NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F015328

Metagenome / Metatranscriptome Family F015328

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015328
Family Type Metagenome / Metatranscriptome
Number of Sequences 255
Average Sequence Length 40 residues
Representative Sequence KGGTSGILFSAADFQSPGDRSVVSGDTLNVTYTFSLDAA
Number of Associated Samples 176
Number of Associated Scaffolds 255

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.40 %
% of genes near scaffold ends (potentially truncated) 97.25 %
% of genes from short scaffolds (< 2000 bps) 87.45 %
Associated GOLD sequencing projects 161
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (47.843 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(21.569 % of family members)
Environment Ontology (ENVO) Unclassified
(46.275 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(48.627 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 255 Family Scaffolds
PF13884Peptidase_S74 1.57
PF13385Laminin_G_3 0.78
PF07603DUF1566 0.39
PF13539Peptidase_M15_4 0.39
PF09926DUF2158 0.39
PF01583APS_kinase 0.39
PF02945Endonuclease_7 0.39
PF137592OG-FeII_Oxy_5 0.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 255 Family Scaffolds
COG0529Adenylylsulfate kinase or related kinaseInorganic ion transport and metabolism [P] 0.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.16 %
UnclassifiedrootN/A47.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2222084011|2225757717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage716Open in IMG/M
3300000405|LV_Brine_h2_0102DRAFT_1058866Not Available635Open in IMG/M
3300000929|NpDRAFT_10265878All Organisms → cellular organisms → Eukaryota937Open in IMG/M
3300000973|BBAY93_10116035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300001533|MLSed_10350987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300001842|RCM30_1004913Not Available510Open in IMG/M
3300001849|RCM26_1016718Not Available1796Open in IMG/M
3300001849|RCM26_1176894Not Available573Open in IMG/M
3300002138|M3t6FKB1_1130871All Organisms → Viruses → Predicted Viral1046Open in IMG/M
3300002195|metazooDRAFT_1229155Not Available984Open in IMG/M
3300002197|metazooDRAFT_1232397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage940Open in IMG/M
3300002203|metazooDRAFT_1300173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300002408|B570J29032_109040025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300004240|Ga0007787_10085749All Organisms → cellular organisms → Bacteria → Proteobacteria1455Open in IMG/M
3300005585|Ga0049084_10060506All Organisms → Viruses → Predicted Viral1407Open in IMG/M
3300005912|Ga0075109_1239834Not Available551Open in IMG/M
3300005913|Ga0075108_10013677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3184Open in IMG/M
3300005917|Ga0075115_10087166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1143Open in IMG/M
3300006030|Ga0075470_10023990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1889Open in IMG/M
3300006641|Ga0075471_10477690Not Available619Open in IMG/M
3300006802|Ga0070749_10025999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3679Open in IMG/M
3300006802|Ga0070749_10183993Not Available1202Open in IMG/M
3300006802|Ga0070749_10284653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage930Open in IMG/M
3300006802|Ga0070749_10781368Not Available507Open in IMG/M
3300006805|Ga0075464_10456367Not Available780Open in IMG/M
3300006916|Ga0070750_10140493Not Available1098Open in IMG/M
3300006920|Ga0070748_1178817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300006953|Ga0074063_12946851Not Available984Open in IMG/M
3300007346|Ga0070753_1101264Not Available1125Open in IMG/M
3300007346|Ga0070753_1103468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1110Open in IMG/M
3300007363|Ga0075458_10025563All Organisms → Viruses → Predicted Viral1878Open in IMG/M
3300007519|Ga0105055_11245451Not Available518Open in IMG/M
3300007538|Ga0099851_1042192All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Yonathbacteria1806Open in IMG/M
3300007538|Ga0099851_1065843All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1408Open in IMG/M
3300007538|Ga0099851_1148225Not Available874Open in IMG/M
3300007538|Ga0099851_1168795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage808Open in IMG/M
3300007539|Ga0099849_1015435Not Available3361Open in IMG/M
3300007540|Ga0099847_1135462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300007540|Ga0099847_1177048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300007542|Ga0099846_1076999Not Available1242Open in IMG/M
3300007722|Ga0105051_10332180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1142Open in IMG/M
3300007960|Ga0099850_1122669Not Available1060Open in IMG/M
3300007960|Ga0099850_1174952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage854Open in IMG/M
3300007960|Ga0099850_1217618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300007972|Ga0105745_1114347All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300007974|Ga0105747_1118459Not Available837Open in IMG/M
3300008055|Ga0108970_11697081Not Available635Open in IMG/M
3300008072|Ga0110929_1061554All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage918Open in IMG/M
3300008107|Ga0114340_1045932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1933Open in IMG/M
3300008120|Ga0114355_1086931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1270Open in IMG/M
3300008266|Ga0114363_1040756Not Available2302Open in IMG/M
3300009037|Ga0105093_10504654Not Available674Open in IMG/M
3300009082|Ga0105099_10319794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage913Open in IMG/M
3300009085|Ga0105103_10306380Not Available866Open in IMG/M
3300009151|Ga0114962_10549426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300009152|Ga0114980_10799760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300009155|Ga0114968_10203272Not Available1147Open in IMG/M
3300009161|Ga0114966_10756413Not Available527Open in IMG/M
3300009165|Ga0105102_10003886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales5318Open in IMG/M
3300009165|Ga0105102_10403019Not Available727Open in IMG/M
3300009165|Ga0105102_10618470Not Available600Open in IMG/M
3300009170|Ga0105096_10664949All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon550Open in IMG/M
3300009182|Ga0114959_10236037Not Available933Open in IMG/M
3300009187|Ga0114972_10327686Not Available900Open in IMG/M
3300009194|Ga0114983_1086558Not Available700Open in IMG/M
3300009504|Ga0114946_10183632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1135Open in IMG/M
3300009504|Ga0114946_10704723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. CFD-1506Open in IMG/M
3300010157|Ga0114964_10406959All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300010160|Ga0114967_10534038Not Available570Open in IMG/M
3300010334|Ga0136644_10596508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300010354|Ga0129333_10211657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1760Open in IMG/M
3300010354|Ga0129333_10296644Not Available1447Open in IMG/M
3300010354|Ga0129333_10316094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1395Open in IMG/M
3300010354|Ga0129333_10515075Not Available1047Open in IMG/M
3300010354|Ga0129333_10670650Not Available894Open in IMG/M
3300010368|Ga0129324_10266427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300010370|Ga0129336_10174429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1233Open in IMG/M
3300010370|Ga0129336_10399031Not Available751Open in IMG/M
3300010370|Ga0129336_10521125Not Available639Open in IMG/M
3300010885|Ga0133913_10285944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4373Open in IMG/M
3300011010|Ga0139557_1045504Not Available754Open in IMG/M
3300011010|Ga0139557_1068499Not Available594Open in IMG/M
3300012352|Ga0157138_1001757All Organisms → Viruses → Predicted Viral3814Open in IMG/M
3300012352|Ga0157138_1004715Not Available2306Open in IMG/M
3300012533|Ga0138256_11455246Not Available500Open in IMG/M
3300012666|Ga0157498_1008708All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax1633Open in IMG/M
3300012666|Ga0157498_1032426Not Available807Open in IMG/M
3300012728|Ga0157552_1271445All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage613Open in IMG/M
3300013004|Ga0164293_10088560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2401Open in IMG/M
3300013004|Ga0164293_10689009Not Available656Open in IMG/M
3300013065|Ga0157547_129807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300013087|Ga0163212_1233580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
(restricted) 3300013128|Ga0172366_10150788All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1518Open in IMG/M
(restricted) 3300013129|Ga0172364_10599833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
(restricted) 3300013133|Ga0172362_10823290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
(restricted) 3300013137|Ga0172375_10185558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1635Open in IMG/M
(restricted) 3300014720|Ga0172376_10292616Not Available977Open in IMG/M
3300014962|Ga0134315_1053847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300015050|Ga0181338_1008000Not Available1766Open in IMG/M
3300015050|Ga0181338_1053918Not Available584Open in IMG/M
3300017701|Ga0181364_1043429Not Available713Open in IMG/M
3300017716|Ga0181350_1008386All Organisms → Viruses → Predicted Viral2968Open in IMG/M
3300017716|Ga0181350_1085753Not Available791Open in IMG/M
3300017716|Ga0181350_1087431Not Available781Open in IMG/M
3300017716|Ga0181350_1148340Not Available548Open in IMG/M
3300017722|Ga0181347_1063129Not Available1101Open in IMG/M
3300017722|Ga0181347_1102961Not Available813Open in IMG/M
3300017722|Ga0181347_1118113Not Available744Open in IMG/M
3300017723|Ga0181362_1026777Not Available1231Open in IMG/M
3300017736|Ga0181365_1013254All Organisms → Viruses → Predicted Viral2058Open in IMG/M
3300017736|Ga0181365_1024825Not Available1511Open in IMG/M
3300017747|Ga0181352_1002192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7277Open in IMG/M
3300017747|Ga0181352_1047873Not Available1250Open in IMG/M
3300017747|Ga0181352_1050019All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1218Open in IMG/M
3300017747|Ga0181352_1086624Not Available871Open in IMG/M
3300017754|Ga0181344_1067206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1059Open in IMG/M
3300017754|Ga0181344_1112705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300017754|Ga0181344_1170161Not Available618Open in IMG/M
3300017754|Ga0181344_1193551Not Available572Open in IMG/M
3300017766|Ga0181343_1018826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2148Open in IMG/M
3300017766|Ga0181343_1127895Not Available712Open in IMG/M
3300017774|Ga0181358_1249985Not Available558Open in IMG/M
3300017774|Ga0181358_1277199Not Available518Open in IMG/M
3300017777|Ga0181357_1063822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1423Open in IMG/M
3300017777|Ga0181357_1116762Not Available1003Open in IMG/M
3300017778|Ga0181349_1011044Not Available3756Open in IMG/M
3300017778|Ga0181349_1143921Not Available861Open in IMG/M
3300017780|Ga0181346_1027430Not Available2372Open in IMG/M
3300017780|Ga0181346_1335628Not Available504Open in IMG/M
3300017784|Ga0181348_1005788All Organisms → cellular organisms → Bacteria5444Open in IMG/M
3300017784|Ga0181348_1191037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300017785|Ga0181355_1005964All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5379Open in IMG/M
3300017785|Ga0181355_1117185Not Available1092Open in IMG/M
3300017785|Ga0181355_1128523Not Available1033Open in IMG/M
3300017785|Ga0181355_1203315Not Available777Open in IMG/M
3300017785|Ga0181355_1234772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300017785|Ga0181355_1313684Not Available585Open in IMG/M
3300017963|Ga0180437_10680764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300019783|Ga0181361_109382Not Available761Open in IMG/M
3300019784|Ga0181359_1237213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300020084|Ga0194110_10249683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1293Open in IMG/M
3300020084|Ga0194110_10394990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage937Open in IMG/M
3300020161|Ga0211726_10332691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300020172|Ga0211729_10024546Not Available748Open in IMG/M
3300020190|Ga0194118_10485188All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300020197|Ga0194128_10115340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1621Open in IMG/M
3300020205|Ga0211731_10313936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14821Open in IMG/M
3300020221|Ga0194127_10764472Not Available599Open in IMG/M
3300020550|Ga0208600_1051318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
3300020553|Ga0208855_1030611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage750Open in IMG/M
3300021519|Ga0194048_10291757Not Available589Open in IMG/M
3300021958|Ga0222718_10106270Not Available1646Open in IMG/M
3300021961|Ga0222714_10274398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage935Open in IMG/M
3300021961|Ga0222714_10278765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage926Open in IMG/M
3300021962|Ga0222713_10817099Not Available519Open in IMG/M
3300022176|Ga0212031_1038695Not Available788Open in IMG/M
3300022190|Ga0181354_1061465All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1248Open in IMG/M
3300022190|Ga0181354_1205416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300022190|Ga0181354_1210751Not Available573Open in IMG/M
3300022190|Ga0181354_1236506Not Available527Open in IMG/M
3300022200|Ga0196901_1027297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2248Open in IMG/M
3300022407|Ga0181351_1170903Not Available759Open in IMG/M
3300022843|Ga0222631_1017965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1091Open in IMG/M
3300022844|Ga0222687_1031503Not Available1080Open in IMG/M
3300022865|Ga0222668_1036612Not Available741Open in IMG/M
3300022874|Ga0222685_1092990Not Available534Open in IMG/M
3300023256|Ga0222703_1021627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1268Open in IMG/M
3300023297|Ga0222640_1112588Not Available556Open in IMG/M
3300024179|Ga0247695_1071858Not Available516Open in IMG/M
3300024352|Ga0255142_1023390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage987Open in IMG/M
3300024509|Ga0255175_1022512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1266Open in IMG/M
3300024557|Ga0255283_1109663Not Available591Open in IMG/M
3300025283|Ga0208048_1110127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300025445|Ga0208424_1048142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300025585|Ga0208546_1030976Not Available1315Open in IMG/M
3300025635|Ga0208147_1076628Not Available829Open in IMG/M
3300025645|Ga0208643_1097391Not Available811Open in IMG/M
3300025646|Ga0208161_1034073All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1764Open in IMG/M
3300025646|Ga0208161_1141431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300025647|Ga0208160_1029147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1683Open in IMG/M
3300025647|Ga0208160_1048261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1219Open in IMG/M
3300025655|Ga0208795_1079071All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage913Open in IMG/M
3300025655|Ga0208795_1094720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage808Open in IMG/M
3300025687|Ga0208019_1137916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage702Open in IMG/M
3300025698|Ga0208771_1191906Not Available548Open in IMG/M
3300025848|Ga0208005_1052419All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300025872|Ga0208783_10180900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage881Open in IMG/M
3300025889|Ga0208644_1013661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5388Open in IMG/M
3300025896|Ga0208916_10305153Not Available693Open in IMG/M
3300027121|Ga0255074_1016281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage961Open in IMG/M
3300027126|Ga0255098_1005048All Organisms → Viruses → Predicted Viral2671Open in IMG/M
3300027145|Ga0255114_1040984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
3300027365|Ga0209300_1055623Not Available651Open in IMG/M
3300027608|Ga0208974_1091781Not Available819Open in IMG/M
3300027608|Ga0208974_1107762Not Available738Open in IMG/M
3300027732|Ga0209442_1016916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3441Open in IMG/M
3300027733|Ga0209297_1210833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300027747|Ga0209189_1252561All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
3300027764|Ga0209134_10139952Not Available834Open in IMG/M
3300027785|Ga0209246_10034626All Organisms → Viruses → Predicted Viral1926Open in IMG/M
3300027798|Ga0209353_10352636Not Available614Open in IMG/M
3300027804|Ga0209358_10014559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5101Open in IMG/M
3300027808|Ga0209354_10079486Not Available1333Open in IMG/M
(restricted) 3300027977|Ga0247834_1076522All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1609Open in IMG/M
3300031565|Ga0307379_10355343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1422Open in IMG/M
3300031565|Ga0307379_10916604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage757Open in IMG/M
3300031566|Ga0307378_10350880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1373Open in IMG/M
3300031566|Ga0307378_10522440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1059Open in IMG/M
3300031566|Ga0307378_10571948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage998Open in IMG/M
3300031566|Ga0307378_10662725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium904Open in IMG/M
3300031673|Ga0307377_10205554Not Available1530Open in IMG/M
3300031784|Ga0315899_10337986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1479Open in IMG/M
3300031787|Ga0315900_10141326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2247Open in IMG/M
3300031787|Ga0315900_11001855Not Available549Open in IMG/M
3300031857|Ga0315909_10779790Not Available608Open in IMG/M
3300031951|Ga0315904_10623108Not Available923Open in IMG/M
3300031951|Ga0315904_10777042All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300031951|Ga0315904_10928282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300031951|Ga0315904_11168957Not Available594Open in IMG/M
3300031952|Ga0315294_11593520Not Available506Open in IMG/M
3300031963|Ga0315901_10426008All Organisms → Viruses → Predicted Viral1056Open in IMG/M
3300031963|Ga0315901_10636299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300032018|Ga0315272_10582562Not Available563Open in IMG/M
3300032050|Ga0315906_11158644Not Available565Open in IMG/M
3300032092|Ga0315905_10016133All Organisms → Viruses7557Open in IMG/M
3300032093|Ga0315902_10840313Not Available718Open in IMG/M
3300032116|Ga0315903_10063145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3696Open in IMG/M
3300032116|Ga0315903_10531323Not Available921Open in IMG/M
3300032116|Ga0315903_10618202Not Available828Open in IMG/M
3300032116|Ga0315903_10667400Not Available784Open in IMG/M
3300032177|Ga0315276_10866236Not Available965Open in IMG/M
3300032275|Ga0315270_10662050Not Available681Open in IMG/M
3300033418|Ga0316625_100172532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1373Open in IMG/M
3300033984|Ga0334989_0333691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300034012|Ga0334986_0543203Not Available563Open in IMG/M
3300034062|Ga0334995_0044712Not Available3667Open in IMG/M
3300034062|Ga0334995_0094159Not Available2290Open in IMG/M
3300034062|Ga0334995_0339315Not Available967Open in IMG/M
3300034062|Ga0334995_0555474Not Available677Open in IMG/M
3300034066|Ga0335019_0188600All Organisms → Viruses → Predicted Viral1340Open in IMG/M
3300034066|Ga0335019_0588417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300034103|Ga0335030_0284043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1115Open in IMG/M
3300034103|Ga0335030_0326472All Organisms → Viruses → Predicted Viral1019Open in IMG/M
3300034104|Ga0335031_0104385All Organisms → Viruses → Predicted Viral1995Open in IMG/M
3300034104|Ga0335031_0330999Not Available980Open in IMG/M
3300034104|Ga0335031_0439200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage809Open in IMG/M
3300034110|Ga0335055_0326015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300034122|Ga0335060_0391542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300034122|Ga0335060_0468647Not Available654Open in IMG/M
3300034166|Ga0335016_0536926All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300034272|Ga0335049_0281064All Organisms → Viruses → Predicted Viral1134Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake21.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater6.67%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.71%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.53%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.75%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.75%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater2.35%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water2.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.96%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.57%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.57%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.57%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake1.18%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.18%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.18%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.18%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.78%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.78%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.78%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.39%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.39%
Coastal LagoonEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon0.39%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.39%
BenthicEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic0.39%
Water BodiesEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies0.39%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.39%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.39%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline0.39%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.39%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.39%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.39%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.39%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.39%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2222084011Coastal lagoon microbial communities from Albufera, Spain - Sample 1EnvironmentalOpen in IMG/M
3300000405Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micronEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001533Benthic freshwater microbial communities from British Columbia, CanadaEnvironmentalOpen in IMG/M
3300001842Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2bEnvironmentalOpen in IMG/M
3300001849Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2bEnvironmentalOpen in IMG/M
3300002138M3t6FKB1 (102f)EnvironmentalOpen in IMG/M
3300002195Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013EnvironmentalOpen in IMG/M
3300002197Freshwater microbial communities from San Paulo Zoo lake, Brazil - DEC 2012EnvironmentalOpen in IMG/M
3300002203Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005912Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKDEnvironmentalOpen in IMG/M
3300005913Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1EnvironmentalOpen in IMG/M
3300005917Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKHEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007519Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008072Microbial Communities in Water bodies, Singapore - Site MAEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300009504Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep SedimentEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300012352Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37EnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300012728Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013065Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES037 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300019783Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022843Saline water microbial communities from Ace Lake, Antarctica - #5EnvironmentalOpen in IMG/M
3300022844Saline water microbial communities from Ace Lake, Antarctica - #1163EnvironmentalOpen in IMG/M
3300022865Saline water microbial communities from Ace Lake, Antarctica - #728EnvironmentalOpen in IMG/M
3300022874Saline water microbial communities from Ace Lake, Antarctica - #1077EnvironmentalOpen in IMG/M
3300023256Saline water microbial communities from Ace Lake, Antarctica - #1506EnvironmentalOpen in IMG/M
3300023297Saline water microbial communities from Ace Lake, Antarctica - #187EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024509Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8dEnvironmentalOpen in IMG/M
3300024557Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025283Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes)EnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025698Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027126Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300027145Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027365Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)EnvironmentalOpen in IMG/M
3300027531Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22251674912222084011Coastal LagoonTSDNTKGGTSGILFSASTFQSPGARTVVSGDTLNVTYEFSLDAA
LV_Brine_h2_0102DRAFT_105886613300000405HypersalineTTGILFSAGDFTAPGDRSVIDGDTINVTYQFSLDAQ*
NpDRAFT_1026587833300000929Freshwater And MarineGTAGTLFSAADFGSPGDRSVVSSDTLSVTYTFSLAG*
BBAY93_1011603533300000973Macroalgal SurfaceSDNTKGGTSGILFSAADFSSPGDRSVVSGDVINVTYTFSLDAA*
MLSed_1035098733300001533BenthicSNSTKGGTTGVLFSAADFQAPGDRSVANGDTLNVTYQFSLDAA*
RCM30_100491313300001842Marine PlanktonISNSTKSGTTGTLFSASDFQSPGDRTVASGDTLNVTYTFSLTAT*
RCM26_101671833300001849Marine PlanktonSGTTGTLFSAADFQSPGDRSVVSGDVLTVTYTFSLSA*
RCM26_117689433300001849Marine PlanktonGGSGVLFSASDFTSPGDRVVASGDTLNVTYTFSLTAA*
M3t6FKB1_113087113300002138MarineGSAKSGTAGTLFSAADFSSPGDRAVTSGDTLNVTYTMSLAG*
metazooDRAFT_122915533300002195LakeTGLLFSVASFEAPGDRSVVSGDTLNVTYEFTLSDA*
metazooDRAFT_123239733300002197LakeGTSGILFSVASYQAPGARTVVSGDTLNVTYQFSLDAA*
metazooDRAFT_130017313300002203LakeTKGGTTGTLYSAADFSAPGDRSVVNGDTLTVTYTLSLAG*
B570J29032_10904002533300002408FreshwaterAFLASVATGSSGILFSASDFQSPGDRVVVAGDTLNVTYTFSLDAA*
Ga0007787_1008574943300004240Freshwater LakeGAFLTSGSAKGGTTGTLFSAADFQSPGDRSVVSGDILLVTYTFSLSA*
Ga0049084_1006050643300005585Freshwater LenticTSNNTVGGSTGTLFSAADFGSPGDRSVVNSDILTVTYTLSLAG*
Ga0075109_123983413300005912Saline LakeNNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA*
Ga0075108_1001367713300005913Saline LakeGTAGVLFSAADFASPGDRSVVSGDTLTVTYTYSQTAT*
Ga0075115_1008716613300005917Saline LakeKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA*
Ga0075470_1002399013300006030AqueousVSNSTAGGSTGTLFSAADFQSPGDRSVVSGDTLNVTYSFSLAG*
Ga0075471_1047769023300006641AqueousGAFLASAASGTSGTLFSAADFQSPGDRSVVSGDVLTVSYTFSLSA*
Ga0070749_1002599953300006802AqueousGVLFSVSTFQSPGARSVVSGDTLNVTYEFSLDAA*
Ga0070749_1018399313300006802AqueousTKSGTTGVLFSASDFSSPGDRSVVSGDTLNVTYTFSLDAA*
Ga0070749_1028465313300006802AqueousKGGTSGVLFSAADFASPGDRAVVSGDTINVTYTFSLDAA*
Ga0070749_1078136823300006802AqueousTTGTLFSAADFSSPGDRSVVSGDIISVTYTFSLAA*
Ga0075464_1045636723300006805AqueousTSGSAKSGTTGTLFSAAAFGSPGDRSVVNSDTLSVTYTFSLAG*
Ga0070750_1014049313300006916AqueousSVDTGTSGILFSVSNFQSPGDRTVANGDTLNVTYTFSLDAA*
Ga0070748_117881713300006920AqueousTLNTGILFSVADFDAPGSRSVVSGDTLNVRYDFSLADA*
Ga0074063_1294685123300006953SoilTGTLFSASDLQSPGDRNVSGGDVINVTYRFELTAT*
Ga0070753_110126423300007346AqueousFLCSVTSGTSGVLFSAGDFTGGDKSVDSGDTLSVTYQFSLDAA*
Ga0070753_110346833300007346AqueousGSTGTLFSAADFTGGDRSVASGDTLNVTYTLSLAG*
Ga0075458_1002556313300007363AqueousAFLTSNNTILGTTGTLFSAADFQSPGDRSVVSGDVISVTYEFRLTAT*
Ga0105055_1124545113300007519FreshwaterKNGTTGTLFSAADFGSPGDRSVVSGDSLAVTYTFSLAG*
Ga0099851_104219213300007538AqueousTKSGTTGILFSASDFQAPGDRVVTSGDILNVTYTFNLAAV*
Ga0099851_106584313300007538AqueousTGVLFSASDFAAPGDRSVASGDTLNITYQFSLDAA*
Ga0099851_114822513300007538AqueousTGTLFSAKDFSSPGDRNVVSGDVVLVTYTFSLAG*
Ga0099851_116879533300007538AqueousISNNTKGGTTGVLFSAADFQSPGDRAVVSGDIINVTYQFSLDAA*
Ga0099849_101543513300007539AqueousSTKSGTTGILFSASDFTSPGDRSVVSGDTINVTYTFSLAAT*
Ga0099847_113546213300007540AqueousNNTKGGTTGVLFSAADFQSPGDRSVVSGDIINVTYQFSLDAA*
Ga0099847_117704813300007540AqueousSNSTAGGSTGTLFSAADFQSPGDRNVVSGDTLNVTYTFSLAG*
Ga0099846_107699913300007542AqueousKGGSAGVLFSAADFASPGDRSVVSGDTLVVSYTFSLDAA*
Ga0105051_1033218033300007722FreshwaterGVLFSASDFAAPGDRNVTSGDTITISYEFSLDAA*
Ga0099850_112266933300007960AqueousLTSDNTKSGTSGILFSASDFASPGDRSVVSGDTINVTYTFNLDAA*
Ga0099850_117495213300007960AqueousNTKGGTSGILFSAADFQSPGDRSVVSGDTLNVTYTFSLDAA*
Ga0099850_121761833300007960AqueousTSGVLFSVSNFQSPGDRDVVSGDTLNVTYEFSLDAA*
Ga0105745_111434733300007972Estuary WaterSVATGTSGILFSASDFQSPGDRVVVSGDTLNVTYTFSLDAA*
Ga0105747_111845923300007974Estuary WaterSGVLFSGSDFTGGDKSVASGDTLNVTYTFSLTAT*
Ga0108970_1169708113300008055EstuaryTKGGTTGTLFSAADFSAPGDRSVVSGDILNVTYTFSLSA*
Ga0110929_106155433300008072Water BodiesTKGGTSGTLFSAADFAAPGDRSVVSGDTLNVTYTFSLDAA*
Ga0114340_104593233300008107Freshwater, PlanktonTVSSGTSGVLFSEADFQSPGDRTVVSGDTLNVTYTFSLDAA*
Ga0114355_108693113300008120Freshwater, PlanktonNTKGGTVGTLLSAGNFTVGDRAVVNGDTINVTYTFSADAT*
Ga0114363_104075613300008266Freshwater, PlanktonKGGTTGTLFSVANFQSPGDRSVINGDTLSVTYTFNLDAA*
Ga0105093_1050465413300009037Freshwater SedimentICTVASGTSGILFSEADFDSPGDRNVVNGDTLNVSYTFSLDAA*
Ga0105099_1031979413300009082Freshwater SedimentNTKSGTAGVLFSASDFAAPGDRNVSSGDTIQITYTFSLDAA*
Ga0105103_1030638013300009085Freshwater SedimentSDNTKSGSTGVLFSASDFAAPGDRSVASGDTLAVTYTFSLDAA*
Ga0114962_1054942613300009151Freshwater LakeTGILFSASDFASPGDRVVASGDTLNVTYTFSLTAT*
Ga0114980_1079976033300009152Freshwater LakeLVSNSTKGGSTGTLFSASDFQSPGDRAVVNGDTLNVTYQFSLTAT*
Ga0114968_1020327213300009155Freshwater LakeNGTTGVLFSASDFSAPGDRVVASGDTLNVTYTFSLTAT*
Ga0114966_1075641313300009161Freshwater LakeTGTLFSAADSGSPGDRSVVSSDTLSVTYTFSLAG*
Ga0105102_1000388613300009165Freshwater SedimentTTGVLFSVANFAAPGDRAVVSGDTLNVTYTFSLDAA*
Ga0105102_1040301913300009165Freshwater SedimentGILFSAGDFASPGDRSVVSGDTLTLTYTFSLDAA*
Ga0105102_1061847023300009165Freshwater SedimentCSVTSGTSGILFCAADFTSPRAVESGDTLEVTYTLSAADDGA*
Ga0105096_1066494913300009170Freshwater SedimentTGTLFSAADFQAPGDRSVVSGDTLNVTYTFSLDAA*
Ga0114959_1023603723300009182Freshwater LakeGFLTSGSAKSGIVGTLFSASDFTAPGDRAVVSGDILNVTYTLSLAG*
Ga0114972_1032768613300009187Freshwater LakeSGSAKSGTTGTLFSAADFGSPGDRSVVSSDTLSVTYTFSLAG*
Ga0114983_108655813300009194Deep SubsurfaceTKSGTTGVLFSASDFAAPGDRSVASGDQLNVTYTFSLDAA*
Ga0114946_1018363213300009504SedimentTSDDTKGGTAGVLFSVANFAAPGDRAVVSGDTLNVTYTFSLDAV*
Ga0114946_1070472323300009504SedimentGGTAGVLFSVANFAAPGDRAVVSGDTLNVSYSFSLDAV*
Ga0114964_1040695913300010157Freshwater LakeNSTKSGTTGILFSASDFASPGDRVVASGDTLNVTYTFSLTAT*
Ga0114967_1053403823300010160Freshwater LakeKSGTTGTLFSAADFGSPGDRSVVSSDTLSVTYTFSLAG*
Ga0136644_1059650813300010334Freshwater LakeNSTKSGTTGTLFSASDFQSPGDRPVVSGDTLNVTYQFSLTAT*
Ga0129333_1021165713300010354Freshwater To Marine Saline GradientTGTLFSAADFSSPGDRSVVSGDTLNVTYTMSLSG*
Ga0129333_1029664413300010354Freshwater To Marine Saline GradientTSGTLFSASDFTGGDRSVVNGDTLQVTYTFSLAA*
Ga0129333_1031609423300010354Freshwater To Marine Saline GradientGTSGILFSEGAFSSVRNVVNGDTLNVTYSLSNNAA*
Ga0129333_1051507513300010354Freshwater To Marine Saline GradientSNSTKGGSTGTLFSEASFSSPGNRSVVSGDTLNVTYTFSLS*
Ga0129333_1067065033300010354Freshwater To Marine Saline GradientTSVAAKSPGNTGILFSAADFQSPGDRSVVNGDTLTVTYTFSLDAA*
Ga0129324_1026642733300010368Freshwater To Marine Saline GradientTSGTSGILFSAGDFTGGDKIVAATDTINVTYTFSADAV*
Ga0129336_1017442913300010370Freshwater To Marine Saline GradientTTGTLFSASDFQSPGDRSVVNGDTLTVTYTFSLDAA*
Ga0129336_1039903133300010370Freshwater To Marine Saline GradientGGAFLISDNTKGGSAGVLFSAADFASPGDRAVVSGDVIQVTYTFSLDAI*
Ga0129336_1052112513300010370Freshwater To Marine Saline GradientSSNTKGGTTGTLFSAGDFAAPGDRAVVAGDTLTLTYTFSLDAA*
Ga0133913_1028594413300010885Freshwater LakeVNTKSGVTGVMYSAADFSSPGDRAVVSGDTLTVTYTLSLAG*
Ga0139557_104550413300011010FreshwaterTAGTLYSAADFSAPGDRAVTNGDVLNVVYTLSLAG*
Ga0139557_106849913300011010FreshwaterTAGTLFSAADFGSPGDRSVVASDTLAVTYTFSLAA*
Ga0157138_100175753300012352FreshwaterNSGVLFSAGDFTGGDKSVASGDTLNVTYQFSLDAA*
Ga0157138_100471533300012352FreshwaterGVLFSASDFQSPGDRTVVSGDTLNVTYTFSLDAA*
Ga0138256_1145524633300012533Active SludgeGAFLISNSTKGGTTGILFSASDNQSPGDRSVILNDTVNVTYTFNLDAA*
Ga0157498_100870843300012666Freshwater, Surface IceTGTLFSAADFQAPGDRAVVSGDVLNVAYSFSLSA*
Ga0157498_103242613300012666Freshwater, Surface IceFLTTGDSPGGSSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA*
Ga0157552_127144513300012728FreshwaterSTGTLYSAADFSSPGDRSVVSGDTLTVTYTLSLAG*
Ga0164293_1008856013300013004FreshwaterVDTGTSGILFSASDFQSPGDRSVVNGDVLNVTYTFNLDAA*
Ga0164293_1068900913300013004FreshwaterKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA*
Ga0157547_12980713300013065FreshwaterGGVTGIMFSASDFQSPGDRSVVSGDTLNVTYQFSLTAT*
Ga0163212_123358033300013087FreshwaterDNTKSGTSGILFSASDFQSPGDRAVVSGDTLNVTYTFSLDAT*
(restricted) Ga0172366_1015078813300013128SedimentGTSGVLFSEAEFEAPGDRAVVSGDILNVKYTFSLADA*
(restricted) Ga0172364_1059983333300013129SedimentGTLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA*
(restricted) Ga0172362_1082329013300013133SedimentTSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA*
(restricted) Ga0172375_1018555843300013137FreshwaterGAFLTSDNTILGTTGTLFSAADFQSPGDRSVVSGDVISCTYEFRLSA*
(restricted) Ga0172376_1029261613300014720FreshwaterSNDTKGGTTGTLFSEKAFSSPGDRSVVSGDVISVTYTFSLAG*
Ga0134315_105384713300014962Surface WaterGGTSGILFSASDFQSPGDRNVVSGDTLTVTYTFSLDAV*
Ga0181338_100800013300015050Freshwater LakeFLTSGSAKSGTAGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAG*
Ga0181338_105391823300015050Freshwater LakeGGTEGNLISEDDFGAPGDRSVVDSDTLSVTYTFSLAA*
Ga0181364_104342913300017701Freshwater LakeSGTAGVLFSESDFTSPGDRTVVSGDTLNVTYTFSLDAA
Ga0181350_100838633300017716Freshwater LakeVASGTSGTLFSAADFSAPGDRAVTSGDTLNVTYTMSLAG
Ga0181350_108575323300017716Freshwater LakeGTAGTLFSAADFGSPGDRAVVNSDTLSVTYTFSLAG
Ga0181350_108743113300017716Freshwater LakeTSGSAKSGTAGTLFSAADFGSPGDRAVVTSDTLSVTYTFSLAG
Ga0181350_114834013300017716Freshwater LakeSGTTGTLFSAADFGSPGDRNVVNSDTLSVTYTFSLAA
Ga0181347_106312913300017722Freshwater LakeSGTAGTLFSAADFGAPGDRSVVNSDTLSVTYTFSLAG
Ga0181347_110296123300017722Freshwater LakeAFLTSGSAKSGTAGTLFSASDFTSPGDRSVTSGDTLNVTYTLSLAG
Ga0181347_111811313300017722Freshwater LakeKSGTTGTLFSAADFGSPGDRSVVSSDTLSVTYTFSLAG
Ga0181362_102677733300017723Freshwater LakeGTAGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0181365_101325433300017736Freshwater LakeTSGSAKSGTAGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAG
Ga0181365_102482513300017736Freshwater LakeTKGGSTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0181352_100219233300017747Freshwater LakeAGGSTGTLFSAADFQSPGDRSVVSGDTLNVTYTFSLAG
Ga0181352_104787313300017747Freshwater LakeSGTLFSEADFESPGDRVVVAGDTLNVTYTFSLDAA
Ga0181352_105001913300017747Freshwater LakeTSNNTVGGSTGTLFSAADFGAPGDRSVANADVLTVTYTLSLAG
Ga0181352_108662433300017747Freshwater LakeLTNVATGTTGLLFSESDFQSPGDRTVVSGDVLLVTYSFNLDAT
Ga0181352_119310733300017747Freshwater LakeVGGAFLTNNSTVSGTAGTLYSAADFSAPGDRAVTNGDVLNVVYTLSLAG
Ga0181344_106720633300017754Freshwater LakeSGTSGTLFSASDFQSPGDRVVVSGDTLNVTYTFSLDAA
Ga0181344_111270513300017754Freshwater LakeSTKLGTTGILFSAADFQAPGDRNVTSGDTLNVTYTFSLDAA
Ga0181344_117016123300017754Freshwater LakeNVASGTSGILFSASDFQSPGDRAVVNGDVLVVTYTFNLDAT
Ga0181344_119355123300017754Freshwater LakeSGTLFSASDFQSPGDRVVVSGDTLNVTYTFSLDAA
Ga0181343_101882643300017766Freshwater LakeAFLCSAASGTSGTLFSAADFSSPGDRSVVSGDTLNVTYTLSLAG
Ga0181343_112789523300017766Freshwater LakeVASGTSGVLFSEANFTSPGDRNVANGDTLNVVYTFSLTAT
Ga0181358_124998513300017774Freshwater LakeKGGFTGTLFSAADFQSPGDRTVVSGDTLNVTYTFSLTAT
Ga0181358_127719923300017774Freshwater LakeGGAFLVGGTGSSTKGGTTGTLFSAADFGSPGDRSVVTSDTLSVTYTFSLAG
Ga0181357_106382213300017777Freshwater LakeKSGTAGTLFSASDFTSPGDRAVTSGDTLNVTYTMSLAG
Ga0181357_111676223300017777Freshwater LakeGSAKSGTAGTLFSAADFGAPGDRSVVASDTLSVTYTFSLAA
Ga0181349_100573713300017778Freshwater LakeINATATVGGAFLCSVNSGTSPGVLFSAADFGSPGDRNVVNSDTLSVTYTFSLAP
Ga0181349_101104453300017778Freshwater LakeLTSNNTVGGSTGTLFSAADFGSPGDRSVVNSDILTVTYTLSLAG
Ga0181349_114392123300017778Freshwater LakeTTGTLFSAADFGAPGDRSVVTSDTLSVTYTFSLAA
Ga0181346_102743043300017780Freshwater LakeTSGSAKSGTAGTLFSAADFGSPGDRAVVNSDTLSVTYTFSLAA
Ga0181346_133562823300017780Freshwater LakeLCSVSSGPGGVLFSESNFQSPGDRITVSGDVLNVTYSFSLAAV
Ga0181348_100578813300017784Freshwater LakeTVGGAFLCSVNTGTGGTLFSEADFGSPGDRSVVNSDTLSVTYTFSLAP
Ga0181348_119103723300017784Freshwater LakeFLTSGSAKSGTAGTLFSASDFTSPGDRSVVSGDTINVTYTMSLAG
Ga0181355_100596483300017785Freshwater LakeGTSPGTRFSEAEFGGAGDRSVVSSDTLSVTDSFSLAP
Ga0181355_111718513300017785Freshwater LakeNGTVGTLFSAADFQAPGDRSVVNGDILNVTYQFSLSATA
Ga0181355_112852333300017785Freshwater LakeSGTSGVLFSESDFQAPGDRTVVSGDTLNVTYTFSLDAA
Ga0181355_120331513300017785Freshwater LakeTSGSAKSGTAGTLFSAADFGAPGDRSVVSSDTLSVTYTFSLAA
Ga0181355_123477233300017785Freshwater LakeLISSNTKGGTTGVLFSAADFQSPGDKTVVNGDTLTCTYTFSLDAA
Ga0181355_131368413300017785Freshwater LakeNTKGGTTGTLFSAADFQSPGDRSVVSGDVLNVTYQFSLTA
Ga0180437_1068076433300017963Hypersaline Lake SedimentPGGTSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA
Ga0181361_10938213300019783Freshwater LakeSGSVKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0181359_123721333300019784Freshwater LakeTSSNTKSGTTGTLFSAVDFSAPGDRAVVANDTVTVTYTFSLDAA
Ga0194110_1024968333300020084Freshwater LakeSGILFSVAAFEAPGDRSVVAGDTLNVTYQFSLADA
Ga0194110_1039499013300020084Freshwater LakeSGILFSASDFQSPGDRAVVSGDTLNVTYQFSLDAA
Ga0211726_1033269133300020161FreshwaterGTSGILFSASDFQSPGDRAVVAGDTLNVTYTFSLDAA
Ga0211729_1002454613300020172FreshwaterKSGSTGTLFSASDFSAPGDRSVVSGDTINVTYTFSLDAA
Ga0194118_1048518833300020190Freshwater LakeITGTSGILFSVSSFQSPGARAVVSGDTLSVTYQFSLDAA
Ga0194128_1011534013300020197Freshwater LakeGTSGILFSASDFQSPGDRAVVSGDTLNVTYQFSLDAA
Ga0211731_10313936173300020205FreshwaterLTNVATGTSGLLFSESDFQSPGDRTVVSGDVLLVTYSFNLDAT
Ga0194127_1076447233300020221Freshwater LakePGDLPGGTSGTLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA
Ga0208600_105131833300020550FreshwaterSGILFSASDFQSPGDRAVVAGDTLSVTYTFSLDAA
Ga0208855_103061113300020553FreshwaterVDTGTSGILFSASDFQSPGDRAVVAGDTLSVTYTFSLDAA
Ga0194048_1029175713300021519Anoxic Zone FreshwaterKNGTTGVLFSASDFSSPGDRVVASGDTLNVTYTFSLTAT
Ga0222718_1010627033300021958Estuarine WaterLTSDNTKSGTSGILFSASDFASPGDRSVVSGDTINVTYTFNLDAA
Ga0222714_1027439833300021961Estuarine WaterTKGGTSGVLFSAADFASPGDRSVVSGDTVNVTYTFSLDAA
Ga0222714_1027876513300021961Estuarine WaterTTGILFSAADFSSPGDRAVVSGDTLSVTYTFSLDAA
Ga0222713_1081709913300021962Estuarine WaterGTTGLLFSESDFQSPGDRTVVSGDVLLVTYSFNLDAT
Ga0212031_103869523300022176AqueousSVNSGSSGVLFSANNFSGGDKSVDSGDTLSVTYQFSLDAA
Ga0181354_106146513300022190Freshwater LakeLTSSNTKSGTTGTLFSAVDFSAPGDRAVVANDTVTVTYTFSLDAA
Ga0181354_120541613300022190Freshwater LakeGGTTGTLFSAADFSAPGDRVVESGDTLNVTYTLNLAG
Ga0181354_121075133300022190Freshwater LakeTSGTLFSASDFAAPGDRTVQNGDVLSVTYTFSLDAA
Ga0181354_123650613300022190Freshwater LakeTNSTKSGTTGTLFSAADFQSPGDRAVVNGDTLTVTYTFSLTAT
Ga0196901_102729713300022200AqueousKSGTTGILFSASDFTSPGDRSVVSGDTINVTYTFSLAAT
Ga0181351_117090313300022407Freshwater LakeKSGTAGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0222631_101796513300022843Saline WaterLINNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA
Ga0222687_103150313300022844Saline WaterLINNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLNAV
Ga0222668_103661223300022865Saline WaterGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA
Ga0222685_109299013300022874Saline WaterINNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA
Ga0222703_102162713300023256Saline WaterNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLNAV
Ga0222640_111258823300023297Saline WaterNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA
Ga0247695_107185823300024179SoilGGTSGKLITAGLFSSPGDRSVVSGDTLNVSWTGSL
Ga0255142_102339033300024352FreshwaterTKGGSTGTLFSASDFTSPGDRSVVSGDTLNVTYTFSLDAV
Ga0255175_102251233300024509FreshwaterCTVASGTSGILFSVANFQSPGDRAVVSGDTLNVTYTFNLDAV
Ga0255283_110966313300024557FreshwaterKSGTSGVLFSASDFAAPGDRTVASGDVLNVTYTFSLDA
Ga0208048_111012713300025283FreshwaterDNTKSGTSGILFSASDFQSPGDRAVVSGDTLNVTYTFSLDAT
Ga0208424_104814233300025445AqueousTSGTTGVLFSAADFQSPGDRTVVSGDTLTVTYTFSLDAV
Ga0208546_103097613300025585AqueousASGTSGTLFSAADFQSPGDRSVVSGDVLTVSYTFSLSA
Ga0208147_107662813300025635AqueousTSGTLFSEADFQSPGDRVVVSGDTLNVTYTFSLDAA
Ga0208643_109739113300025645AqueousTKSGTAGTLFSAGNFTVGDRSVVTGDTLNVTYTFSADAA
Ga0208161_103407313300025646AqueousLTSDSTKSGTSGILFSAADFQSPGDRTVVNGDTLNVTYQFSLDAA
Ga0208161_114143113300025646AqueousNTKGGTSGILFSAADFQSPGDRSVVSGDTLNVTYTFSLDAA
Ga0208160_102914733300025647AqueousGTTGTLFSAADFASPGDRTVASGDTLNVSYTFSLDAA
Ga0208160_104826133300025647AqueousCSVTSGTSGVLFSAGDFTGGDKSVDSGDTLSVTYQFSLDAA
Ga0208795_107907113300025655AqueousFLISNNTKSGTTGILFSAADFQSPGDRSVVSGDIINVTYVFSLDAA
Ga0208795_109472033300025655AqueousISNNTKGGTTGVLFSAADFQSPGDRAVVSGDIINVTYQFSLDAA
Ga0208019_113791613300025687AqueousKGGTSGILFSAADFQSPGDRSVVSGDTLNVTYTFSLDAA
Ga0208771_119190623300025698Saline LakeNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA
Ga0208005_105241933300025848AqueousGGAFLASAASGTSGTLFSAADFQSPGDRSVVSGDVLTVSYTFSLSA
Ga0208783_1018090013300025872AqueousLVSNSTAGGSTGTLFSAADFQSPGDRSVVSGDTLNVTYTFSLAG
Ga0208644_101366173300025889AqueousFLCNVQDNTSTSGLLFSVSSFTGGDRSVVNGDTLNVTYEFSLDAA
Ga0208916_1030515313300025896AqueousTGTSGILFSGSDFTGGDKSVASGDTLNVTYTFSLTAT
Ga0255074_101628113300027121FreshwaterTGTSGILFSASDFQSPGDRVVVSGDTLNVTYTFSLDAA
Ga0255098_100504813300027126FreshwaterSTGTLFSAKAFTGGARSVISGDTLNVTYTFSLTGT
Ga0255114_104098413300027145FreshwaterASGTSGILFSESDFQSPGDRVVVSGDTLNVTYTFSLDAA
Ga0209300_105562333300027365Deep SubsurfaceNNTKSGTTGVLFSASDFAAPGDRSVASGDQLNVTYTFSLDAA
Ga0208682_114479723300027531EstuarineNSTKGGTTGTLYSAADFSAPGDRSVASSDILNVTYTLSLAG
Ga0208974_109178113300027608Freshwater LenticDSPGGSSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA
Ga0208974_110776213300027608Freshwater LenticLTSGSVKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0208951_116513013300027621Freshwater LenticAFLTNNSTVSGTAGTLYSAADFSAPGDRSVTNGDVLNVVYTLSLAG
Ga0209442_101691653300027732Freshwater LakeKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0209297_121083333300027733Freshwater LakeTSNNTKSGTTGTLFSASDFAAPGDRVVASGDTLNVTYTFSLDAA
Ga0209189_125256113300027747Freshwater LakeSNSTKSGTTGTLFSASDFQSPGDRSVVSGDTLNVTYQFSLTAT
Ga0209134_1013995213300027764Freshwater LakeTATVGGAFLTSSSPKTPNSGFDAGTLFSAADFGSPGDRSVVSGDTLSVTYTFSLAA
Ga0209246_1003462613300027785Freshwater LakeLTSGSAKSGTTGTLFSAADFGSPGDRSVVASDTLSVTYTFSLAG
Ga0209353_1035263623300027798Freshwater LakeGTAGILFSESDFTAPGDRTVVSGDTLNVTYTFSLDAA
Ga0209358_1001455963300027804Freshwater LakeTKAGTTGTLFSAADFQAPGDRAVVSGDILNVTYQFSLSA
Ga0209354_1007948613300027808Freshwater LakeGGAFLTSGSAKGGTAGTLFSAADFGAPGDRSVVASDTLAVTYTFSLAA
(restricted) Ga0247834_107652213300027977FreshwaterSGTTGVLFSASDFTAPGDRVVASGDVLNVSYTFSLAG
Ga0307379_1035534343300031565SoilNNTKGGTSGVLFSAADFASPGDRSVVSGDTINVTYTFSLDAA
Ga0307379_1091660433300031565SoilTSGILFSAADFSSPGDRAVVSGDTLNVTYEFSLDAA
Ga0307378_1035088013300031566SoilSSGVLFSESDFQSPGDRTVVSGDTLNVTYTFSLDAA
Ga0307378_1052244033300031566SoilTGILFSVAAFEVPGDRSVVDGDTLNVTYQFSLTDA
Ga0307378_1057194843300031566SoilVDTGTSGVLFSVSSFQAPGDRSVVSGDTLSVTYEFSADAA
Ga0307378_1066272513300031566SoilTKGGSAGVLFSAADFASPGDRNVASGDTLIVTYTFSLDAA
Ga0307377_1020555413300031673SoilGTTGILFSASDFSSPGDRSVVSGDSVNVTYTFSLDAA
Ga0315899_1033798633300031784FreshwaterAFLCTVSSGTSGVLFSEADFQSPGDRVVVAGDTLNVTYTFSLDAA
Ga0315900_1014132653300031787FreshwaterTKGGTSGILFSASDFQSPGDRSVVNGDTLTVTYTFSLDAA
Ga0315900_1100185513300031787FreshwaterVGGAFLTSNNTILGTTGTLFSAADFQAPGDRSVVSGDVLSVTYTFSLDGTP
Ga0315909_1077979023300031857FreshwaterVGGAFLTSDNTILGTTGTLFSAADFQSPGDRSVVSGDVISVTYEFRLTAT
Ga0315904_1062310823300031951FreshwaterTGTLFSAGDFQAPGDRSVVSGDVINLTYQFSLDAA
Ga0315904_1077704213300031951FreshwaterSAASGTSGTLFSAADFQAPGDRSVVNGDTLTVTYTFSLSA
Ga0315904_1092828223300031951FreshwaterSGTSGTLFSASDFTGGDRSVVNGDTLQVTYTFSLSA
Ga0315904_1116895713300031951FreshwaterAKGGTTGTLFSAADFQSPFDRSVVSGDILLVTYTFSLSA
Ga0315294_1159352023300031952SedimentNVSTGTSGVLFAEGDFTGGDKSVTIGDTLAVTYTFSLTS
Ga0315901_1042600813300031963FreshwaterSSGTSGVLFSEADFQLPGDRVVVAGDTLNVTYTFSLDAA
Ga0315901_1063629923300031963FreshwaterTGGILFSEADFQSPGDRSVQSGDILNVAYTFSLAAS
Ga0315272_1058256213300032018SedimentGTAGTLFSAADFGAPGDRAVVNSDTVSVTYTFSLAG
Ga0315906_1115864423300032050FreshwaterTVASGTSGVLFSEADFQSPGDRTVVSGDTLNVTYTFSLDAA
Ga0315905_1001613393300032092FreshwaterLTSGSAKSGTTGTLFSAADFGAPGDRSVVTSDTLSVTYTFSLAA
Ga0315902_1084031313300032093FreshwaterTVGGAFLVGGTGSSTKGGSTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0315903_1006314573300032116FreshwaterLTNVASGTTGLLFSESDFQSPGDRTVVSGDVLLVTYSFNLDAT
Ga0315903_1053132313300032116FreshwaterLTSGSAKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0315903_1061820213300032116FreshwaterGAFLTSGSAKNGTTGTLFSAADFSAPGDRSVVSGDIISVTYTFSLAG
Ga0315903_1066740033300032116FreshwaterPGGSSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA
Ga0315276_1086623613300032177SedimentGAFLTTGSAKSGTAGTLFSAADFGAPGDRAVVNSDTVSVTYTFSLAG
Ga0315270_1066205033300032275SedimentKSGTTGVLFSASDFQSPGDRSVASGDTLNVTYQFSLDAV
Ga0316625_10017253213300033418SoilTSGVLFSENTFNSPGDRTVVSGDTLNVTYEFSLNAV
Ga0334989_0333691_666_7973300033984FreshwaterLTSVATGTSGILFSASDFQSPGDRAVVAGDTLSVTYTFSLDAA
Ga0334986_0543203_2_1093300034012FreshwaterSGVLFSESDFQSPGDRVVVAGDTLNVTYTFSLDAA
Ga0334995_0044712_2_1333300034062FreshwaterTSNDTKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0334995_0094159_2156_22903300034062FreshwaterLTSNDTKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA
Ga0334995_0339315_835_9663300034062FreshwaterLCTVASGTSGVLFSESDFQSPGDRVVVSGDTLNVTYTFSLDAA
Ga0334995_0555474_349_4833300034062FreshwaterMTSDNTKNGTTGILYSAADFGAPGDRSVASGDVLTVTYTLSLAG
Ga0335019_0188600_1206_13403300034066FreshwaterTSGDLPGGSSGTLFSASDFAAPGDRTVQNGDVLSVTYTFSLDAA
Ga0335019_0588417_514_6513300034066FreshwaterAFLASVATGTSGILFSESDFQAPGDRAVVSGDVLNVTYQFSLDAA
Ga0335030_0284043_1_1263300034103FreshwaterSTKSGTTGILFSASDFQSPGDRTVASGDVLNVTYTFSLTAT
Ga0335030_0326472_898_10173300034103FreshwaterTKGGSTGTLFSAADFQAPGDRSVVSGDILNVTYTFSLSA
Ga0335031_0104385_1842_19943300034104FreshwaterIGGAFLTSSNTKGGGTGTLFSAADFAAPGDRSVVSGDVLVLTYTFSLDAA
Ga0335031_0330999_860_9793300034104FreshwaterTKGGSTGTLFSAADFSAPGDRSVVSGDILNVTYTFSLAG
Ga0335031_0439200_1_1203300034104FreshwaterKGGTTGTLFSAADFSAPGDRTVANGDTLNVTYTFSLDAA
Ga0335055_0326015_538_6483300034110FreshwaterTSGILFSASDFQSPGDRAVVAGDTLSVTYTFSLDAA
Ga0335060_0391542_613_7353300034122FreshwaterVATGTSGILFSASDFQSPGDRAVVSGDTLNVTYTFSLDAT
Ga0335060_0468647_543_6533300034122FreshwaterSSGTLFSASDFAAPGDRTVQNGDVLSVTYTFSLDAA
Ga0335016_0536926_169_2973300034166FreshwaterMCSVASGTSGTLFSASDFTGGDRSVGNGDTLQVTYTFSLAAA
Ga0335049_0281064_1008_11333300034272FreshwaterDLPGGSSGTLFSASDFAAPGDRTVQNGDVLSVTYTFSLDAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.