Basic Information | |
---|---|
Family ID | F015239 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 256 |
Average Sequence Length | 47 residues |
Representative Sequence | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEVERLKALLSKGK |
Number of Associated Samples | 144 |
Number of Associated Scaffolds | 256 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.16 % |
% of genes near scaffold ends (potentially truncated) | 23.05 % |
% of genes from short scaffolds (< 2000 bps) | 71.09 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.812 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.422 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.469 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.00% β-sheet: 0.00% Coil/Unstructured: 40.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 256 Family Scaffolds |
---|---|---|
PF00762 | Ferrochelatase | 42.97 |
PF01578 | Cytochrom_C_asm | 29.30 |
PF03379 | CcmB | 6.64 |
PF00005 | ABC_tran | 6.25 |
PF02628 | COX15-CtaA | 2.73 |
PF09413 | DUF2007 | 2.73 |
PF01040 | UbiA | 1.56 |
PF04238 | DUF420 | 1.17 |
PF03100 | CcmE | 0.78 |
PF03918 | CcmH | 0.39 |
PF12704 | MacB_PCD | 0.39 |
PF13414 | TPR_11 | 0.39 |
PF00180 | Iso_dh | 0.39 |
PF00355 | Rieske | 0.39 |
PF02091 | tRNA-synt_2e | 0.39 |
PF14579 | HHH_6 | 0.39 |
PF05199 | GMC_oxred_C | 0.39 |
PF16327 | CcmF_C | 0.39 |
PF02540 | NAD_synthase | 0.39 |
COG ID | Name | Functional Category | % Frequency in 256 Family Scaffolds |
---|---|---|---|
COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 42.97 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 6.64 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 2.73 |
COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 1.17 |
COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.39 |
COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.39 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.39 |
COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 0.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10073511 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300001084|JGI12648J13191_1002704 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
3300001593|JGI12635J15846_10903694 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300002558|JGI25385J37094_10207136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300002908|JGI25382J43887_10467537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300002909|JGI25388J43891_1000013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 28271 | Open in IMG/M |
3300002914|JGI25617J43924_10039583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1700 | Open in IMG/M |
3300002914|JGI25617J43924_10110774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
3300002914|JGI25617J43924_10164047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300002914|JGI25617J43924_10346244 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300002914|JGI25617J43924_10359072 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300002917|JGI25616J43925_10213159 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300004633|Ga0066395_10047230 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300005166|Ga0066674_10142475 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300005167|Ga0066672_10024060 | All Organisms → cellular organisms → Bacteria | 3236 | Open in IMG/M |
3300005167|Ga0066672_10111994 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
3300005171|Ga0066677_10001486 | All Organisms → cellular organisms → Bacteria | 8378 | Open in IMG/M |
3300005179|Ga0066684_10038722 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
3300005179|Ga0066684_10342472 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300005186|Ga0066676_10128439 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300005332|Ga0066388_100248619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2416 | Open in IMG/M |
3300005332|Ga0066388_100681449 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
3300005332|Ga0066388_101418446 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300005332|Ga0066388_102026842 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300005436|Ga0070713_102102426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300005437|Ga0070710_11006741 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300005451|Ga0066681_10000056 | All Organisms → cellular organisms → Bacteria | 22580 | Open in IMG/M |
3300005451|Ga0066681_10078507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
3300005471|Ga0070698_101511491 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005537|Ga0070730_10024199 | All Organisms → cellular organisms → Bacteria | 4667 | Open in IMG/M |
3300005540|Ga0066697_10228855 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300005542|Ga0070732_10097105 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
3300005554|Ga0066661_10480202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300005561|Ga0066699_10061284 | All Organisms → cellular organisms → Bacteria | 2356 | Open in IMG/M |
3300005576|Ga0066708_10378664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300005587|Ga0066654_10581994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300005764|Ga0066903_100278561 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
3300005764|Ga0066903_101019449 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
3300005764|Ga0066903_102085842 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300005880|Ga0075298_1031518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300006032|Ga0066696_10345172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
3300006052|Ga0075029_100065795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2123 | Open in IMG/M |
3300006052|Ga0075029_100236521 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300006174|Ga0075014_100029411 | All Organisms → cellular organisms → Bacteria | 2203 | Open in IMG/M |
3300006755|Ga0079222_10030958 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
3300006755|Ga0079222_11762969 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300006755|Ga0079222_11969251 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300006755|Ga0079222_12598533 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006804|Ga0079221_11525566 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300006806|Ga0079220_10702635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300006806|Ga0079220_10835070 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300006806|Ga0079220_10857157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300006903|Ga0075426_10002373 | All Organisms → cellular organisms → Bacteria | 13498 | Open in IMG/M |
3300006954|Ga0079219_10041769 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
3300006954|Ga0079219_11497808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300007258|Ga0099793_10005621 | All Organisms → cellular organisms → Bacteria | 4551 | Open in IMG/M |
3300007258|Ga0099793_10580601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300009012|Ga0066710_100158884 | All Organisms → cellular organisms → Bacteria | 3157 | Open in IMG/M |
3300009012|Ga0066710_100388192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2077 | Open in IMG/M |
3300009012|Ga0066710_100409888 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
3300009038|Ga0099829_10007621 | All Organisms → cellular organisms → Bacteria | 6793 | Open in IMG/M |
3300009038|Ga0099829_10023661 | All Organisms → cellular organisms → Bacteria | 4266 | Open in IMG/M |
3300009038|Ga0099829_10061392 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
3300009038|Ga0099829_10076860 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
3300009038|Ga0099829_10268809 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300009038|Ga0099829_10562788 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300009038|Ga0099829_11080759 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300009038|Ga0099829_11672687 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300009038|Ga0099829_11759196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300009088|Ga0099830_10050017 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
3300009088|Ga0099830_10975821 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300009088|Ga0099830_11520558 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300009088|Ga0099830_11662559 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300009089|Ga0099828_10046622 | All Organisms → cellular organisms → Bacteria | 3578 | Open in IMG/M |
3300009089|Ga0099828_10401562 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300009090|Ga0099827_10162271 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
3300009090|Ga0099827_10570088 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300009137|Ga0066709_100052875 | All Organisms → cellular organisms → Bacteria | 4605 | Open in IMG/M |
3300009137|Ga0066709_101585169 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300010043|Ga0126380_12210631 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300010046|Ga0126384_10473188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
3300010047|Ga0126382_12053824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300010048|Ga0126373_10003365 | All Organisms → cellular organisms → Bacteria | 11949 | Open in IMG/M |
3300010048|Ga0126373_10071282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3140 | Open in IMG/M |
3300010048|Ga0126373_10185228 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
3300010048|Ga0126373_10444858 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300010321|Ga0134067_10024006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1853 | Open in IMG/M |
3300010323|Ga0134086_10334878 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300010333|Ga0134080_10115170 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300010337|Ga0134062_10056400 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300010358|Ga0126370_10002200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9158 | Open in IMG/M |
3300010358|Ga0126370_10318316 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300010358|Ga0126370_10522149 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300010358|Ga0126370_10737778 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300010358|Ga0126370_10833261 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300010359|Ga0126376_10085959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2354 | Open in IMG/M |
3300010359|Ga0126376_10777564 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300010359|Ga0126376_12264670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300010359|Ga0126376_12916912 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300010360|Ga0126372_10385490 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300010360|Ga0126372_13234785 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300010361|Ga0126378_10277368 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
3300010361|Ga0126378_10608883 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300010361|Ga0126378_11790617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300010361|Ga0126378_12559775 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300010398|Ga0126383_12782069 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300011269|Ga0137392_10557681 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300011269|Ga0137392_10746777 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300011269|Ga0137392_10827761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300011269|Ga0137392_10881674 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300011270|Ga0137391_10204482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1717 | Open in IMG/M |
3300011270|Ga0137391_11225625 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300011270|Ga0137391_11388656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300011271|Ga0137393_10120636 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
3300011271|Ga0137393_10991930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300012096|Ga0137389_10278225 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300012096|Ga0137389_10297345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1366 | Open in IMG/M |
3300012096|Ga0137389_10307043 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300012096|Ga0137389_10823942 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300012096|Ga0137389_10949732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300012096|Ga0137389_11418137 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300012189|Ga0137388_10012606 | All Organisms → cellular organisms → Bacteria | 6050 | Open in IMG/M |
3300012189|Ga0137388_10636487 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300012199|Ga0137383_10883672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300012201|Ga0137365_10029210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4245 | Open in IMG/M |
3300012202|Ga0137363_11573061 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012206|Ga0137380_10109326 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
3300012206|Ga0137380_10685210 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300012207|Ga0137381_10156223 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
3300012207|Ga0137381_10669082 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300012209|Ga0137379_10014199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7606 | Open in IMG/M |
3300012209|Ga0137379_10294112 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
3300012209|Ga0137379_10306401 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
3300012209|Ga0137379_10622148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
3300012209|Ga0137379_10698604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
3300012210|Ga0137378_10431656 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300012210|Ga0137378_10443053 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300012210|Ga0137378_11504990 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300012211|Ga0137377_10186807 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
3300012349|Ga0137387_11282681 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300012351|Ga0137386_10035457 | All Organisms → cellular organisms → Bacteria | 3407 | Open in IMG/M |
3300012354|Ga0137366_10313666 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300012357|Ga0137384_10668253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300012357|Ga0137384_11115880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300012361|Ga0137360_10455717 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300012361|Ga0137360_11867827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300012363|Ga0137390_10101369 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
3300012363|Ga0137390_11107577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
3300012363|Ga0137390_11200482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300012363|Ga0137390_11834914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300012582|Ga0137358_10288038 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300012683|Ga0137398_10001786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8951 | Open in IMG/M |
3300012683|Ga0137398_10045575 | All Organisms → cellular organisms → Bacteria | 2572 | Open in IMG/M |
3300012917|Ga0137395_11063257 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300012918|Ga0137396_10197613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1478 | Open in IMG/M |
3300012931|Ga0153915_10150363 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
3300012948|Ga0126375_10954982 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300012971|Ga0126369_10155760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2154 | Open in IMG/M |
3300012971|Ga0126369_10593169 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300012971|Ga0126369_11088452 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300012975|Ga0134110_10016247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2854 | Open in IMG/M |
3300014150|Ga0134081_10035663 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300014157|Ga0134078_10073195 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300016404|Ga0182037_10067750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2457 | Open in IMG/M |
3300017656|Ga0134112_10247591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300017657|Ga0134074_1133856 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300017961|Ga0187778_10000353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 33116 | Open in IMG/M |
3300017961|Ga0187778_10274497 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300017961|Ga0187778_10848439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300017966|Ga0187776_10354514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
3300017973|Ga0187780_10003932 | All Organisms → cellular organisms → Bacteria | 11159 | Open in IMG/M |
3300017973|Ga0187780_10032846 | All Organisms → cellular organisms → Bacteria | 3656 | Open in IMG/M |
3300017999|Ga0187767_10008088 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
3300018085|Ga0187772_10528321 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300018086|Ga0187769_10127054 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300018431|Ga0066655_10000023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 34894 | Open in IMG/M |
3300018433|Ga0066667_10000435 | All Organisms → cellular organisms → Bacteria | 14050 | Open in IMG/M |
3300018433|Ga0066667_11641613 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300018468|Ga0066662_10273441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
3300018468|Ga0066662_10350220 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300018468|Ga0066662_10634296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
3300018468|Ga0066662_10796040 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300018482|Ga0066669_10014052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4219 | Open in IMG/M |
3300018482|Ga0066669_10415919 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300019360|Ga0187894_10287477 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300020199|Ga0179592_10010203 | All Organisms → cellular organisms → Bacteria | 4057 | Open in IMG/M |
3300020579|Ga0210407_10034949 | All Organisms → cellular organisms → Bacteria | 3738 | Open in IMG/M |
3300020579|Ga0210407_10543030 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300021046|Ga0215015_10585480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
3300021046|Ga0215015_10898449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
3300021086|Ga0179596_10209783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
3300021088|Ga0210404_10025145 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
3300021476|Ga0187846_10053515 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
3300021479|Ga0210410_10000049 | All Organisms → cellular organisms → Bacteria | 201250 | Open in IMG/M |
3300021559|Ga0210409_10201093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1815 | Open in IMG/M |
3300021560|Ga0126371_10002872 | All Organisms → cellular organisms → Bacteria | 14972 | Open in IMG/M |
3300021560|Ga0126371_10063758 | All Organisms → cellular organisms → Bacteria | 3563 | Open in IMG/M |
3300021560|Ga0126371_13636515 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300021560|Ga0126371_13820922 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300026312|Ga0209153_1000131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 39544 | Open in IMG/M |
3300026314|Ga0209268_1047376 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300026317|Ga0209154_1079453 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300026328|Ga0209802_1210607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300026328|Ga0209802_1301754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300026330|Ga0209473_1042499 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
3300026551|Ga0209648_10019164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5981 | Open in IMG/M |
3300026551|Ga0209648_10128251 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
3300026551|Ga0209648_10158312 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300026551|Ga0209648_10162645 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
3300026551|Ga0209648_10428800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300026551|Ga0209648_10574214 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300027643|Ga0209076_1061025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300027655|Ga0209388_1007236 | All Organisms → cellular organisms → Bacteria | 2913 | Open in IMG/M |
3300027671|Ga0209588_1140064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300027725|Ga0209178_1016167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2327 | Open in IMG/M |
3300027765|Ga0209073_10235417 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300027787|Ga0209074_10280401 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300027787|Ga0209074_10546137 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300027835|Ga0209515_10094801 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
3300027842|Ga0209580_10064067 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300027846|Ga0209180_10007303 | All Organisms → cellular organisms → Bacteria | 5623 | Open in IMG/M |
3300027846|Ga0209180_10036963 | All Organisms → cellular organisms → Bacteria | 2652 | Open in IMG/M |
3300027846|Ga0209180_10129477 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300027846|Ga0209180_10155535 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
3300027846|Ga0209180_10644507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300027857|Ga0209166_10001253 | All Organisms → cellular organisms → Bacteria | 21811 | Open in IMG/M |
3300027857|Ga0209166_10118386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1465 | Open in IMG/M |
3300027862|Ga0209701_10014606 | All Organisms → cellular organisms → Bacteria | 5146 | Open in IMG/M |
3300027862|Ga0209701_10173265 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300027874|Ga0209465_10032118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2476 | Open in IMG/M |
3300027874|Ga0209465_10448544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 645 | Open in IMG/M |
3300027875|Ga0209283_10085534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2049 | Open in IMG/M |
3300027882|Ga0209590_10516782 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300027898|Ga0209067_10097911 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300027903|Ga0209488_10253460 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300027903|Ga0209488_10532437 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300027911|Ga0209698_10074700 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
3300027911|Ga0209698_10171014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1771 | Open in IMG/M |
3300030974|Ga0075371_11188412 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031231|Ga0170824_119777203 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1188645 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300031720|Ga0307469_10137364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1803 | Open in IMG/M |
3300031753|Ga0307477_10171614 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300031754|Ga0307475_10125391 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300031754|Ga0307475_10131050 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
3300031754|Ga0307475_10288069 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
3300031954|Ga0306926_10286078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2041 | Open in IMG/M |
3300031959|Ga0318530_10252793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300032001|Ga0306922_11818643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300032180|Ga0307471_100000235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 27898 | Open in IMG/M |
3300032180|Ga0307471_100003528 | All Organisms → cellular organisms → Bacteria | 9404 | Open in IMG/M |
3300032180|Ga0307471_100182029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2074 | Open in IMG/M |
3300032180|Ga0307471_100544075 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300032261|Ga0306920_101157183 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300032783|Ga0335079_10104974 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
3300034178|Ga0364934_0042816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1670 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.52% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.34% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.39% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.39% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.39% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.39% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.39% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.39% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.39% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.39% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.39% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_100735112 | 3300000597 | Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVAERLSTLREEVERLKALLTKGK* |
JGI12648J13191_10027042 | 3300001084 | Forest Soil | MKNLGSVMAAYLASWAIFFVYYWSVGRRVSRLRDDVERLKSTLTKTSRP* |
JGI12635J15846_109036941 | 3300001593 | Forest Soil | MKNLDSVLAAYLAGWAIFFAYYISVARRTAALRKEVERLKQS |
JGI25385J37094_102071361 | 3300002558 | Grasslands Soil | IAKGGGGSMKNLDSVLAAYLAGWAIFFVYYISVSQRMSALRDEVERLKTLLTKGK* |
JGI25382J43887_104675371 | 3300002908 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALRDEVERLKTLLTKGK* |
JGI25388J43891_10000133 | 3300002909 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERLKALLTKGR* |
JGI25617J43924_100395831 | 3300002914 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVARRTAALRKDVERLKESLTRGK* |
JGI25617J43924_101107741 | 3300002914 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFIYYVSVAQRMNTLREQIEQLKNSLNRGK* |
JGI25617J43924_101640472 | 3300002914 | Grasslands Soil | MKNLDSILAAYLAGWAIFFVYYISVAQRMNALHKQIEQLKSSLSRGK* |
JGI25617J43924_103462442 | 3300002914 | Grasslands Soil | MMKNLDSVLAAYLAGWAIFFAYYISVAQRMNTLREQIEQLKNSLSRGK* |
JGI25617J43924_103590722 | 3300002914 | Grasslands Soil | MKNFQSILAAYLAGWAIFFLYYISVAQRMKTLRQEIERLKNSLNRGK |
JGI25616J43925_102131592 | 3300002917 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNTLRDQIEQLKNSLNRGK* |
Ga0066395_100472302 | 3300004633 | Tropical Forest Soil | MKNLDSVLAAYLAAWAIFFVYYISVSQRMGALREEVERLKAMLSKGR* |
Ga0066674_101424751 | 3300005166 | Soil | NLDSVLAAYLAGWAIFFVYYISVAQRLSTLRDEVERLKALLTKGR* |
Ga0066672_100240604 | 3300005167 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSTLREEVERLKAMLNKGK* |
Ga0066672_101119942 | 3300005167 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEVERLKALLSKGK* |
Ga0066677_100014868 | 3300005171 | Soil | MKNLDSVLAAYLAGWAIFFVYYISISQRMSTLREEVERLKALLTKGK* |
Ga0066684_100387225 | 3300005179 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKALL |
Ga0066684_103424721 | 3300005179 | Soil | MKNLDSVLAAYLAVWAIFFVYYISVSQRMSTLREEVERLKAMLNKGK* |
Ga0066676_101284393 | 3300005186 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEIERLKAQLTKGK* |
Ga0066388_1002486191 | 3300005332 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYVSVSRRMSVLREEVERLKNRIGKAKP* |
Ga0066388_1006814493 | 3300005332 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFIYYISVSQRMSALRDEVNRLKSLLNKGK* |
Ga0066388_1014184463 | 3300005332 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMGALREEVERLKTMLAKGSSK* |
Ga0066388_1020268422 | 3300005332 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKMLLSKGK* |
Ga0070713_1021024262 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNLDSVLAAYLAGWAIFFMYYVSVAQRMNTLREQIEQLKNSLNRGK* |
Ga0070710_110067412 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNLDSVLAAYLAGWAIFFMYSVSVAQRMNTLREQIEQLKNSLNRGK* |
Ga0066681_1000005616 | 3300005451 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEIERLKAQLTKGR* |
Ga0066681_100785071 | 3300005451 | Soil | LAAYLAGWAIFFVYYISVSQRMSTLREEVERLKALLSKGSSK* |
Ga0070698_1015114912 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKAQLSK |
Ga0070730_100241993 | 3300005537 | Surface Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMGALREEVERLKTMLSKGKS* |
Ga0066697_102288552 | 3300005540 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSTLREEVERLKALLSKGSSK* |
Ga0070732_100971052 | 3300005542 | Surface Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMTSLREEVERLKAQLSKGK* |
Ga0066661_104802022 | 3300005554 | Soil | FAKGGGGSMKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEVERLKAQLTKGK* |
Ga0066699_100612843 | 3300005561 | Soil | MKNLDSVLAAYLAGWAIFFVYFISVSQRMSTLREEVERLKAMLNKGK* |
Ga0066708_103786641 | 3300005576 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKALLTKGSSK* |
Ga0066654_105819941 | 3300005587 | Soil | SMKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEVERLKALLSKGK* |
Ga0066903_1002785613 | 3300005764 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKALLSKGK* |
Ga0066903_1010194493 | 3300005764 | Tropical Forest Soil | VLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKAQLSKGK* |
Ga0066903_1020858421 | 3300005764 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKASLSKGKT* |
Ga0075298_10315181 | 3300005880 | Rice Paddy Soil | MKNLDSVLAAYLAGWAIFFAYYISVSRRMNTLRDEVERLKN |
Ga0066696_103451721 | 3300006032 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRTSALREEVERLKALLTKGSSK* |
Ga0075029_1000657951 | 3300006052 | Watersheds | MKNLDSVLAAYLAGWVIFFGYYISVSLRMGTLRDEVERLKNQLGRGK* |
Ga0075029_1002365213 | 3300006052 | Watersheds | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNALRGQIEQLKNSLNRGK* |
Ga0075014_1000294111 | 3300006174 | Watersheds | NLDSVLAAYLAGWAIFFVYYISVAQRMNTLRQQIEQLKNSLNRGK* |
Ga0079222_100309584 | 3300006755 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSTLREEVERLKAMLGKGK* |
Ga0079222_117629692 | 3300006755 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMGALREEVERLKAMLAKGSSK* |
Ga0079222_119692512 | 3300006755 | Agricultural Soil | GGFAKGGGGSMKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKAMLSKGKP* |
Ga0079222_125985332 | 3300006755 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKTLLNKGK* |
Ga0079221_115255661 | 3300006804 | Agricultural Soil | LAGWAIFFVYYISVSQRMSSLREEVERLKAQLSKGR* |
Ga0079220_107026351 | 3300006806 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFIYYVSVAQRMSTLRDEVERLKA |
Ga0079220_108350702 | 3300006806 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKAMLSKGR* |
Ga0079220_108571571 | 3300006806 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMTSLREEVERLKAMLSKGK* |
Ga0075426_1000237313 | 3300006903 | Populus Rhizosphere | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKAQLSKGR* |
Ga0079219_100417693 | 3300006954 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMGALREEVERLKTMLAKGGSK* |
Ga0079219_114978082 | 3300006954 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVER |
Ga0099793_100056215 | 3300007258 | Vadose Zone Soil | MKNLDSILAAYLAGWAIFFVYYVSVAQRMNALHKQIEQLKSSLSRGK* |
Ga0099793_105806012 | 3300007258 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVARRTADLRKDIERLKESLARGK* |
Ga0066710_1001588842 | 3300009012 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLHRGK |
Ga0066710_1003881924 | 3300009012 | Grasslands Soil | AAYLAGWAIFFVYYISVSQRMSTLREEVERLKALLSKGSSK |
Ga0066710_1004098884 | 3300009012 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEIEQLKAQWTKGR |
Ga0099829_100076217 | 3300009038 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNSLREQIEQLKNSLNRGK* |
Ga0099829_100236615 | 3300009038 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLHRSK* |
Ga0099829_100613922 | 3300009038 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRAEALRKEIDRLKNSLSRSK* |
Ga0099829_100768602 | 3300009038 | Vadose Zone Soil | VKNLDSVLAAYLAGWAIFFVYYISVARRMNSLREEIEELKNSLRRDK* |
Ga0099829_102688092 | 3300009038 | Vadose Zone Soil | MKNFQSILAAYLAGWAIFFLYYISVAQRMKTLRQEIERLKNSLNRGK* |
Ga0099829_105627882 | 3300009038 | Vadose Zone Soil | MKNLDSVLVAYLAGWAIFFFFYLSVERRTAALRGELDRLRKLVEKGK* |
Ga0099829_110807592 | 3300009038 | Vadose Zone Soil | MKNFDSILAAYLAGWAIFFLYFISVSKRMKTLRQDIERLKNSLSRSK* |
Ga0099829_116726872 | 3300009038 | Vadose Zone Soil | MKDLDSVLAAYLAGWAIFFVYYISVSQRMSALRDEVERLKTLLNKGK* |
Ga0099829_117591961 | 3300009038 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLHRGK* |
Ga0099830_100500175 | 3300009088 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRAEALRKEIERLKNSLSRSK* |
Ga0099830_109758212 | 3300009088 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALRDEVERLKTLLSKGK* |
Ga0099830_115205582 | 3300009088 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVEHLKALLTKGK* |
Ga0099830_116625592 | 3300009088 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALSEEIERLKSSLHRGK* |
Ga0099828_100466222 | 3300009089 | Vadose Zone Soil | MRNLDSVLAAYLAGWAIFFVYYISVARRTAALRKDVERLKESLTRGK* |
Ga0099828_104015622 | 3300009089 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLSRGK* |
Ga0099827_101622712 | 3300009090 | Vadose Zone Soil | MKNFDSILAAYLAGWAIFFLYYVSVSKRMNTLRQEIERLKNSLSRSK* |
Ga0099827_105700881 | 3300009090 | Vadose Zone Soil | SVLAAYLAGWAIFFLYYVSVARRMNALHEEIERLKSSLHRGK* |
Ga0066709_1000528755 | 3300009137 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEIEQLKAQWTKGR* |
Ga0066709_1015851692 | 3300009137 | Grasslands Soil | GLAKGGGGSMKNLDSVLAAYLAGWAIFFVYYISVSQRMSTLREEVERLKALLSKGSSK* |
Ga0126380_122106311 | 3300010043 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFIYYISVSQRMSALRDEV |
Ga0126384_104731882 | 3300010046 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFIYHVSVSRRMSVLRDEVDRLKSLLNKGK* |
Ga0126382_120538241 | 3300010047 | Tropical Forest Soil | NLDSVLAAYLAGWAIFFIYYVSVSRRMSVLREEVERLKALLNKGK* |
Ga0126373_100033659 | 3300010048 | Tropical Forest Soil | MKNLDSVLAAYLAAWAIFFVYYISVAQRMGALREEVERLKAMLSKGR* |
Ga0126373_100712824 | 3300010048 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVDRLKALLNKGK* |
Ga0126373_101852283 | 3300010048 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERLKALLTKGK* |
Ga0126373_104448582 | 3300010048 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYVSVSRRMSVLRDEVERLKGLLSKGK* |
Ga0134067_100240064 | 3300010321 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKAMLSKGSSK* |
Ga0134086_103348782 | 3300010323 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLHRGK* |
Ga0134080_101151703 | 3300010333 | Grasslands Soil | MKNLDSVLAAYLAGCAIFFLYYVSVARRMNALREEIERLKSSLHRGK* |
Ga0134062_100564002 | 3300010337 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLRDEVERLKALLTKGR* |
Ga0126370_100022008 | 3300010358 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKTLLSRGK* |
Ga0126370_103183162 | 3300010358 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFIYYVSISRRMSVLRDEVDRLKSLLNKGK* |
Ga0126370_105221492 | 3300010358 | Tropical Forest Soil | RGGFAKGGGGSMKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVDRLKALLNKGK* |
Ga0126370_107377782 | 3300010358 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKASLSKGKTSDQF* |
Ga0126370_108332612 | 3300010358 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKTMLGKGK* |
Ga0126376_100859591 | 3300010359 | Tropical Forest Soil | ARQRRGIAKRGGGAMKNLDSVLAAYLAGWAIFFIYYVSVSRRMSVLRDEVDRLKSLLNKGK* |
Ga0126376_107775642 | 3300010359 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMGALREEVERLKTLLSKGK* |
Ga0126376_122646701 | 3300010359 | Tropical Forest Soil | GWAIFFVYYVSVSRRMSVLRDEVERLKAQLNKGK* |
Ga0126376_129169122 | 3300010359 | Tropical Forest Soil | VKEHLGSILAAYLVGWAVFFAFYVSVARRMSALRDEVERLKNSIGKGK* |
Ga0126372_103854902 | 3300010360 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKTMMSKGK* |
Ga0126372_132347852 | 3300010360 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYVSVSRRMSVLRDEVERLKSLLSKGK* |
Ga0126378_102773682 | 3300010361 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYVSVSRRMSVLRDEVERLKALLSKGK* |
Ga0126378_106088832 | 3300010361 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSTLREEVERLKAMLSKGK* |
Ga0126378_117906171 | 3300010361 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVAERLSTLREEVERLKAQLTKGK* |
Ga0126378_125597751 | 3300010361 | Tropical Forest Soil | MKNFNSILAAYLAGWAIFFVYYISVSQRMGALREEVERLKAMLAKGS |
Ga0126383_127820692 | 3300010398 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMGALREEVERLKAMLSKGK* |
Ga0137392_105576812 | 3300011269 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLNRGK* |
Ga0137392_107467772 | 3300011269 | Vadose Zone Soil | MKNLDSILAAYLAGWAIFFLYFISVSRRMRTLRQDIERLKNSLSRSK* |
Ga0137392_108277612 | 3300011269 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLSRGK* |
Ga0137392_108816742 | 3300011269 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEVERLKTLLSKGK* |
Ga0137391_102044823 | 3300011270 | Vadose Zone Soil | MKNFDSILAAYLGGWAIFFLYFISVSRRMNTLRQEIERLKNSLSRSK* |
Ga0137391_112256252 | 3300011270 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLNRGK* |
Ga0137391_113886561 | 3300011270 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNALREQIEQLKNT |
Ga0137393_101206362 | 3300011271 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALHEEIERLKSSLHRGK* |
Ga0137393_109919302 | 3300011271 | Vadose Zone Soil | VLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLHRGK* |
Ga0137389_102782251 | 3300012096 | Vadose Zone Soil | GSIARQRRGFAQGGGGSMKNLDSVLAAYLAGWAIFFVYYISVSQRISTLREEVEHLKALLTKGK* |
Ga0137389_102973453 | 3300012096 | Vadose Zone Soil | MKNLNSVLAAYLAGWAIFFLYYVSVARRAEALRKEIDRLKNSLSRSK* |
Ga0137389_103070431 | 3300012096 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFMYYVSVAQRMNTLREQIEQLKN |
Ga0137389_108239422 | 3300012096 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIELLKSSLHRGK* |
Ga0137389_109497321 | 3300012096 | Vadose Zone Soil | LAGWAIFFVYYVSVAARMIAKNKQIEQLKSSLSRGK* |
Ga0137389_114181372 | 3300012096 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVARRTSALREEIERLKSQLNRGK* |
Ga0137388_100126063 | 3300012189 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRAEALRKESERLKNSLSRSK* |
Ga0137388_106364872 | 3300012189 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLFYLTIERRTAALRGEIARLKRLVEKGK* |
Ga0137383_108836722 | 3300012199 | Vadose Zone Soil | LAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLHRGK* |
Ga0137365_100292101 | 3300012201 | Vadose Zone Soil | KNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLHRGK* |
Ga0137363_115730612 | 3300012202 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLDRGK* |
Ga0137380_101093263 | 3300012206 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEVERLKALLTKGK* |
Ga0137380_106852102 | 3300012206 | Vadose Zone Soil | LAGWAIFFVYYISVSQRMSSLREEVERLKTQLSKGK* |
Ga0137381_101562232 | 3300012207 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALHEEVERLKMLLSKGK* |
Ga0137381_106690822 | 3300012207 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIAQRMNALREEIERLKSSLHRGK* |
Ga0137379_100141992 | 3300012209 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKTQLSKGK* |
Ga0137379_102941122 | 3300012209 | Vadose Zone Soil | MKNLDSVLAAYLTGWAIFFLYYVSVARRMNALREEIERLKSSLHRGK* |
Ga0137379_103064011 | 3300012209 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIAQRMNALREEIER |
Ga0137379_106221482 | 3300012209 | Vadose Zone Soil | PMKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLNRGK* |
Ga0137379_106986043 | 3300012209 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERL |
Ga0137378_104316562 | 3300012210 | Vadose Zone Soil | MKNFDSILAAYLAGWAIFFLYYVSVSKRMNTLRQEIERLKNSLSRGK* |
Ga0137378_104430531 | 3300012210 | Vadose Zone Soil | AAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLHRGK* |
Ga0137378_115049901 | 3300012210 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKS |
Ga0137377_101868071 | 3300012211 | Vadose Zone Soil | GGGPMKNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLHRGK* |
Ga0137387_112826812 | 3300012349 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLQRGK* |
Ga0137386_100354574 | 3300012351 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKTLLSKGK* |
Ga0137366_103136661 | 3300012354 | Vadose Zone Soil | DSVLAAYLAGWAIFFLYYVSIAQRMNALREEIERLKSSLHRGK* |
Ga0137384_106682532 | 3300012357 | Vadose Zone Soil | AYLAGWAIFFLYYVSVSKRMNTLRQEIERLKNSLSRSK* |
Ga0137384_111158802 | 3300012357 | Vadose Zone Soil | DSILAAYLAGWAIFFLYYVSVSKRMNTLRQEIERLKNSLSRGK* |
Ga0137360_104557172 | 3300012361 | Vadose Zone Soil | MKNLDSVLAAYLGGWAIFFVYYISVAQRMNTLRDQIEQLKNSLNRGK* |
Ga0137360_118678272 | 3300012361 | Vadose Zone Soil | MKNFDSILAAYLAGWAIFFLYFISVSKRMNTLRQEIERLKNSLGRGK* |
Ga0137390_101013695 | 3300012363 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNALREQIEQLKNTLNRGK* |
Ga0137390_111075772 | 3300012363 | Vadose Zone Soil | TAKRGGSPMKNFDSILAAYLAGWAIFFLYFISVSKRMKTLRQDIERLKNSLSRSK* |
Ga0137390_112004821 | 3300012363 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALRDEVERLKTLLNKGK* |
Ga0137390_118349142 | 3300012363 | Vadose Zone Soil | MKNLDSVLAAYLAGWAILFVYYISVEEGMSTMREEVERLKTLLSKGK* |
Ga0137358_102880382 | 3300012582 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFMYYVSVAHRMNTQREQIEQLKNSLNRGK* |
Ga0137398_100017864 | 3300012683 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNTLRDQVEQLKNSLNRGK* |
Ga0137398_100455753 | 3300012683 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFMYYVSVAQRMNTLREQIEQLKSSLNRGK* |
Ga0137395_110632572 | 3300012917 | Vadose Zone Soil | MKNFDSILAAYLAGWAIFFLYFISVSRRMKTLRQDIERLKNSLSRGK* |
Ga0137396_101976131 | 3300012918 | Vadose Zone Soil | MKNLDSILAAYLAGWAIFFVYYVSVAQRMNALHKQIEQLKSSLS |
Ga0153915_101503632 | 3300012931 | Freshwater Wetlands | MKNLDSVLAAYLAGWAIFFAYYISVSRRMNTLRDEVERLKNLLNRGK* |
Ga0126375_109549822 | 3300012948 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFIYYVSVSRRMSVLREEVERLKALLNKGK* |
Ga0126369_101557604 | 3300012971 | Tropical Forest Soil | AYLAGWAIFFVYYISVAQRLSTLREEVERLKALLTKGK* |
Ga0126369_105931692 | 3300012971 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFIYYVSVSRRMSVLRDEVDRLKSLLNKGK* |
Ga0126369_110884522 | 3300012971 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKAQLSKGK* |
Ga0134110_100162471 | 3300012975 | Grasslands Soil | AYLAGWAIFFVYYISVSQRMSTLREEVERLKALLSKGSSK* |
Ga0134081_100356631 | 3300014150 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERLKA |
Ga0134078_100731951 | 3300014157 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRRSTLREEIERLKAQLTKGK* |
Ga0182037_100677504 | 3300016404 | Soil | RFAKGGGGSMKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERLKALLTKGK |
Ga0134112_102475912 | 3300017656 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSL |
Ga0134074_11338562 | 3300017657 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEIERLKAQLTKGK |
Ga0187778_1000035314 | 3300017961 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFLYYVSVARRMSSLRDEVERLKGLLNKGE |
Ga0187778_102744972 | 3300017961 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFVYYISVARRMSTLSEEIERLKALLNKGK |
Ga0187778_108484392 | 3300017961 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFLYYVSVARRMSSLRDEVERLKG |
Ga0187776_103545142 | 3300017966 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFLYYVSVSRRMSTLRDEVERLKGLLKKGK |
Ga0187780_100039324 | 3300017973 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFLYYVSVARRMSNLRDEVERLKGLLSKRK |
Ga0187780_100328462 | 3300017973 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFLYYVSVARRMSSLRDEVERLKGLLNKGK |
Ga0187767_100080882 | 3300017999 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFLFYLSVERRAAALRAEIERLKKLVEKGR |
Ga0187772_105283212 | 3300018085 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFLYYVSVARRMSSLRDEVERLKALLSKGK |
Ga0187769_101270543 | 3300018086 | Tropical Peatland | MKNLDSVLAAYLAGWAIFFLYYVSVARRMSSLRDEVERLKGLLSKGK |
Ga0066655_1000002322 | 3300018431 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERLKALLTKGR |
Ga0066667_1000043511 | 3300018433 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISISQRMSTLREEVERLKALLTKGK |
Ga0066667_116416131 | 3300018433 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERL |
Ga0066662_102734412 | 3300018468 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALRDEVERLKTLLTKGK |
Ga0066662_103502201 | 3300018468 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALREEIERLKSSLNRGK |
Ga0066662_106342961 | 3300018468 | Grasslands Soil | NLDSVLAAYLAGWAIFFLYYVSVARRAEALRKEIDRLKNSLSRSK |
Ga0066662_107960402 | 3300018468 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSTLREEVERLKAMLNKGK |
Ga0066669_100140522 | 3300018482 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLRDEVERLKALLTKGR |
Ga0066669_104159192 | 3300018482 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSTLREEVERLKALLSKGSSK |
Ga0187894_102874772 | 3300019360 | Microbial Mat On Rocks | VKNLNSLFAAYLLGWAIFFVYYLSVGRRMASLRDEVERLKQVLKRGQ |
Ga0179592_100102035 | 3300020199 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFMYYVSVAQRMNTLREQIEQLKSSLNRGK |
Ga0210407_100349493 | 3300020579 | Soil | MKNLDSVLAAYLAGWAIFFVYYVTIARRMATLRDEIERLKDSLNRGK |
Ga0210407_105430302 | 3300020579 | Soil | MKNLDSVLAAYLAGWAIFFVYYVTIARRMATLRDEIEELKNSLNRGK |
Ga0215015_105854801 | 3300021046 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALRDEVERLKTLLSKGK |
Ga0215015_108984492 | 3300021046 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVARRTAALRKDVERLKESLTRGK |
Ga0179596_102097832 | 3300021086 | Vadose Zone Soil | MKNFDSILAAYLAGWAIFFLYFISVSKRMKTLRQDIERLKNSLSRSK |
Ga0210404_100251452 | 3300021088 | Soil | MKNFDSILAAYLAGWAIFFVYYVSVSLRMNTLRDEIARLKSVLNRGK |
Ga0187846_100535152 | 3300021476 | Biofilm | MKNLDSVLAAYLAGWAIFLVYYVSVAQRMSALREEVERLKALLTKGK |
Ga0210410_10000049151 | 3300021479 | Soil | MKNLDSVLAAYLAGWAIFFVYYVSVAQRMSTLREEVERLKSLLTKGK |
Ga0210409_102010932 | 3300021559 | Soil | MKNLDSVLAAYLAGWAIFFVYFVSISQRMNTLREEIERLKNSLNRGK |
Ga0126371_100028722 | 3300021560 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERLKALLTKGK |
Ga0126371_100637582 | 3300021560 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKAQLSKGK |
Ga0126371_136365151 | 3300021560 | Tropical Forest Soil | LDSVLAAYLAGWAIFFVYYISVSQRMGALRDEVERLKAMLSKGK |
Ga0126371_138209222 | 3300021560 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKASLSKGKTSDQF |
Ga0209153_10001312 | 3300026312 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEVERLKALLSKGK |
Ga0209268_10473763 | 3300026314 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEIERLKAQLTKGR |
Ga0209154_10794532 | 3300026317 | Soil | MKNLDSVLAAYLAGWAIFFVYFISVSQRMSTLREEVERLKAMLNKGK |
Ga0209802_12106072 | 3300026328 | Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLHRGK |
Ga0209802_13017541 | 3300026328 | Soil | LRGTAERGGSSMKNFDSILAAYLAGWAIFFLYHISVARRMKTLHEEIERLKNSLSRGK |
Ga0209473_10424994 | 3300026330 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKALLTKGSSK |
Ga0209648_100191648 | 3300026551 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFIYYVSVAQRMNTLREQIEQLKNSLNRGK |
Ga0209648_101282513 | 3300026551 | Grasslands Soil | MKNFDSILAAYLAGWAIFFLYYISIDKRMKTLREEIERLKNSLSRGK |
Ga0209648_101583122 | 3300026551 | Grasslands Soil | MMKNLDSVLAAYLAGWAIFFAYYISVAQRMNTLREQIEQLKNSLSRGK |
Ga0209648_101626452 | 3300026551 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNSLREQIEQLKNSLNRGK |
Ga0209648_104288002 | 3300026551 | Grasslands Soil | MKNLDSILAAYLAGWAIFFVYYISVAQRMNALHKQIEQLKSSLSRGK |
Ga0209648_105742142 | 3300026551 | Grasslands Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIEGLKSSLHRGK |
Ga0209076_10610253 | 3300027643 | Vadose Zone Soil | MKNLDSILAAYLAGWAIFFVYYVSVAQRMNALHKQIEQLKSSLSRGK |
Ga0209388_10072361 | 3300027655 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFMYYVSVAQRMNTLREQIEQL |
Ga0209588_11400642 | 3300027671 | Vadose Zone Soil | MKNLDSILAAYLAGWAIFFVYYISVAQRMNALREQIEQLKSSLSRGK |
Ga0209178_10161673 | 3300027725 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMGALREEVERLKAMLAKGSSK |
Ga0209073_102354172 | 3300027765 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKAMLSKGR |
Ga0209074_102804012 | 3300027787 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKAMLSKGKP |
Ga0209074_105461372 | 3300027787 | Agricultural Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSALREEVERLKTLLNKGK |
Ga0209515_100948012 | 3300027835 | Groundwater | MKNLESVLAAYLAGWAIFFLFYLSVERRTAALREEIERLKQLVRKGR |
Ga0209580_100640672 | 3300027842 | Surface Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMTSLREEVERLKAQLSKGK |
Ga0209180_100073034 | 3300027846 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLHRSK |
Ga0209180_100369632 | 3300027846 | Vadose Zone Soil | VKNLDSVLAAYLAGWAIFFVYYISVARRMNSLREEIEELKNSLRRDK |
Ga0209180_101294772 | 3300027846 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRAEALRKEIERLKNSLSRSK |
Ga0209180_101555352 | 3300027846 | Vadose Zone Soil | MKNFDSILAAYLAGWAIFFLYFISVSRRMKTLRQDIERLKNSLSRGK |
Ga0209180_106445072 | 3300027846 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMNALHEEIERLKSSLHRGK |
Ga0209166_1000125317 | 3300027857 | Surface Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMGALREEVERLKTMLSKGKS |
Ga0209166_101183863 | 3300027857 | Surface Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMGALREEVERLKTMLSKGSSK |
Ga0209701_100146064 | 3300027862 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRAEALRKEIDRLKNSLSRSK |
Ga0209701_101732651 | 3300027862 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALSEEIERLK |
Ga0209465_100321183 | 3300027874 | Tropical Forest Soil | MKNLDSVLAAYLAAWAIFFVYYISVSQRMGALREEVERLKAMLSKGR |
Ga0209465_104485443 | 3300027874 | Tropical Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKALLSKGK |
Ga0209283_100855342 | 3300027875 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFLYYVSIARRMNALREEIERLKSSLSRGK |
Ga0209590_105167822 | 3300027882 | Vadose Zone Soil | MKNFDSILAAYLAGWAIFFLYYVSVSKRMNTLRQEIERLKNSLSRSK |
Ga0209067_100979113 | 3300027898 | Watersheds | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNALRGQIEQLKNSLNRGK |
Ga0209488_102534603 | 3300027903 | Vadose Zone Soil | MKNLDSILAAYLAGWAIFFLYFISVSRRMRTLRQDIERLKNSLSRSK |
Ga0209488_105324372 | 3300027903 | Vadose Zone Soil | MKNLDSVLAAYLAGWAIFFMYYVSVAQRMNTLREQIEQLKKSLNRGK |
Ga0209698_100747004 | 3300027911 | Watersheds | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNTLRQQIEQLKNSLNRGK |
Ga0209698_101710142 | 3300027911 | Watersheds | MKNLDSVLAAYLAGWVIFFGYYISVSLRMGTLRDEVERLKNQLGRGK |
Ga0075371_111884121 | 3300030974 | Soil | MKNLDSVLAAYLAGWAIFFMYYISVAQRMNTLREQIEQLKNSLNRGK |
Ga0170824_1197772032 | 3300031231 | Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMNSLRDQIEQLKNSLNRGK |
(restricted) Ga0255312_11886452 | 3300031248 | Sandy Soil | MKNLDSVLAAYLAGWAIFFLFYLSIERRTAALRGEIERLKKLVEKGK |
Ga0307469_101373642 | 3300031720 | Hardwood Forest Soil | MKNLDSVLAAYLAGWAIFFVYYVTIARRMATLRDEIERLKNSLNRGK |
Ga0307477_101716142 | 3300031753 | Hardwood Forest Soil | MKNFDSILAAYLAGWAIFFVYYISVARRMRSLGEEVERLKALLNRGK |
Ga0307475_101253913 | 3300031754 | Hardwood Forest Soil | MKNLDSVLAAYLAGWAIFFVYFISVSRRMSSLRKEIEQLKNTLSRGK |
Ga0307475_101310503 | 3300031754 | Hardwood Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRMSTLREEVERLKSLLTKGK |
Ga0307475_102880692 | 3300031754 | Hardwood Forest Soil | MKNLDSVLAAYLAGWAIFFVYYVSVAHRMSALREEVERLKGLLNKGK |
Ga0306926_102860781 | 3300031954 | Soil | GSMKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERLKALLTKGR |
Ga0318530_102527931 | 3300031959 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERLK |
Ga0306922_118186432 | 3300032001 | Soil | MKNLDSVLAAYLAGWAIFFVYYVSVSQRMSALREEVERLKTLLNKGK |
Ga0307471_10000023530 | 3300032180 | Hardwood Forest Soil | MKNLDSVLAAYLAGWAIFFVYYISVSQRMSSLREEVERLKAQLNKGKP |
Ga0307471_1000035284 | 3300032180 | Hardwood Forest Soil | MKNFDSILAAYLAGWAIFFIYYISVSRRMNTLRDEIARLKSVLSRGK |
Ga0307471_1001820293 | 3300032180 | Hardwood Forest Soil | MKNLDSVLAAYLAGWAIFFVYYVTIARRMATLRDEIEQLKNSLNRGK |
Ga0307471_1005440751 | 3300032180 | Hardwood Forest Soil | RRRIAKRSGGAMKNLDSVLAAYLAGWAIFFVYYVTIARRMATLRDEIERLKNSLNRGK |
Ga0306920_1011571833 | 3300032261 | Soil | MKNLDSVLAAYLAGWAIFFVYYISVAQRLSTLREEVERL |
Ga0335079_101049743 | 3300032783 | Soil | MKNLDSVLAAYLAGWAIFFLYYVSVARRMSSLRDEVERLKALVSKGK |
Ga0364934_0042816_34_177 | 3300034178 | Sediment | MKNLNSVFAAYLLGWAIFFVYYLSVGRRMASLRDEVERLKQVLKRGQ |
⦗Top⦘ |