMRVWSRTLSGRLCRVASLFSENMAEQDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGIIQLLPS
Ga0325414_113436023300032741LeafMRVWSRTLSGRLCRVSLLFSENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPLDASHFNFKPGIIQLLP
Ga0325414_113722013300032741LeafFSSCTCMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNKNIRVRTLRDHMNPTRTSAPSCIVFPPNASHFNFKPGTWEKVKVE
Ga0325414_114678613300032741LeafMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKP
Ga0325402_108578533300033160XylemMRVWSRTLSGRLCRVSSLFSENMVEEDNQLLHNKNNKNNRVRTLRDHMNPTRTSAPSCIVFSPDASHFNLSQTLFNFYLLFMAQI
Ga0325402_108991723300033160XylemMKIWSRILSGRLCRVSSSFSENMAEEDNQSLHNKNIRVRTLKDHMNPTRTSAPSCIVFPPDASHFNFKSGIIQLLPSFMA
Ga0325402_112350623300033160XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLL
Ga0325402_116256723300033160XylemMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGII
Ga0307507_1007774213300033179EctomycorrhizaMRVWSCTLSGRLCKVSSLFLENIAEEENQSLHNENNENNRVRTLRDHMNPTRTSAPSRIVFPPDASHFNFKPHIIQLLPSFHGL
Ga0307507_1008775923300033179EctomycorrhizaMRAWSRTLSGRLCRVSSSFSKNMVEEDNQSLHNEHNENNRVRTLRHHMNPTRTSAPSCIV
Ga0307507_1012333933300033179EctomycorrhizaMRVWTRTLSGRLSKKSSSSLENMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDTSQEVDVIEDT
Ga0307507_1021403913300033179EctomycorrhizaSGRLCRVSTSFSENMTEEDNQSLHNENNRVRTLRDHMNSIRTSAPSCIVFSPDASHFNFKSGIIQLYLLFMA
Ga0307507_1021811513300033179EctomycorrhizaMRVWSRTLSGRLCRVSSSFLENIIEEDNQSLHNENNENNRVRTLRDHMNLTRTSAPLCIVFPPDASHFNFKPGIIQLLPSFHGLDLENPYLHLRE
Ga0307507_1025509923300033179EctomycorrhizaMSRTLSGRLCRVSSSFSENIAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIIMTQIVA
Ga0307507_1029716013300033179EctomycorrhizaMRIWSHTLSGRLCRVSSSFSENMAEEDNQSLHNENNRVRTLRDYINPTRTSTPSSIVFPPDASHFNFKSDIIQLLPSFHDLDLEN
Ga0307507_1032173613300033179EctomycorrhizaMRVWTRTLNGRLSRKSSSFSENMAEKDNQSLHNENNRVRTLRDHMNPTRTSAPSCISFPPDASH
Ga0307507_1037923513300033179EctomycorrhizaMRVWSRTLSGKLCRASSSFSENMAEVDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPCNASHFNFKSDIIQFLSSFHVLDL
Ga0307507_1046666713300033179EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENIAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSYIVFPPHT
Ga0307507_1058317413300033179EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNLTRTSAPSCIVFPHNASHFNFKPDIIQLLPSFHGLDLENPYLH
Ga0307510_1002948283300033180EctomycorrhizaLFSSSILFSSYTCMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNEINRVKTLKDHMNPTRTSAPSCIVSPLMHLILILSQALFNFYLLFMA
Ga0307510_1007482043300033180EctomycorrhizaMCMRVWSRILSGRLCRVSSSFSENMAEEDNQSFHNENNRVRTLRDHMNPTRTSAPSCIVSPPDVSHFNFKPGIIQ
Ga0307510_1007593213300033180EctomycorrhizaMRVWSCTLNGRLCRVSSSFSENMAEEDNLSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFSLDASH
Ga0307510_1019340213300033180EctomycorrhizaMRVWSRTLSGKLCRASSSFSENMAEVDNQSLHNENNENSRVRTLRDHMNPTRTSAPSCIVFPSNASHFNFKSDIIQFLSSFHGLDL
Ga0307510_1028780713300033180EctomycorrhizaFLFVSFFFLPFYSLPKRSCTLSGRLCRVSSSFSENMAEEDNQSLYNENNRVRTLKDHMNPRRTSAPSCIVFPLMHLILILSHALFNFYLLFMT
Ga0307510_1032468213300033180EctomycorrhizaMRVCSRTLSGRLYRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRISAPSCIVSPPDASHFNFKPDIIQLL
Ga0307510_1034690813300033180EctomycorrhizaMKVWSRTLSGRLCRVSSSFSENMTEEDNQSLHNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNFKLGIIQLYLLFMA
Ga0307510_1047656113300033180EctomycorrhizaMRVWSRTLTGRLCRVSSSFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPD
Ga0307510_1048980423300033180EctomycorrhizaMRVWSRILSGRHCRVSSSFSENMAKKDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDAS
Ga0307510_1050861813300033180EctomycorrhizaMRVWTRTLNGRLSRKSSSFSENMVEEDNQSLHDENNENNRVRTLRDHMNPTRTSAPSCIVFPHDAFHFNFKPD
Ga0307510_1056068513300033180EctomycorrhizaMRVWSRTLSGRLCRVSSSFSENMAEKDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPIDASHFNFKTGIIQLLPSFH
Ga0307510_1056180013300033180EctomycorrhizaMRVWSRTLSGRLCRVSSSFLESMAEEDNQSLHNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHF
Ga0325419_010303_3294_35423300034389LeafMRAWSCTLSGRLCRVSSSFSKNMAENDNQSLHNENNENIRVRTQRDHMNPTRTSAPSCIVFPPDASHFILSQALFNFYLFMA
Ga0325419_088018_2_2113300034389LeafMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPIRTSAPSCIVFPPDASHFNF
Ga0325419_109843_429_6743300034389LeafMRVWSRILSGRLCRVSSSFSENMAEEDNQSLHNENNKNIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPGTWEKVKVE
Ga0325420_049126_444_6833300034688LeafMRVWSRTLRGRLCRVSSSFSENIAEEDNQSLHNENNENNRVRILRDHMNAIRTSAPSCIVFPPNASHFNFKPSIIQLLP
Ga0325420_061927_1155_13733300034688LeafMRVWTCTLCDRLSGKSSSFSENMAEEDNQSLHNKNNYVRILWDNMNPTRISAPSCIVFPPDASQEIDVIEDA
Ga0325420_130122_2_2323300034688LeafMRVWSRTLSGRLCRVSSSFLENMTKEDDQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNLKLGIIQL
Ga0325421_009092_5681_59263300034689LeafMHESLVTYIKCRLYRVSSSFSENMTEENNQLFHNENNRVRILRDHMNPTRTSAPSCIVFPPNASHFNFKPGIIQLLPSFMA
Ga0325421_055861_1944_21353300034689LeafMTVWSRTLSGRLCRVSLSFLENMAEEDNQSLHNKNNENNCVRTLRYHINPTRTSAPSCIGFPPD
Ga0325421_096173_740_9823300034689LeafMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIWVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKLGIIQLLPSF
Ga0325423_138409_274_5013300034778LeafMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLYNENNENNRVRTLRDHINPTRTSAPSCIVFPPDASHFNFKPGIIQ
Ga0325407_095063_734_9823300034899XylemMRMWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNENIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPDIIQLLPSFHG
Ga0325407_131095_365_5923300034899XylemMRVWSRTLSGRLCRVSSLFSENMAEEDNQSLHNENNENNRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPNIIQ
Ga0325407_145305_3_2213300034899XylemMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENIRVRTLRDHMNPTRTSAPLCIVFPPDASHFNFKPGIIQ
Ga0325409_018693_697_9153300034901XylemMRVWTRTLCDRLSGKSSSSSENMAEEDNQSLYNENNYVRIPWDNMNLTRISAPSCIVFPPDASQEIDVIEDA
Ga0325409_133043_271_5043300034901XylemMRVWSRTLSGRLCRVSSSFSENMAEEDNQSLHNENNKNIRVRTLRDHMNPTRTSAPSCIVFPPDASHFNFKPSIIQLL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.