Basic Information | |
---|---|
Family ID | F015328 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 255 |
Average Sequence Length | 40 residues |
Representative Sequence | KGGTSGILFSAADFQSPGDRSVVSGDTLNVTYTFSLDAA |
Number of Associated Samples | 176 |
Number of Associated Scaffolds | 255 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.40 % |
% of genes near scaffold ends (potentially truncated) | 97.25 % |
% of genes from short scaffolds (< 2000 bps) | 87.45 % |
Associated GOLD sequencing projects | 161 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (47.843 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.569 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.275 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.627 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 255 Family Scaffolds |
---|---|---|
PF13884 | Peptidase_S74 | 1.57 |
PF13385 | Laminin_G_3 | 0.78 |
PF07603 | DUF1566 | 0.39 |
PF13539 | Peptidase_M15_4 | 0.39 |
PF09926 | DUF2158 | 0.39 |
PF01583 | APS_kinase | 0.39 |
PF02945 | Endonuclease_7 | 0.39 |
PF13759 | 2OG-FeII_Oxy_5 | 0.39 |
COG ID | Name | Functional Category | % Frequency in 255 Family Scaffolds |
---|---|---|---|
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.16 % |
Unclassified | root | N/A | 47.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2222084011|2225757717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300000405|LV_Brine_h2_0102DRAFT_1058866 | Not Available | 635 | Open in IMG/M |
3300000929|NpDRAFT_10265878 | All Organisms → cellular organisms → Eukaryota | 937 | Open in IMG/M |
3300000973|BBAY93_10116035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300001533|MLSed_10350987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300001842|RCM30_1004913 | Not Available | 510 | Open in IMG/M |
3300001849|RCM26_1016718 | Not Available | 1796 | Open in IMG/M |
3300001849|RCM26_1176894 | Not Available | 573 | Open in IMG/M |
3300002138|M3t6FKB1_1130871 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
3300002195|metazooDRAFT_1229155 | Not Available | 984 | Open in IMG/M |
3300002197|metazooDRAFT_1232397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300002203|metazooDRAFT_1300173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300002408|B570J29032_109040025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300004240|Ga0007787_10085749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
3300005585|Ga0049084_10060506 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
3300005912|Ga0075109_1239834 | Not Available | 551 | Open in IMG/M |
3300005913|Ga0075108_10013677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3184 | Open in IMG/M |
3300005917|Ga0075115_10087166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300006030|Ga0075470_10023990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1889 | Open in IMG/M |
3300006641|Ga0075471_10477690 | Not Available | 619 | Open in IMG/M |
3300006802|Ga0070749_10025999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3679 | Open in IMG/M |
3300006802|Ga0070749_10183993 | Not Available | 1202 | Open in IMG/M |
3300006802|Ga0070749_10284653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
3300006802|Ga0070749_10781368 | Not Available | 507 | Open in IMG/M |
3300006805|Ga0075464_10456367 | Not Available | 780 | Open in IMG/M |
3300006916|Ga0070750_10140493 | Not Available | 1098 | Open in IMG/M |
3300006920|Ga0070748_1178817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300006953|Ga0074063_12946851 | Not Available | 984 | Open in IMG/M |
3300007346|Ga0070753_1101264 | Not Available | 1125 | Open in IMG/M |
3300007346|Ga0070753_1103468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
3300007363|Ga0075458_10025563 | All Organisms → Viruses → Predicted Viral | 1878 | Open in IMG/M |
3300007519|Ga0105055_11245451 | Not Available | 518 | Open in IMG/M |
3300007538|Ga0099851_1042192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Yonathbacteria | 1806 | Open in IMG/M |
3300007538|Ga0099851_1065843 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1408 | Open in IMG/M |
3300007538|Ga0099851_1148225 | Not Available | 874 | Open in IMG/M |
3300007538|Ga0099851_1168795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300007539|Ga0099849_1015435 | Not Available | 3361 | Open in IMG/M |
3300007540|Ga0099847_1135462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300007540|Ga0099847_1177048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300007542|Ga0099846_1076999 | Not Available | 1242 | Open in IMG/M |
3300007722|Ga0105051_10332180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
3300007960|Ga0099850_1122669 | Not Available | 1060 | Open in IMG/M |
3300007960|Ga0099850_1174952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300007960|Ga0099850_1217618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300007972|Ga0105745_1114347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300007974|Ga0105747_1118459 | Not Available | 837 | Open in IMG/M |
3300008055|Ga0108970_11697081 | Not Available | 635 | Open in IMG/M |
3300008072|Ga0110929_1061554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300008107|Ga0114340_1045932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
3300008120|Ga0114355_1086931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1270 | Open in IMG/M |
3300008266|Ga0114363_1040756 | Not Available | 2302 | Open in IMG/M |
3300009037|Ga0105093_10504654 | Not Available | 674 | Open in IMG/M |
3300009082|Ga0105099_10319794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300009085|Ga0105103_10306380 | Not Available | 866 | Open in IMG/M |
3300009151|Ga0114962_10549426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300009152|Ga0114980_10799760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300009155|Ga0114968_10203272 | Not Available | 1147 | Open in IMG/M |
3300009161|Ga0114966_10756413 | Not Available | 527 | Open in IMG/M |
3300009165|Ga0105102_10003886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 5318 | Open in IMG/M |
3300009165|Ga0105102_10403019 | Not Available | 727 | Open in IMG/M |
3300009165|Ga0105102_10618470 | Not Available | 600 | Open in IMG/M |
3300009170|Ga0105096_10664949 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 550 | Open in IMG/M |
3300009182|Ga0114959_10236037 | Not Available | 933 | Open in IMG/M |
3300009187|Ga0114972_10327686 | Not Available | 900 | Open in IMG/M |
3300009194|Ga0114983_1086558 | Not Available | 700 | Open in IMG/M |
3300009504|Ga0114946_10183632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
3300009504|Ga0114946_10704723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. CFD-1 | 506 | Open in IMG/M |
3300010157|Ga0114964_10406959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300010160|Ga0114967_10534038 | Not Available | 570 | Open in IMG/M |
3300010334|Ga0136644_10596508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300010354|Ga0129333_10211657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1760 | Open in IMG/M |
3300010354|Ga0129333_10296644 | Not Available | 1447 | Open in IMG/M |
3300010354|Ga0129333_10316094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
3300010354|Ga0129333_10515075 | Not Available | 1047 | Open in IMG/M |
3300010354|Ga0129333_10670650 | Not Available | 894 | Open in IMG/M |
3300010368|Ga0129324_10266427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300010370|Ga0129336_10174429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
3300010370|Ga0129336_10399031 | Not Available | 751 | Open in IMG/M |
3300010370|Ga0129336_10521125 | Not Available | 639 | Open in IMG/M |
3300010885|Ga0133913_10285944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4373 | Open in IMG/M |
3300011010|Ga0139557_1045504 | Not Available | 754 | Open in IMG/M |
3300011010|Ga0139557_1068499 | Not Available | 594 | Open in IMG/M |
3300012352|Ga0157138_1001757 | All Organisms → Viruses → Predicted Viral | 3814 | Open in IMG/M |
3300012352|Ga0157138_1004715 | Not Available | 2306 | Open in IMG/M |
3300012533|Ga0138256_11455246 | Not Available | 500 | Open in IMG/M |
3300012666|Ga0157498_1008708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 1633 | Open in IMG/M |
3300012666|Ga0157498_1032426 | Not Available | 807 | Open in IMG/M |
3300012728|Ga0157552_1271445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300013004|Ga0164293_10088560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2401 | Open in IMG/M |
3300013004|Ga0164293_10689009 | Not Available | 656 | Open in IMG/M |
3300013065|Ga0157547_129807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300013087|Ga0163212_1233580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10150788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1518 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10599833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10823290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10185558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1635 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10292616 | Not Available | 977 | Open in IMG/M |
3300014962|Ga0134315_1053847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300015050|Ga0181338_1008000 | Not Available | 1766 | Open in IMG/M |
3300015050|Ga0181338_1053918 | Not Available | 584 | Open in IMG/M |
3300017701|Ga0181364_1043429 | Not Available | 713 | Open in IMG/M |
3300017716|Ga0181350_1008386 | All Organisms → Viruses → Predicted Viral | 2968 | Open in IMG/M |
3300017716|Ga0181350_1085753 | Not Available | 791 | Open in IMG/M |
3300017716|Ga0181350_1087431 | Not Available | 781 | Open in IMG/M |
3300017716|Ga0181350_1148340 | Not Available | 548 | Open in IMG/M |
3300017722|Ga0181347_1063129 | Not Available | 1101 | Open in IMG/M |
3300017722|Ga0181347_1102961 | Not Available | 813 | Open in IMG/M |
3300017722|Ga0181347_1118113 | Not Available | 744 | Open in IMG/M |
3300017723|Ga0181362_1026777 | Not Available | 1231 | Open in IMG/M |
3300017736|Ga0181365_1013254 | All Organisms → Viruses → Predicted Viral | 2058 | Open in IMG/M |
3300017736|Ga0181365_1024825 | Not Available | 1511 | Open in IMG/M |
3300017747|Ga0181352_1002192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7277 | Open in IMG/M |
3300017747|Ga0181352_1047873 | Not Available | 1250 | Open in IMG/M |
3300017747|Ga0181352_1050019 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1218 | Open in IMG/M |
3300017747|Ga0181352_1086624 | Not Available | 871 | Open in IMG/M |
3300017754|Ga0181344_1067206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
3300017754|Ga0181344_1112705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300017754|Ga0181344_1170161 | Not Available | 618 | Open in IMG/M |
3300017754|Ga0181344_1193551 | Not Available | 572 | Open in IMG/M |
3300017766|Ga0181343_1018826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2148 | Open in IMG/M |
3300017766|Ga0181343_1127895 | Not Available | 712 | Open in IMG/M |
3300017774|Ga0181358_1249985 | Not Available | 558 | Open in IMG/M |
3300017774|Ga0181358_1277199 | Not Available | 518 | Open in IMG/M |
3300017777|Ga0181357_1063822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1423 | Open in IMG/M |
3300017777|Ga0181357_1116762 | Not Available | 1003 | Open in IMG/M |
3300017778|Ga0181349_1011044 | Not Available | 3756 | Open in IMG/M |
3300017778|Ga0181349_1143921 | Not Available | 861 | Open in IMG/M |
3300017780|Ga0181346_1027430 | Not Available | 2372 | Open in IMG/M |
3300017780|Ga0181346_1335628 | Not Available | 504 | Open in IMG/M |
3300017784|Ga0181348_1005788 | All Organisms → cellular organisms → Bacteria | 5444 | Open in IMG/M |
3300017784|Ga0181348_1191037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300017785|Ga0181355_1005964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5379 | Open in IMG/M |
3300017785|Ga0181355_1117185 | Not Available | 1092 | Open in IMG/M |
3300017785|Ga0181355_1128523 | Not Available | 1033 | Open in IMG/M |
3300017785|Ga0181355_1203315 | Not Available | 777 | Open in IMG/M |
3300017785|Ga0181355_1234772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300017785|Ga0181355_1313684 | Not Available | 585 | Open in IMG/M |
3300017963|Ga0180437_10680764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300019783|Ga0181361_109382 | Not Available | 761 | Open in IMG/M |
3300019784|Ga0181359_1237213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300020084|Ga0194110_10249683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1293 | Open in IMG/M |
3300020084|Ga0194110_10394990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300020161|Ga0211726_10332691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300020172|Ga0211729_10024546 | Not Available | 748 | Open in IMG/M |
3300020190|Ga0194118_10485188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300020197|Ga0194128_10115340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1621 | Open in IMG/M |
3300020205|Ga0211731_10313936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14821 | Open in IMG/M |
3300020221|Ga0194127_10764472 | Not Available | 599 | Open in IMG/M |
3300020550|Ga0208600_1051318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300020553|Ga0208855_1030611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300021519|Ga0194048_10291757 | Not Available | 589 | Open in IMG/M |
3300021958|Ga0222718_10106270 | Not Available | 1646 | Open in IMG/M |
3300021961|Ga0222714_10274398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300021961|Ga0222714_10278765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
3300021962|Ga0222713_10817099 | Not Available | 519 | Open in IMG/M |
3300022176|Ga0212031_1038695 | Not Available | 788 | Open in IMG/M |
3300022190|Ga0181354_1061465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
3300022190|Ga0181354_1205416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300022190|Ga0181354_1210751 | Not Available | 573 | Open in IMG/M |
3300022190|Ga0181354_1236506 | Not Available | 527 | Open in IMG/M |
3300022200|Ga0196901_1027297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2248 | Open in IMG/M |
3300022407|Ga0181351_1170903 | Not Available | 759 | Open in IMG/M |
3300022843|Ga0222631_1017965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1091 | Open in IMG/M |
3300022844|Ga0222687_1031503 | Not Available | 1080 | Open in IMG/M |
3300022865|Ga0222668_1036612 | Not Available | 741 | Open in IMG/M |
3300022874|Ga0222685_1092990 | Not Available | 534 | Open in IMG/M |
3300023256|Ga0222703_1021627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300023297|Ga0222640_1112588 | Not Available | 556 | Open in IMG/M |
3300024179|Ga0247695_1071858 | Not Available | 516 | Open in IMG/M |
3300024352|Ga0255142_1023390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
3300024509|Ga0255175_1022512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1266 | Open in IMG/M |
3300024557|Ga0255283_1109663 | Not Available | 591 | Open in IMG/M |
3300025283|Ga0208048_1110127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300025445|Ga0208424_1048142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300025585|Ga0208546_1030976 | Not Available | 1315 | Open in IMG/M |
3300025635|Ga0208147_1076628 | Not Available | 829 | Open in IMG/M |
3300025645|Ga0208643_1097391 | Not Available | 811 | Open in IMG/M |
3300025646|Ga0208161_1034073 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1764 | Open in IMG/M |
3300025646|Ga0208161_1141431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300025647|Ga0208160_1029147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1683 | Open in IMG/M |
3300025647|Ga0208160_1048261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
3300025655|Ga0208795_1079071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300025655|Ga0208795_1094720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300025687|Ga0208019_1137916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300025698|Ga0208771_1191906 | Not Available | 548 | Open in IMG/M |
3300025848|Ga0208005_1052419 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300025872|Ga0208783_10180900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300025889|Ga0208644_1013661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5388 | Open in IMG/M |
3300025896|Ga0208916_10305153 | Not Available | 693 | Open in IMG/M |
3300027121|Ga0255074_1016281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
3300027126|Ga0255098_1005048 | All Organisms → Viruses → Predicted Viral | 2671 | Open in IMG/M |
3300027145|Ga0255114_1040984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300027365|Ga0209300_1055623 | Not Available | 651 | Open in IMG/M |
3300027608|Ga0208974_1091781 | Not Available | 819 | Open in IMG/M |
3300027608|Ga0208974_1107762 | Not Available | 738 | Open in IMG/M |
3300027732|Ga0209442_1016916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3441 | Open in IMG/M |
3300027733|Ga0209297_1210833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300027747|Ga0209189_1252561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300027764|Ga0209134_10139952 | Not Available | 834 | Open in IMG/M |
3300027785|Ga0209246_10034626 | All Organisms → Viruses → Predicted Viral | 1926 | Open in IMG/M |
3300027798|Ga0209353_10352636 | Not Available | 614 | Open in IMG/M |
3300027804|Ga0209358_10014559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5101 | Open in IMG/M |
3300027808|Ga0209354_10079486 | Not Available | 1333 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1076522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1609 | Open in IMG/M |
3300031565|Ga0307379_10355343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
3300031565|Ga0307379_10916604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300031566|Ga0307378_10350880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
3300031566|Ga0307378_10522440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
3300031566|Ga0307378_10571948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300031566|Ga0307378_10662725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 904 | Open in IMG/M |
3300031673|Ga0307377_10205554 | Not Available | 1530 | Open in IMG/M |
3300031784|Ga0315899_10337986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1479 | Open in IMG/M |
3300031787|Ga0315900_10141326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2247 | Open in IMG/M |
3300031787|Ga0315900_11001855 | Not Available | 549 | Open in IMG/M |
3300031857|Ga0315909_10779790 | Not Available | 608 | Open in IMG/M |
3300031951|Ga0315904_10623108 | Not Available | 923 | Open in IMG/M |
3300031951|Ga0315904_10777042 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300031951|Ga0315904_10928282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
3300031951|Ga0315904_11168957 | Not Available | 594 | Open in IMG/M |
3300031952|Ga0315294_11593520 | Not Available | 506 | Open in IMG/M |
3300031963|Ga0315901_10426008 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
3300031963|Ga0315901_10636299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300032018|Ga0315272_10582562 | Not Available | 563 | Open in IMG/M |
3300032050|Ga0315906_11158644 | Not Available | 565 | Open in IMG/M |
3300032092|Ga0315905_10016133 | All Organisms → Viruses | 7557 | Open in IMG/M |
3300032093|Ga0315902_10840313 | Not Available | 718 | Open in IMG/M |
3300032116|Ga0315903_10063145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3696 | Open in IMG/M |
3300032116|Ga0315903_10531323 | Not Available | 921 | Open in IMG/M |
3300032116|Ga0315903_10618202 | Not Available | 828 | Open in IMG/M |
3300032116|Ga0315903_10667400 | Not Available | 784 | Open in IMG/M |
3300032177|Ga0315276_10866236 | Not Available | 965 | Open in IMG/M |
3300032275|Ga0315270_10662050 | Not Available | 681 | Open in IMG/M |
3300033418|Ga0316625_100172532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
3300033984|Ga0334989_0333691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300034012|Ga0334986_0543203 | Not Available | 563 | Open in IMG/M |
3300034062|Ga0334995_0044712 | Not Available | 3667 | Open in IMG/M |
3300034062|Ga0334995_0094159 | Not Available | 2290 | Open in IMG/M |
3300034062|Ga0334995_0339315 | Not Available | 967 | Open in IMG/M |
3300034062|Ga0334995_0555474 | Not Available | 677 | Open in IMG/M |
3300034066|Ga0335019_0188600 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
3300034066|Ga0335019_0588417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300034103|Ga0335030_0284043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1115 | Open in IMG/M |
3300034103|Ga0335030_0326472 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
3300034104|Ga0335031_0104385 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
3300034104|Ga0335031_0330999 | Not Available | 980 | Open in IMG/M |
3300034104|Ga0335031_0439200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300034110|Ga0335055_0326015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300034122|Ga0335060_0391542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300034122|Ga0335060_0468647 | Not Available | 654 | Open in IMG/M |
3300034166|Ga0335016_0536926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300034272|Ga0335049_0281064 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.57% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.59% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.67% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.71% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.53% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.75% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.75% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.75% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.35% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.35% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.96% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.57% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.57% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.57% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.18% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.18% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.18% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.18% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.78% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.78% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.78% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.39% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.39% |
Coastal Lagoon | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon | 0.39% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.39% |
Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.39% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.39% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.39% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.39% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.39% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.39% |
Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.39% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.39% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.39% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.39% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.39% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2222084011 | Coastal lagoon microbial communities from Albufera, Spain - Sample 1 | Environmental | Open in IMG/M |
3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
3300002138 | M3t6FKB1 (102f) | Environmental | Open in IMG/M |
3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
3300002197 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - DEC 2012 | Environmental | Open in IMG/M |
3300002203 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
3300005917 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013065 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES037 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
3300022844 | Saline water microbial communities from Ace Lake, Antarctica - #1163 | Environmental | Open in IMG/M |
3300022865 | Saline water microbial communities from Ace Lake, Antarctica - #728 | Environmental | Open in IMG/M |
3300022874 | Saline water microbial communities from Ace Lake, Antarctica - #1077 | Environmental | Open in IMG/M |
3300023256 | Saline water microbial communities from Ace Lake, Antarctica - #1506 | Environmental | Open in IMG/M |
3300023297 | Saline water microbial communities from Ace Lake, Antarctica - #187 | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025698 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2225167491 | 2222084011 | Coastal Lagoon | TSDNTKGGTSGILFSASTFQSPGARTVVSGDTLNVTYEFSLDAA |
LV_Brine_h2_0102DRAFT_10588661 | 3300000405 | Hypersaline | TTGILFSAGDFTAPGDRSVIDGDTINVTYQFSLDAQ* |
NpDRAFT_102658783 | 3300000929 | Freshwater And Marine | GTAGTLFSAADFGSPGDRSVVSSDTLSVTYTFSLAG* |
BBAY93_101160353 | 3300000973 | Macroalgal Surface | SDNTKGGTSGILFSAADFSSPGDRSVVSGDVINVTYTFSLDAA* |
MLSed_103509873 | 3300001533 | Benthic | SNSTKGGTTGVLFSAADFQAPGDRSVANGDTLNVTYQFSLDAA* |
RCM30_10049131 | 3300001842 | Marine Plankton | ISNSTKSGTTGTLFSASDFQSPGDRTVASGDTLNVTYTFSLTAT* |
RCM26_10167183 | 3300001849 | Marine Plankton | SGTTGTLFSAADFQSPGDRSVVSGDVLTVTYTFSLSA* |
RCM26_11768943 | 3300001849 | Marine Plankton | GGSGVLFSASDFTSPGDRVVASGDTLNVTYTFSLTAA* |
M3t6FKB1_11308711 | 3300002138 | Marine | GSAKSGTAGTLFSAADFSSPGDRAVTSGDTLNVTYTMSLAG* |
metazooDRAFT_12291553 | 3300002195 | Lake | TGLLFSVASFEAPGDRSVVSGDTLNVTYEFTLSDA* |
metazooDRAFT_12323973 | 3300002197 | Lake | GTSGILFSVASYQAPGARTVVSGDTLNVTYQFSLDAA* |
metazooDRAFT_13001731 | 3300002203 | Lake | TKGGTTGTLYSAADFSAPGDRSVVNGDTLTVTYTLSLAG* |
B570J29032_1090400253 | 3300002408 | Freshwater | AFLASVATGSSGILFSASDFQSPGDRVVVAGDTLNVTYTFSLDAA* |
Ga0007787_100857494 | 3300004240 | Freshwater Lake | GAFLTSGSAKGGTTGTLFSAADFQSPGDRSVVSGDILLVTYTFSLSA* |
Ga0049084_100605064 | 3300005585 | Freshwater Lentic | TSNNTVGGSTGTLFSAADFGSPGDRSVVNSDILTVTYTLSLAG* |
Ga0075109_12398341 | 3300005912 | Saline Lake | NNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA* |
Ga0075108_100136771 | 3300005913 | Saline Lake | GTAGVLFSAADFASPGDRSVVSGDTLTVTYTYSQTAT* |
Ga0075115_100871661 | 3300005917 | Saline Lake | KGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA* |
Ga0075470_100239901 | 3300006030 | Aqueous | VSNSTAGGSTGTLFSAADFQSPGDRSVVSGDTLNVTYSFSLAG* |
Ga0075471_104776902 | 3300006641 | Aqueous | GAFLASAASGTSGTLFSAADFQSPGDRSVVSGDVLTVSYTFSLSA* |
Ga0070749_100259995 | 3300006802 | Aqueous | GVLFSVSTFQSPGARSVVSGDTLNVTYEFSLDAA* |
Ga0070749_101839931 | 3300006802 | Aqueous | TKSGTTGVLFSASDFSSPGDRSVVSGDTLNVTYTFSLDAA* |
Ga0070749_102846531 | 3300006802 | Aqueous | KGGTSGVLFSAADFASPGDRAVVSGDTINVTYTFSLDAA* |
Ga0070749_107813682 | 3300006802 | Aqueous | TTGTLFSAADFSSPGDRSVVSGDIISVTYTFSLAA* |
Ga0075464_104563672 | 3300006805 | Aqueous | TSGSAKSGTTGTLFSAAAFGSPGDRSVVNSDTLSVTYTFSLAG* |
Ga0070750_101404931 | 3300006916 | Aqueous | SVDTGTSGILFSVSNFQSPGDRTVANGDTLNVTYTFSLDAA* |
Ga0070748_11788171 | 3300006920 | Aqueous | TLNTGILFSVADFDAPGSRSVVSGDTLNVRYDFSLADA* |
Ga0074063_129468512 | 3300006953 | Soil | TGTLFSASDLQSPGDRNVSGGDVINVTYRFELTAT* |
Ga0070753_11012642 | 3300007346 | Aqueous | FLCSVTSGTSGVLFSAGDFTGGDKSVDSGDTLSVTYQFSLDAA* |
Ga0070753_11034683 | 3300007346 | Aqueous | GSTGTLFSAADFTGGDRSVASGDTLNVTYTLSLAG* |
Ga0075458_100255631 | 3300007363 | Aqueous | AFLTSNNTILGTTGTLFSAADFQSPGDRSVVSGDVISVTYEFRLTAT* |
Ga0105055_112454511 | 3300007519 | Freshwater | KNGTTGTLFSAADFGSPGDRSVVSGDSLAVTYTFSLAG* |
Ga0099851_10421921 | 3300007538 | Aqueous | TKSGTTGILFSASDFQAPGDRVVTSGDILNVTYTFNLAAV* |
Ga0099851_10658431 | 3300007538 | Aqueous | TGVLFSASDFAAPGDRSVASGDTLNITYQFSLDAA* |
Ga0099851_11482251 | 3300007538 | Aqueous | TGTLFSAKDFSSPGDRNVVSGDVVLVTYTFSLAG* |
Ga0099851_11687953 | 3300007538 | Aqueous | ISNNTKGGTTGVLFSAADFQSPGDRAVVSGDIINVTYQFSLDAA* |
Ga0099849_10154351 | 3300007539 | Aqueous | STKSGTTGILFSASDFTSPGDRSVVSGDTINVTYTFSLAAT* |
Ga0099847_11354621 | 3300007540 | Aqueous | NNTKGGTTGVLFSAADFQSPGDRSVVSGDIINVTYQFSLDAA* |
Ga0099847_11770481 | 3300007540 | Aqueous | SNSTAGGSTGTLFSAADFQSPGDRNVVSGDTLNVTYTFSLAG* |
Ga0099846_10769991 | 3300007542 | Aqueous | KGGSAGVLFSAADFASPGDRSVVSGDTLVVSYTFSLDAA* |
Ga0105051_103321803 | 3300007722 | Freshwater | GVLFSASDFAAPGDRNVTSGDTITISYEFSLDAA* |
Ga0099850_11226693 | 3300007960 | Aqueous | LTSDNTKSGTSGILFSASDFASPGDRSVVSGDTINVTYTFNLDAA* |
Ga0099850_11749521 | 3300007960 | Aqueous | NTKGGTSGILFSAADFQSPGDRSVVSGDTLNVTYTFSLDAA* |
Ga0099850_12176183 | 3300007960 | Aqueous | TSGVLFSVSNFQSPGDRDVVSGDTLNVTYEFSLDAA* |
Ga0105745_11143473 | 3300007972 | Estuary Water | SVATGTSGILFSASDFQSPGDRVVVSGDTLNVTYTFSLDAA* |
Ga0105747_11184592 | 3300007974 | Estuary Water | SGVLFSGSDFTGGDKSVASGDTLNVTYTFSLTAT* |
Ga0108970_116970811 | 3300008055 | Estuary | TKGGTTGTLFSAADFSAPGDRSVVSGDILNVTYTFSLSA* |
Ga0110929_10615543 | 3300008072 | Water Bodies | TKGGTSGTLFSAADFAAPGDRSVVSGDTLNVTYTFSLDAA* |
Ga0114340_10459323 | 3300008107 | Freshwater, Plankton | TVSSGTSGVLFSEADFQSPGDRTVVSGDTLNVTYTFSLDAA* |
Ga0114355_10869311 | 3300008120 | Freshwater, Plankton | NTKGGTVGTLLSAGNFTVGDRAVVNGDTINVTYTFSADAT* |
Ga0114363_10407561 | 3300008266 | Freshwater, Plankton | KGGTTGTLFSVANFQSPGDRSVINGDTLSVTYTFNLDAA* |
Ga0105093_105046541 | 3300009037 | Freshwater Sediment | ICTVASGTSGILFSEADFDSPGDRNVVNGDTLNVSYTFSLDAA* |
Ga0105099_103197941 | 3300009082 | Freshwater Sediment | NTKSGTAGVLFSASDFAAPGDRNVSSGDTIQITYTFSLDAA* |
Ga0105103_103063801 | 3300009085 | Freshwater Sediment | SDNTKSGSTGVLFSASDFAAPGDRSVASGDTLAVTYTFSLDAA* |
Ga0114962_105494261 | 3300009151 | Freshwater Lake | TGILFSASDFASPGDRVVASGDTLNVTYTFSLTAT* |
Ga0114980_107997603 | 3300009152 | Freshwater Lake | LVSNSTKGGSTGTLFSASDFQSPGDRAVVNGDTLNVTYQFSLTAT* |
Ga0114968_102032721 | 3300009155 | Freshwater Lake | NGTTGVLFSASDFSAPGDRVVASGDTLNVTYTFSLTAT* |
Ga0114966_107564131 | 3300009161 | Freshwater Lake | TGTLFSAADSGSPGDRSVVSSDTLSVTYTFSLAG* |
Ga0105102_100038861 | 3300009165 | Freshwater Sediment | TTGVLFSVANFAAPGDRAVVSGDTLNVTYTFSLDAA* |
Ga0105102_104030191 | 3300009165 | Freshwater Sediment | GILFSAGDFASPGDRSVVSGDTLTLTYTFSLDAA* |
Ga0105102_106184702 | 3300009165 | Freshwater Sediment | CSVTSGTSGILFCAADFTSPRAVESGDTLEVTYTLSAADDGA* |
Ga0105096_106649491 | 3300009170 | Freshwater Sediment | TGTLFSAADFQAPGDRSVVSGDTLNVTYTFSLDAA* |
Ga0114959_102360372 | 3300009182 | Freshwater Lake | GFLTSGSAKSGIVGTLFSASDFTAPGDRAVVSGDILNVTYTLSLAG* |
Ga0114972_103276861 | 3300009187 | Freshwater Lake | SGSAKSGTTGTLFSAADFGSPGDRSVVSSDTLSVTYTFSLAG* |
Ga0114983_10865581 | 3300009194 | Deep Subsurface | TKSGTTGVLFSASDFAAPGDRSVASGDQLNVTYTFSLDAA* |
Ga0114946_101836321 | 3300009504 | Sediment | TSDDTKGGTAGVLFSVANFAAPGDRAVVSGDTLNVTYTFSLDAV* |
Ga0114946_107047232 | 3300009504 | Sediment | GGTAGVLFSVANFAAPGDRAVVSGDTLNVSYSFSLDAV* |
Ga0114964_104069591 | 3300010157 | Freshwater Lake | NSTKSGTTGILFSASDFASPGDRVVASGDTLNVTYTFSLTAT* |
Ga0114967_105340382 | 3300010160 | Freshwater Lake | KSGTTGTLFSAADFGSPGDRSVVSSDTLSVTYTFSLAG* |
Ga0136644_105965081 | 3300010334 | Freshwater Lake | NSTKSGTTGTLFSASDFQSPGDRPVVSGDTLNVTYQFSLTAT* |
Ga0129333_102116571 | 3300010354 | Freshwater To Marine Saline Gradient | TGTLFSAADFSSPGDRSVVSGDTLNVTYTMSLSG* |
Ga0129333_102966441 | 3300010354 | Freshwater To Marine Saline Gradient | TSGTLFSASDFTGGDRSVVNGDTLQVTYTFSLAA* |
Ga0129333_103160942 | 3300010354 | Freshwater To Marine Saline Gradient | GTSGILFSEGAFSSVRNVVNGDTLNVTYSLSNNAA* |
Ga0129333_105150751 | 3300010354 | Freshwater To Marine Saline Gradient | SNSTKGGSTGTLFSEASFSSPGNRSVVSGDTLNVTYTFSLS* |
Ga0129333_106706503 | 3300010354 | Freshwater To Marine Saline Gradient | TSVAAKSPGNTGILFSAADFQSPGDRSVVNGDTLTVTYTFSLDAA* |
Ga0129324_102664273 | 3300010368 | Freshwater To Marine Saline Gradient | TSGTSGILFSAGDFTGGDKIVAATDTINVTYTFSADAV* |
Ga0129336_101744291 | 3300010370 | Freshwater To Marine Saline Gradient | TTGTLFSASDFQSPGDRSVVNGDTLTVTYTFSLDAA* |
Ga0129336_103990313 | 3300010370 | Freshwater To Marine Saline Gradient | GGAFLISDNTKGGSAGVLFSAADFASPGDRAVVSGDVIQVTYTFSLDAI* |
Ga0129336_105211251 | 3300010370 | Freshwater To Marine Saline Gradient | SSNTKGGTTGTLFSAGDFAAPGDRAVVAGDTLTLTYTFSLDAA* |
Ga0133913_102859441 | 3300010885 | Freshwater Lake | VNTKSGVTGVMYSAADFSSPGDRAVVSGDTLTVTYTLSLAG* |
Ga0139557_10455041 | 3300011010 | Freshwater | TAGTLYSAADFSAPGDRAVTNGDVLNVVYTLSLAG* |
Ga0139557_10684991 | 3300011010 | Freshwater | TAGTLFSAADFGSPGDRSVVASDTLAVTYTFSLAA* |
Ga0157138_10017575 | 3300012352 | Freshwater | NSGVLFSAGDFTGGDKSVASGDTLNVTYQFSLDAA* |
Ga0157138_10047153 | 3300012352 | Freshwater | GVLFSASDFQSPGDRTVVSGDTLNVTYTFSLDAA* |
Ga0138256_114552463 | 3300012533 | Active Sludge | GAFLISNSTKGGTTGILFSASDNQSPGDRSVILNDTVNVTYTFNLDAA* |
Ga0157498_10087084 | 3300012666 | Freshwater, Surface Ice | TGTLFSAADFQAPGDRAVVSGDVLNVAYSFSLSA* |
Ga0157498_10324261 | 3300012666 | Freshwater, Surface Ice | FLTTGDSPGGSSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA* |
Ga0157552_12714451 | 3300012728 | Freshwater | STGTLYSAADFSSPGDRSVVSGDTLTVTYTLSLAG* |
Ga0164293_100885601 | 3300013004 | Freshwater | VDTGTSGILFSASDFQSPGDRSVVNGDVLNVTYTFNLDAA* |
Ga0164293_106890091 | 3300013004 | Freshwater | KGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA* |
Ga0157547_1298071 | 3300013065 | Freshwater | GGVTGIMFSASDFQSPGDRSVVSGDTLNVTYQFSLTAT* |
Ga0163212_12335803 | 3300013087 | Freshwater | DNTKSGTSGILFSASDFQSPGDRAVVSGDTLNVTYTFSLDAT* |
(restricted) Ga0172366_101507881 | 3300013128 | Sediment | GTSGVLFSEAEFEAPGDRAVVSGDILNVKYTFSLADA* |
(restricted) Ga0172364_105998333 | 3300013129 | Sediment | GTLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA* |
(restricted) Ga0172362_108232901 | 3300013133 | Sediment | TSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA* |
(restricted) Ga0172375_101855584 | 3300013137 | Freshwater | GAFLTSDNTILGTTGTLFSAADFQSPGDRSVVSGDVISCTYEFRLSA* |
(restricted) Ga0172376_102926161 | 3300014720 | Freshwater | SNDTKGGTTGTLFSEKAFSSPGDRSVVSGDVISVTYTFSLAG* |
Ga0134315_10538471 | 3300014962 | Surface Water | GGTSGILFSASDFQSPGDRNVVSGDTLTVTYTFSLDAV* |
Ga0181338_10080001 | 3300015050 | Freshwater Lake | FLTSGSAKSGTAGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAG* |
Ga0181338_10539182 | 3300015050 | Freshwater Lake | GGTEGNLISEDDFGAPGDRSVVDSDTLSVTYTFSLAA* |
Ga0181364_10434291 | 3300017701 | Freshwater Lake | SGTAGVLFSESDFTSPGDRTVVSGDTLNVTYTFSLDAA |
Ga0181350_10083863 | 3300017716 | Freshwater Lake | VASGTSGTLFSAADFSAPGDRAVTSGDTLNVTYTMSLAG |
Ga0181350_10857532 | 3300017716 | Freshwater Lake | GTAGTLFSAADFGSPGDRAVVNSDTLSVTYTFSLAG |
Ga0181350_10874311 | 3300017716 | Freshwater Lake | TSGSAKSGTAGTLFSAADFGSPGDRAVVTSDTLSVTYTFSLAG |
Ga0181350_11483401 | 3300017716 | Freshwater Lake | SGTTGTLFSAADFGSPGDRNVVNSDTLSVTYTFSLAA |
Ga0181347_10631291 | 3300017722 | Freshwater Lake | SGTAGTLFSAADFGAPGDRSVVNSDTLSVTYTFSLAG |
Ga0181347_11029612 | 3300017722 | Freshwater Lake | AFLTSGSAKSGTAGTLFSASDFTSPGDRSVTSGDTLNVTYTLSLAG |
Ga0181347_11181131 | 3300017722 | Freshwater Lake | KSGTTGTLFSAADFGSPGDRSVVSSDTLSVTYTFSLAG |
Ga0181362_10267773 | 3300017723 | Freshwater Lake | GTAGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0181365_10132543 | 3300017736 | Freshwater Lake | TSGSAKSGTAGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAG |
Ga0181365_10248251 | 3300017736 | Freshwater Lake | TKGGSTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0181352_10021923 | 3300017747 | Freshwater Lake | AGGSTGTLFSAADFQSPGDRSVVSGDTLNVTYTFSLAG |
Ga0181352_10478731 | 3300017747 | Freshwater Lake | SGTLFSEADFESPGDRVVVAGDTLNVTYTFSLDAA |
Ga0181352_10500191 | 3300017747 | Freshwater Lake | TSNNTVGGSTGTLFSAADFGAPGDRSVANADVLTVTYTLSLAG |
Ga0181352_10866243 | 3300017747 | Freshwater Lake | LTNVATGTTGLLFSESDFQSPGDRTVVSGDVLLVTYSFNLDAT |
Ga0181352_11931073 | 3300017747 | Freshwater Lake | VGGAFLTNNSTVSGTAGTLYSAADFSAPGDRAVTNGDVLNVVYTLSLAG |
Ga0181344_10672063 | 3300017754 | Freshwater Lake | SGTSGTLFSASDFQSPGDRVVVSGDTLNVTYTFSLDAA |
Ga0181344_11127051 | 3300017754 | Freshwater Lake | STKLGTTGILFSAADFQAPGDRNVTSGDTLNVTYTFSLDAA |
Ga0181344_11701612 | 3300017754 | Freshwater Lake | NVASGTSGILFSASDFQSPGDRAVVNGDVLVVTYTFNLDAT |
Ga0181344_11935512 | 3300017754 | Freshwater Lake | SGTLFSASDFQSPGDRVVVSGDTLNVTYTFSLDAA |
Ga0181343_10188264 | 3300017766 | Freshwater Lake | AFLCSAASGTSGTLFSAADFSSPGDRSVVSGDTLNVTYTLSLAG |
Ga0181343_11278952 | 3300017766 | Freshwater Lake | VASGTSGVLFSEANFTSPGDRNVANGDTLNVVYTFSLTAT |
Ga0181358_12499851 | 3300017774 | Freshwater Lake | KGGFTGTLFSAADFQSPGDRTVVSGDTLNVTYTFSLTAT |
Ga0181358_12771992 | 3300017774 | Freshwater Lake | GGAFLVGGTGSSTKGGTTGTLFSAADFGSPGDRSVVTSDTLSVTYTFSLAG |
Ga0181357_10638221 | 3300017777 | Freshwater Lake | KSGTAGTLFSASDFTSPGDRAVTSGDTLNVTYTMSLAG |
Ga0181357_11167622 | 3300017777 | Freshwater Lake | GSAKSGTAGTLFSAADFGAPGDRSVVASDTLSVTYTFSLAA |
Ga0181349_10057371 | 3300017778 | Freshwater Lake | INATATVGGAFLCSVNSGTSPGVLFSAADFGSPGDRNVVNSDTLSVTYTFSLAP |
Ga0181349_10110445 | 3300017778 | Freshwater Lake | LTSNNTVGGSTGTLFSAADFGSPGDRSVVNSDILTVTYTLSLAG |
Ga0181349_11439212 | 3300017778 | Freshwater Lake | TTGTLFSAADFGAPGDRSVVTSDTLSVTYTFSLAA |
Ga0181346_10274304 | 3300017780 | Freshwater Lake | TSGSAKSGTAGTLFSAADFGSPGDRAVVNSDTLSVTYTFSLAA |
Ga0181346_13356282 | 3300017780 | Freshwater Lake | LCSVSSGPGGVLFSESNFQSPGDRITVSGDVLNVTYSFSLAAV |
Ga0181348_10057881 | 3300017784 | Freshwater Lake | TVGGAFLCSVNTGTGGTLFSEADFGSPGDRSVVNSDTLSVTYTFSLAP |
Ga0181348_11910372 | 3300017784 | Freshwater Lake | FLTSGSAKSGTAGTLFSASDFTSPGDRSVVSGDTINVTYTMSLAG |
Ga0181355_10059648 | 3300017785 | Freshwater Lake | GTSPGTRFSEAEFGGAGDRSVVSSDTLSVTDSFSLAP |
Ga0181355_11171851 | 3300017785 | Freshwater Lake | NGTVGTLFSAADFQAPGDRSVVNGDILNVTYQFSLSATA |
Ga0181355_11285233 | 3300017785 | Freshwater Lake | SGTSGVLFSESDFQAPGDRTVVSGDTLNVTYTFSLDAA |
Ga0181355_12033151 | 3300017785 | Freshwater Lake | TSGSAKSGTAGTLFSAADFGAPGDRSVVSSDTLSVTYTFSLAA |
Ga0181355_12347723 | 3300017785 | Freshwater Lake | LISSNTKGGTTGVLFSAADFQSPGDKTVVNGDTLTCTYTFSLDAA |
Ga0181355_13136841 | 3300017785 | Freshwater Lake | NTKGGTTGTLFSAADFQSPGDRSVVSGDVLNVTYQFSLTA |
Ga0180437_106807643 | 3300017963 | Hypersaline Lake Sediment | PGGTSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA |
Ga0181361_1093821 | 3300019783 | Freshwater Lake | SGSVKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0181359_12372133 | 3300019784 | Freshwater Lake | TSSNTKSGTTGTLFSAVDFSAPGDRAVVANDTVTVTYTFSLDAA |
Ga0194110_102496833 | 3300020084 | Freshwater Lake | SGILFSVAAFEAPGDRSVVAGDTLNVTYQFSLADA |
Ga0194110_103949901 | 3300020084 | Freshwater Lake | SGILFSASDFQSPGDRAVVSGDTLNVTYQFSLDAA |
Ga0211726_103326913 | 3300020161 | Freshwater | GTSGILFSASDFQSPGDRAVVAGDTLNVTYTFSLDAA |
Ga0211729_100245461 | 3300020172 | Freshwater | KSGSTGTLFSASDFSAPGDRSVVSGDTINVTYTFSLDAA |
Ga0194118_104851883 | 3300020190 | Freshwater Lake | ITGTSGILFSVSSFQSPGARAVVSGDTLSVTYQFSLDAA |
Ga0194128_101153401 | 3300020197 | Freshwater Lake | GTSGILFSASDFQSPGDRAVVSGDTLNVTYQFSLDAA |
Ga0211731_1031393617 | 3300020205 | Freshwater | LTNVATGTSGLLFSESDFQSPGDRTVVSGDVLLVTYSFNLDAT |
Ga0194127_107644723 | 3300020221 | Freshwater Lake | PGDLPGGTSGTLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA |
Ga0208600_10513183 | 3300020550 | Freshwater | SGILFSASDFQSPGDRAVVAGDTLSVTYTFSLDAA |
Ga0208855_10306111 | 3300020553 | Freshwater | VDTGTSGILFSASDFQSPGDRAVVAGDTLSVTYTFSLDAA |
Ga0194048_102917571 | 3300021519 | Anoxic Zone Freshwater | KNGTTGVLFSASDFSSPGDRVVASGDTLNVTYTFSLTAT |
Ga0222718_101062703 | 3300021958 | Estuarine Water | LTSDNTKSGTSGILFSASDFASPGDRSVVSGDTINVTYTFNLDAA |
Ga0222714_102743983 | 3300021961 | Estuarine Water | TKGGTSGVLFSAADFASPGDRSVVSGDTVNVTYTFSLDAA |
Ga0222714_102787651 | 3300021961 | Estuarine Water | TTGILFSAADFSSPGDRAVVSGDTLSVTYTFSLDAA |
Ga0222713_108170991 | 3300021962 | Estuarine Water | GTTGLLFSESDFQSPGDRTVVSGDVLLVTYSFNLDAT |
Ga0212031_10386952 | 3300022176 | Aqueous | SVNSGSSGVLFSANNFSGGDKSVDSGDTLSVTYQFSLDAA |
Ga0181354_10614651 | 3300022190 | Freshwater Lake | LTSSNTKSGTTGTLFSAVDFSAPGDRAVVANDTVTVTYTFSLDAA |
Ga0181354_12054161 | 3300022190 | Freshwater Lake | GGTTGTLFSAADFSAPGDRVVESGDTLNVTYTLNLAG |
Ga0181354_12107513 | 3300022190 | Freshwater Lake | TSGTLFSASDFAAPGDRTVQNGDVLSVTYTFSLDAA |
Ga0181354_12365061 | 3300022190 | Freshwater Lake | TNSTKSGTTGTLFSAADFQSPGDRAVVNGDTLTVTYTFSLTAT |
Ga0196901_10272971 | 3300022200 | Aqueous | KSGTTGILFSASDFTSPGDRSVVSGDTINVTYTFSLAAT |
Ga0181351_11709031 | 3300022407 | Freshwater Lake | KSGTAGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0222631_10179651 | 3300022843 | Saline Water | LINNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA |
Ga0222687_10315031 | 3300022844 | Saline Water | LINNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLNAV |
Ga0222668_10366122 | 3300022865 | Saline Water | GTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA |
Ga0222685_10929901 | 3300022874 | Saline Water | INNNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA |
Ga0222703_10216271 | 3300023256 | Saline Water | NNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLNAV |
Ga0222640_11125882 | 3300023297 | Saline Water | NNTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA |
Ga0247695_10718582 | 3300024179 | Soil | GGTSGKLITAGLFSSPGDRSVVSGDTLNVSWTGSL |
Ga0255142_10233903 | 3300024352 | Freshwater | TKGGSTGTLFSASDFTSPGDRSVVSGDTLNVTYTFSLDAV |
Ga0255175_10225123 | 3300024509 | Freshwater | CTVASGTSGILFSVANFQSPGDRAVVSGDTLNVTYTFNLDAV |
Ga0255283_11096631 | 3300024557 | Freshwater | KSGTSGVLFSASDFAAPGDRTVASGDVLNVTYTFSLDA |
Ga0208048_11101271 | 3300025283 | Freshwater | DNTKSGTSGILFSASDFQSPGDRAVVSGDTLNVTYTFSLDAT |
Ga0208424_10481423 | 3300025445 | Aqueous | TSGTTGVLFSAADFQSPGDRTVVSGDTLTVTYTFSLDAV |
Ga0208546_10309761 | 3300025585 | Aqueous | ASGTSGTLFSAADFQSPGDRSVVSGDVLTVSYTFSLSA |
Ga0208147_10766281 | 3300025635 | Aqueous | TSGTLFSEADFQSPGDRVVVSGDTLNVTYTFSLDAA |
Ga0208643_10973911 | 3300025645 | Aqueous | TKSGTAGTLFSAGNFTVGDRSVVTGDTLNVTYTFSADAA |
Ga0208161_10340731 | 3300025646 | Aqueous | LTSDSTKSGTSGILFSAADFQSPGDRTVVNGDTLNVTYQFSLDAA |
Ga0208161_11414311 | 3300025646 | Aqueous | NTKGGTSGILFSAADFQSPGDRSVVSGDTLNVTYTFSLDAA |
Ga0208160_10291473 | 3300025647 | Aqueous | GTTGTLFSAADFASPGDRTVASGDTLNVSYTFSLDAA |
Ga0208160_10482613 | 3300025647 | Aqueous | CSVTSGTSGVLFSAGDFTGGDKSVDSGDTLSVTYQFSLDAA |
Ga0208795_10790711 | 3300025655 | Aqueous | FLISNNTKSGTTGILFSAADFQSPGDRSVVSGDIINVTYVFSLDAA |
Ga0208795_10947203 | 3300025655 | Aqueous | ISNNTKGGTTGVLFSAADFQSPGDRAVVSGDIINVTYQFSLDAA |
Ga0208019_11379161 | 3300025687 | Aqueous | KGGTSGILFSAADFQSPGDRSVVSGDTLNVTYTFSLDAA |
Ga0208771_11919062 | 3300025698 | Saline Lake | NTKGGTTGVLFSAADFQAPGDRSVVSGDIINVTYQFSLDAA |
Ga0208005_10524193 | 3300025848 | Aqueous | GGAFLASAASGTSGTLFSAADFQSPGDRSVVSGDVLTVSYTFSLSA |
Ga0208783_101809001 | 3300025872 | Aqueous | LVSNSTAGGSTGTLFSAADFQSPGDRSVVSGDTLNVTYTFSLAG |
Ga0208644_10136617 | 3300025889 | Aqueous | FLCNVQDNTSTSGLLFSVSSFTGGDRSVVNGDTLNVTYEFSLDAA |
Ga0208916_103051531 | 3300025896 | Aqueous | TGTSGILFSGSDFTGGDKSVASGDTLNVTYTFSLTAT |
Ga0255074_10162811 | 3300027121 | Freshwater | TGTSGILFSASDFQSPGDRVVVSGDTLNVTYTFSLDAA |
Ga0255098_10050481 | 3300027126 | Freshwater | STGTLFSAKAFTGGARSVISGDTLNVTYTFSLTGT |
Ga0255114_10409841 | 3300027145 | Freshwater | ASGTSGILFSESDFQSPGDRVVVSGDTLNVTYTFSLDAA |
Ga0209300_10556233 | 3300027365 | Deep Subsurface | NNTKSGTTGVLFSASDFAAPGDRSVASGDQLNVTYTFSLDAA |
Ga0208682_11447972 | 3300027531 | Estuarine | NSTKGGTTGTLYSAADFSAPGDRSVASSDILNVTYTLSLAG |
Ga0208974_10917811 | 3300027608 | Freshwater Lentic | DSPGGSSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA |
Ga0208974_11077621 | 3300027608 | Freshwater Lentic | LTSGSVKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0208951_11651301 | 3300027621 | Freshwater Lentic | AFLTNNSTVSGTAGTLYSAADFSAPGDRSVTNGDVLNVVYTLSLAG |
Ga0209442_10169165 | 3300027732 | Freshwater Lake | KGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0209297_12108333 | 3300027733 | Freshwater Lake | TSNNTKSGTTGTLFSASDFAAPGDRVVASGDTLNVTYTFSLDAA |
Ga0209189_12525611 | 3300027747 | Freshwater Lake | SNSTKSGTTGTLFSASDFQSPGDRSVVSGDTLNVTYQFSLTAT |
Ga0209134_101399521 | 3300027764 | Freshwater Lake | TATVGGAFLTSSSPKTPNSGFDAGTLFSAADFGSPGDRSVVSGDTLSVTYTFSLAA |
Ga0209246_100346261 | 3300027785 | Freshwater Lake | LTSGSAKSGTTGTLFSAADFGSPGDRSVVASDTLSVTYTFSLAG |
Ga0209353_103526362 | 3300027798 | Freshwater Lake | GTAGILFSESDFTAPGDRTVVSGDTLNVTYTFSLDAA |
Ga0209358_100145596 | 3300027804 | Freshwater Lake | TKAGTTGTLFSAADFQAPGDRAVVSGDILNVTYQFSLSA |
Ga0209354_100794861 | 3300027808 | Freshwater Lake | GGAFLTSGSAKGGTAGTLFSAADFGAPGDRSVVASDTLAVTYTFSLAA |
(restricted) Ga0247834_10765221 | 3300027977 | Freshwater | SGTTGVLFSASDFTAPGDRVVASGDVLNVSYTFSLAG |
Ga0307379_103553434 | 3300031565 | Soil | NNTKGGTSGVLFSAADFASPGDRSVVSGDTINVTYTFSLDAA |
Ga0307379_109166043 | 3300031565 | Soil | TSGILFSAADFSSPGDRAVVSGDTLNVTYEFSLDAA |
Ga0307378_103508801 | 3300031566 | Soil | SSGVLFSESDFQSPGDRTVVSGDTLNVTYTFSLDAA |
Ga0307378_105224403 | 3300031566 | Soil | TGILFSVAAFEVPGDRSVVDGDTLNVTYQFSLTDA |
Ga0307378_105719484 | 3300031566 | Soil | VDTGTSGVLFSVSSFQAPGDRSVVSGDTLSVTYEFSADAA |
Ga0307378_106627251 | 3300031566 | Soil | TKGGSAGVLFSAADFASPGDRNVASGDTLIVTYTFSLDAA |
Ga0307377_102055541 | 3300031673 | Soil | GTTGILFSASDFSSPGDRSVVSGDSVNVTYTFSLDAA |
Ga0315899_103379863 | 3300031784 | Freshwater | AFLCTVSSGTSGVLFSEADFQSPGDRVVVAGDTLNVTYTFSLDAA |
Ga0315900_101413265 | 3300031787 | Freshwater | TKGGTSGILFSASDFQSPGDRSVVNGDTLTVTYTFSLDAA |
Ga0315900_110018551 | 3300031787 | Freshwater | VGGAFLTSNNTILGTTGTLFSAADFQAPGDRSVVSGDVLSVTYTFSLDGTP |
Ga0315909_107797902 | 3300031857 | Freshwater | VGGAFLTSDNTILGTTGTLFSAADFQSPGDRSVVSGDVISVTYEFRLTAT |
Ga0315904_106231082 | 3300031951 | Freshwater | TGTLFSAGDFQAPGDRSVVSGDVINLTYQFSLDAA |
Ga0315904_107770421 | 3300031951 | Freshwater | SAASGTSGTLFSAADFQAPGDRSVVNGDTLTVTYTFSLSA |
Ga0315904_109282822 | 3300031951 | Freshwater | SGTSGTLFSASDFTGGDRSVVNGDTLQVTYTFSLSA |
Ga0315904_111689571 | 3300031951 | Freshwater | AKGGTTGTLFSAADFQSPFDRSVVSGDILLVTYTFSLSA |
Ga0315294_115935202 | 3300031952 | Sediment | NVSTGTSGVLFAEGDFTGGDKSVTIGDTLAVTYTFSLTS |
Ga0315901_104260081 | 3300031963 | Freshwater | SSGTSGVLFSEADFQLPGDRVVVAGDTLNVTYTFSLDAA |
Ga0315901_106362992 | 3300031963 | Freshwater | TGGILFSEADFQSPGDRSVQSGDILNVAYTFSLAAS |
Ga0315272_105825621 | 3300032018 | Sediment | GTAGTLFSAADFGAPGDRAVVNSDTVSVTYTFSLAG |
Ga0315906_111586442 | 3300032050 | Freshwater | TVASGTSGVLFSEADFQSPGDRTVVSGDTLNVTYTFSLDAA |
Ga0315905_100161339 | 3300032092 | Freshwater | LTSGSAKSGTTGTLFSAADFGAPGDRSVVTSDTLSVTYTFSLAA |
Ga0315902_108403131 | 3300032093 | Freshwater | TVGGAFLVGGTGSSTKGGSTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0315903_100631457 | 3300032116 | Freshwater | LTNVASGTTGLLFSESDFQSPGDRTVVSGDVLLVTYSFNLDAT |
Ga0315903_105313231 | 3300032116 | Freshwater | LTSGSAKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0315903_106182021 | 3300032116 | Freshwater | GAFLTSGSAKNGTTGTLFSAADFSAPGDRSVVSGDIISVTYTFSLAG |
Ga0315903_106674003 | 3300032116 | Freshwater | PGGSSGVLFSASDFAAPGDRVVQNGDVLSVTYTFSLDAA |
Ga0315276_108662361 | 3300032177 | Sediment | GAFLTTGSAKSGTAGTLFSAADFGAPGDRAVVNSDTVSVTYTFSLAG |
Ga0315270_106620503 | 3300032275 | Sediment | KSGTTGVLFSASDFQSPGDRSVASGDTLNVTYQFSLDAV |
Ga0316625_1001725321 | 3300033418 | Soil | TSGVLFSENTFNSPGDRTVVSGDTLNVTYEFSLNAV |
Ga0334989_0333691_666_797 | 3300033984 | Freshwater | LTSVATGTSGILFSASDFQSPGDRAVVAGDTLSVTYTFSLDAA |
Ga0334986_0543203_2_109 | 3300034012 | Freshwater | SGVLFSESDFQSPGDRVVVAGDTLNVTYTFSLDAA |
Ga0334995_0044712_2_133 | 3300034062 | Freshwater | TSNDTKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0334995_0094159_2156_2290 | 3300034062 | Freshwater | LTSNDTKGGTTGTLFSAADFGSPGDRSVVNSDTLSVTYTFSLAA |
Ga0334995_0339315_835_966 | 3300034062 | Freshwater | LCTVASGTSGVLFSESDFQSPGDRVVVSGDTLNVTYTFSLDAA |
Ga0334995_0555474_349_483 | 3300034062 | Freshwater | MTSDNTKNGTTGILYSAADFGAPGDRSVASGDVLTVTYTLSLAG |
Ga0335019_0188600_1206_1340 | 3300034066 | Freshwater | TSGDLPGGSSGTLFSASDFAAPGDRTVQNGDVLSVTYTFSLDAA |
Ga0335019_0588417_514_651 | 3300034066 | Freshwater | AFLASVATGTSGILFSESDFQAPGDRAVVSGDVLNVTYQFSLDAA |
Ga0335030_0284043_1_126 | 3300034103 | Freshwater | STKSGTTGILFSASDFQSPGDRTVASGDVLNVTYTFSLTAT |
Ga0335030_0326472_898_1017 | 3300034103 | Freshwater | TKGGSTGTLFSAADFQAPGDRSVVSGDILNVTYTFSLSA |
Ga0335031_0104385_1842_1994 | 3300034104 | Freshwater | IGGAFLTSSNTKGGGTGTLFSAADFAAPGDRSVVSGDVLVLTYTFSLDAA |
Ga0335031_0330999_860_979 | 3300034104 | Freshwater | TKGGSTGTLFSAADFSAPGDRSVVSGDILNVTYTFSLAG |
Ga0335031_0439200_1_120 | 3300034104 | Freshwater | KGGTTGTLFSAADFSAPGDRTVANGDTLNVTYTFSLDAA |
Ga0335055_0326015_538_648 | 3300034110 | Freshwater | TSGILFSASDFQSPGDRAVVAGDTLSVTYTFSLDAA |
Ga0335060_0391542_613_735 | 3300034122 | Freshwater | VATGTSGILFSASDFQSPGDRAVVSGDTLNVTYTFSLDAT |
Ga0335060_0468647_543_653 | 3300034122 | Freshwater | SSGTLFSASDFAAPGDRTVQNGDVLSVTYTFSLDAA |
Ga0335016_0536926_169_297 | 3300034166 | Freshwater | MCSVASGTSGTLFSASDFTGGDRSVGNGDTLQVTYTFSLAAA |
Ga0335049_0281064_1008_1133 | 3300034272 | Freshwater | DLPGGSSGTLFSASDFAAPGDRTVQNGDVLSVTYTFSLDAA |
⦗Top⦘ |