NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F015201

Metagenome / Metatranscriptome Family F015201

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015201
Family Type Metagenome / Metatranscriptome
Number of Sequences 256
Average Sequence Length 38 residues
Representative Sequence MNKALIVYLVNQKKKQARKDVESKHAVTELKKQSAATF
Number of Associated Samples 143
Number of Associated Scaffolds 256

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 80.86 %
% of genes near scaffold ends (potentially truncated) 19.53 %
% of genes from short scaffolds (< 2000 bps) 69.92 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (48.047 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(26.172 % of family members)
Environment Ontology (ENVO) Unclassified
(39.453 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(47.656 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.03%    β-sheet: 0.00%    Coil/Unstructured: 46.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 256 Family Scaffolds
PF02511Thy1 56.64
PF14284PcfJ 3.12
PF13482RNase_H_2 2.34
PF00436SSB 1.95
PF01050MannoseP_isomer 1.56
PF00476DNA_pol_A 1.56
PF00908dTDP_sugar_isom 0.39
PF04014MazE_antitoxin 0.39
PF13392HNH_3 0.39
PF02945Endonuclease_7 0.39
PF00856SET 0.39
PF00210Ferritin 0.39
PF13936HTH_38 0.39
PF13439Glyco_transf_4 0.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 256 Family Scaffolds
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 56.64
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 1.95
COG2965Primosomal replication protein NReplication, recombination and repair [L] 1.95
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 1.56
COG1898dTDP-4-dehydrorhamnose 3,5-epimerase or related enzymeCell wall/membrane/envelope biogenesis [M] 0.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.95 %
UnclassifiedrootN/A48.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10002153Not Available11641Open in IMG/M
3300000116|DelMOSpr2010_c10005981Not Available6657Open in IMG/M
3300000116|DelMOSpr2010_c10008538All Organisms → cellular organisms → Bacteria5448Open in IMG/M
3300000116|DelMOSpr2010_c10066958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1479Open in IMG/M
3300000116|DelMOSpr2010_c10093879Not Available1150Open in IMG/M
3300000116|DelMOSpr2010_c10132364All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl881Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10175295All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl512Open in IMG/M
3300000126|BS_KBB_SWE26_205mDRAFT_c1003142All Organisms → Viruses → Predicted Viral3052Open in IMG/M
3300000882|FwDRAFT_10047878Not Available826Open in IMG/M
3300001213|JGIcombinedJ13530_108334095Not Available852Open in IMG/M
3300001687|WOR8_10020328Not Available6287Open in IMG/M
3300005346|Ga0074242_11110431All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.2698Open in IMG/M
3300005517|Ga0070374_10614243Not Available539Open in IMG/M
3300005527|Ga0068876_10000190Not Available47410Open in IMG/M
3300005527|Ga0068876_10285568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.939Open in IMG/M
3300005527|Ga0068876_10301011Not Available910Open in IMG/M
3300005662|Ga0078894_10524633Not Available1061Open in IMG/M
3300005662|Ga0078894_10878198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.779Open in IMG/M
3300005805|Ga0079957_1143257Not Available1227Open in IMG/M
3300006025|Ga0075474_10183450Not Available647Open in IMG/M
3300006026|Ga0075478_10002886Not Available6229Open in IMG/M
3300006026|Ga0075478_10079481Not Available1056Open in IMG/M
3300006026|Ga0075478_10133257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage PSS2781Open in IMG/M
3300006030|Ga0075470_10010970Not Available2794Open in IMG/M
3300006734|Ga0098073_1003096All Organisms → Viruses → Predicted Viral3879Open in IMG/M
3300006734|Ga0098073_1008373All Organisms → Viruses → Predicted Viral1861Open in IMG/M
3300006734|Ga0098073_1017307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Lirvirus → Synechococcus virus SCBP31115Open in IMG/M
3300006734|Ga0098073_1046427Not Available585Open in IMG/M
3300006802|Ga0070749_10061831All Organisms → Viruses2258Open in IMG/M
3300006802|Ga0070749_10070550Not Available2096Open in IMG/M
3300006802|Ga0070749_10111954All Organisms → Viruses → Predicted Viral1608Open in IMG/M
3300006802|Ga0070749_10178344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1225Open in IMG/M
3300006802|Ga0070749_10206317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1124Open in IMG/M
3300006802|Ga0070749_10231437Not Available1051Open in IMG/M
3300006802|Ga0070749_10314992All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl875Open in IMG/M
3300006810|Ga0070754_10007117Not Available7359Open in IMG/M
3300006810|Ga0070754_10443763All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl563Open in IMG/M
3300006867|Ga0075476_10091274Not Available1178Open in IMG/M
3300006867|Ga0075476_10347305Not Available514Open in IMG/M
3300006869|Ga0075477_10024826All Organisms → cellular organisms → Bacteria2770Open in IMG/M
3300006869|Ga0075477_10331197Not Available601Open in IMG/M
3300006870|Ga0075479_10057778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1647Open in IMG/M
3300006916|Ga0070750_10132584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1137Open in IMG/M
3300006919|Ga0070746_10017040All Organisms → Viruses → Predicted Viral4032Open in IMG/M
3300006919|Ga0070746_10320926Not Available707Open in IMG/M
3300007214|Ga0103959_1138040All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300007344|Ga0070745_1073402Not Available1369Open in IMG/M
3300007538|Ga0099851_1001144Not Available11221Open in IMG/M
3300007538|Ga0099851_1017333Not Available2924Open in IMG/M
3300007538|Ga0099851_1019725All Organisms → Viruses → Predicted Viral2725Open in IMG/M
3300007538|Ga0099851_1066034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1407Open in IMG/M
3300007538|Ga0099851_1083382Not Available1229Open in IMG/M
3300007538|Ga0099851_1110840Not Available1041Open in IMG/M
3300007538|Ga0099851_1196516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.735Open in IMG/M
3300007538|Ga0099851_1278282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes594Open in IMG/M
3300007539|Ga0099849_1095857All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae1186Open in IMG/M
3300007541|Ga0099848_1006260Not Available5433Open in IMG/M
3300007541|Ga0099848_1043138Not Available1840Open in IMG/M
3300007541|Ga0099848_1240592Not Available636Open in IMG/M
3300007541|Ga0099848_1279153Not Available578Open in IMG/M
3300007541|Ga0099848_1297333Not Available555Open in IMG/M
3300007542|Ga0099846_1104976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1038Open in IMG/M
3300007640|Ga0070751_1220745All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium729Open in IMG/M
3300007960|Ga0099850_1057518Not Available1649Open in IMG/M
3300007960|Ga0099850_1139366All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl982Open in IMG/M
3300007973|Ga0105746_1236147Not Available628Open in IMG/M
3300008055|Ga0108970_10410472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1144Open in IMG/M
3300008120|Ga0114355_1055013Not Available1784Open in IMG/M
3300008120|Ga0114355_1096562Not Available1173Open in IMG/M
3300008262|Ga0114337_1128337Not Available1134Open in IMG/M
3300009001|Ga0102963_1029150All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon2310Open in IMG/M
3300009009|Ga0105105_10233964Not Available967Open in IMG/M
3300009009|Ga0105105_10414061Not Available754Open in IMG/M
3300009027|Ga0102957_1095568Not Available1033Open in IMG/M
3300009075|Ga0105090_10664179Not Available633Open in IMG/M
3300009165|Ga0105102_10481743Not Available671Open in IMG/M
3300009165|Ga0105102_10517968Not Available649Open in IMG/M
3300009169|Ga0105097_10080679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1771Open in IMG/M
3300009170|Ga0105096_10538011Not Available610Open in IMG/M
3300009450|Ga0127391_1001591All Organisms → Viruses5110Open in IMG/M
3300009492|Ga0127412_10007799Not Available1020Open in IMG/M
3300009492|Ga0127412_10009976Not Available922Open in IMG/M
3300009492|Ga0127412_10022647All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl679Open in IMG/M
3300010296|Ga0129348_1177291Not Available730Open in IMG/M
3300010296|Ga0129348_1179372Not Available726Open in IMG/M
3300010297|Ga0129345_1268928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4594Open in IMG/M
3300010299|Ga0129342_1186786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.741Open in IMG/M
3300010354|Ga0129333_10006122Not Available11372Open in IMG/M
3300010354|Ga0129333_10048597All Organisms → Viruses3980Open in IMG/M
3300010354|Ga0129333_10056286All Organisms → cellular organisms → Bacteria3673Open in IMG/M
3300010354|Ga0129333_10337548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H11342Open in IMG/M
3300010354|Ga0129333_10345628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1324Open in IMG/M
3300010354|Ga0129333_10443867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1143Open in IMG/M
3300010354|Ga0129333_10590678Not Available965Open in IMG/M
3300010354|Ga0129333_10712570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → Actinomyces procaprae862Open in IMG/M
3300010354|Ga0129333_10739686All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.843Open in IMG/M
3300010354|Ga0129333_10741630All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.841Open in IMG/M
3300010354|Ga0129333_11220423Not Available624Open in IMG/M
3300010354|Ga0129333_11276403Not Available607Open in IMG/M
3300010354|Ga0129333_11349497All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.588Open in IMG/M
3300010354|Ga0129333_11755714Not Available504Open in IMG/M
3300010370|Ga0129336_10092013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1782Open in IMG/M
3300010370|Ga0129336_10288366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP1915Open in IMG/M
3300010389|Ga0136549_10030937Not Available3006Open in IMG/M
3300011984|Ga0119931_1018611All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300012000|Ga0119951_1025684Not Available2011Open in IMG/M
3300012013|Ga0153805_1058045All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl655Open in IMG/M
3300013087|Ga0163212_1153302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.728Open in IMG/M
(restricted) 3300013126|Ga0172367_10140928Not Available1609Open in IMG/M
(restricted) 3300013131|Ga0172373_10177479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1477Open in IMG/M
(restricted) 3300013137|Ga0172375_10038482Not Available4897Open in IMG/M
3300014050|Ga0119952_1004598Not Available6698Open in IMG/M
(restricted) 3300014720|Ga0172376_10288204Not Available987Open in IMG/M
3300014801|Ga0119946_1017361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2739Open in IMG/M
3300016697|Ga0180057_1058949All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS41133Open in IMG/M
3300017707|Ga0181363_1001643All Organisms → cellular organisms → Bacteria5282Open in IMG/M
3300017747|Ga0181352_1015684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.2394Open in IMG/M
3300017785|Ga0181355_1214374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2751Open in IMG/M
3300017788|Ga0169931_10051687Not Available4413Open in IMG/M
3300017788|Ga0169931_10228180Not Available1549Open in IMG/M
3300017788|Ga0169931_10279190Not Available1334Open in IMG/M
3300017951|Ga0181577_10038929Not Available3420Open in IMG/M
3300017956|Ga0181580_10305259All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1082Open in IMG/M
3300017963|Ga0180437_10580127All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl820Open in IMG/M
3300017968|Ga0181587_10664022Not Available661Open in IMG/M
3300017968|Ga0181587_11017655Not Available506Open in IMG/M
3300019784|Ga0181359_1004421All Organisms → Viruses4461Open in IMG/M
3300019784|Ga0181359_1008462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H13557Open in IMG/M
3300019784|Ga0181359_1156036Not Available778Open in IMG/M
3300020074|Ga0194113_10036620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.4999Open in IMG/M
3300020074|Ga0194113_10242743All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300020074|Ga0194113_10446696Not Available939Open in IMG/M
3300020074|Ga0194113_10734972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.681Open in IMG/M
3300020109|Ga0194112_10238948Not Available1430Open in IMG/M
3300020179|Ga0194134_10003009Not Available18835Open in IMG/M
3300020179|Ga0194134_10006240Not Available10809Open in IMG/M
3300020179|Ga0194134_10207730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.835Open in IMG/M
3300020179|Ga0194134_10270515Not Available685Open in IMG/M
3300020183|Ga0194115_10050819All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2627Open in IMG/M
3300020183|Ga0194115_10297399Not Available738Open in IMG/M
3300020190|Ga0194118_10103344All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1744Open in IMG/M
3300020204|Ga0194116_10038506Not Available3572Open in IMG/M
3300020378|Ga0211527_10047739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1346Open in IMG/M
3300020498|Ga0208050_1003939All Organisms → Viruses1878Open in IMG/M
3300020551|Ga0208360_1013702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1123Open in IMG/M
3300020566|Ga0208222_1002946All Organisms → Viruses4465Open in IMG/M
3300021092|Ga0194122_10265424All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl888Open in IMG/M
3300021092|Ga0194122_10669419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.507Open in IMG/M
3300021335|Ga0213867_1001530Not Available10320Open in IMG/M
3300021356|Ga0213858_10388756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.656Open in IMG/M
3300021376|Ga0194130_10167787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1332Open in IMG/M
3300021376|Ga0194130_10388200Not Available745Open in IMG/M
3300021960|Ga0222715_10142731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H11494Open in IMG/M
3300021961|Ga0222714_10001421Not Available26956Open in IMG/M
3300021961|Ga0222714_10036322All Organisms → cellular organisms → Bacteria3585Open in IMG/M
3300021961|Ga0222714_10037972All Organisms → cellular organisms → Bacteria3482Open in IMG/M
3300021961|Ga0222714_10095466All Organisms → Viruses → Predicted Viral1896Open in IMG/M
3300021961|Ga0222714_10161812All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1330Open in IMG/M
3300021962|Ga0222713_10006804Not Available10807Open in IMG/M
3300021962|Ga0222713_10053070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.3085Open in IMG/M
3300021962|Ga0222713_10374288Not Available884Open in IMG/M
3300021963|Ga0222712_10217047Not Available1242Open in IMG/M
3300021964|Ga0222719_10467949Not Available765Open in IMG/M
3300022069|Ga0212026_1017405All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.994Open in IMG/M
3300022176|Ga0212031_1008634All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1394Open in IMG/M
3300022176|Ga0212031_1024228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes959Open in IMG/M
3300022179|Ga0181353_1003376All Organisms → cellular organisms → Bacteria3577Open in IMG/M
3300022179|Ga0181353_1066734Not Available924Open in IMG/M
3300022187|Ga0196899_1109640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.808Open in IMG/M
3300022198|Ga0196905_1000292Not Available20200Open in IMG/M
3300022198|Ga0196905_1003066Not Available6168Open in IMG/M
3300022198|Ga0196905_1035391All Organisms → Viruses → Predicted Viral1479Open in IMG/M
3300022198|Ga0196905_1151408Not Available597Open in IMG/M
3300022198|Ga0196905_1163260Not Available569Open in IMG/M
3300022200|Ga0196901_1007810All Organisms → cellular organisms → Bacteria4644Open in IMG/M
3300022200|Ga0196901_1008814Not Available4334Open in IMG/M
3300022200|Ga0196901_1079362Not Available1173Open in IMG/M
3300022407|Ga0181351_1037599All Organisms → Viruses2049Open in IMG/M
3300022752|Ga0214917_10117580All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1493Open in IMG/M
3300022752|Ga0214917_10266029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.787Open in IMG/M
3300023116|Ga0255751_10150163All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1368Open in IMG/M
3300023176|Ga0255772_10244267Not Available986Open in IMG/M
3300024354|Ga0255171_1099562Not Available514Open in IMG/M
3300025057|Ga0208018_100365Not Available12556Open in IMG/M
3300025057|Ga0208018_101370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.4973Open in IMG/M
3300025057|Ga0208018_109860Not Available1356Open in IMG/M
3300025283|Ga0208048_1003739All Organisms → cellular organisms → Bacteria6899Open in IMG/M
3300025610|Ga0208149_1001575Not Available8389Open in IMG/M
3300025646|Ga0208161_1039430All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae1594Open in IMG/M
3300025646|Ga0208161_1052433Not Available1296Open in IMG/M
3300025646|Ga0208161_1097780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.815Open in IMG/M
3300025646|Ga0208161_1103838Not Available778Open in IMG/M
3300025646|Ga0208161_1107720All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium757Open in IMG/M
3300025646|Ga0208161_1155402Not Available566Open in IMG/M
3300025647|Ga0208160_1080550All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae873Open in IMG/M
3300025647|Ga0208160_1105862Not Available724Open in IMG/M
3300025655|Ga0208795_1141551All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl609Open in IMG/M
3300025671|Ga0208898_1154163All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.616Open in IMG/M
3300025828|Ga0208547_1080795Not Available1039Open in IMG/M
3300025853|Ga0208645_1047073All Organisms → Viruses2083Open in IMG/M
3300025853|Ga0208645_1134501All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl965Open in IMG/M
3300027683|Ga0209392_1069442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1137Open in IMG/M
3300027693|Ga0209704_1113858Not Available774Open in IMG/M
3300027693|Ga0209704_1170751Not Available632Open in IMG/M
3300027697|Ga0209033_1249811Not Available512Open in IMG/M
3300027762|Ga0209288_10121061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.830Open in IMG/M
3300027762|Ga0209288_10123820Not Available821Open in IMG/M
3300027793|Ga0209972_10146119All Organisms → Viruses → Predicted Viral1137Open in IMG/M
3300027814|Ga0209742_10058677Not Available1258Open in IMG/M
3300027814|Ga0209742_10290424Not Available538Open in IMG/M
3300027892|Ga0209550_10077831All Organisms → Viruses2556Open in IMG/M
3300027917|Ga0209536_100260755All Organisms → Viruses2171Open in IMG/M
3300029930|Ga0119944_1003482All Organisms → cellular organisms → Bacteria2630Open in IMG/M
3300029933|Ga0119945_1036461Not Available546Open in IMG/M
3300031539|Ga0307380_10172419Not Available2121Open in IMG/M
3300031539|Ga0307380_10505608All Organisms → Viruses → Predicted Viral1061Open in IMG/M
3300031539|Ga0307380_10684054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.867Open in IMG/M
3300031539|Ga0307380_11202589All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.587Open in IMG/M
3300031565|Ga0307379_10213998Not Available1961Open in IMG/M
3300031565|Ga0307379_11255764All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium609Open in IMG/M
3300031566|Ga0307378_11534245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.505Open in IMG/M
3300031578|Ga0307376_10259395All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1170Open in IMG/M
3300031669|Ga0307375_10201765All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1334Open in IMG/M
3300031673|Ga0307377_10575291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.809Open in IMG/M
3300031758|Ga0315907_10127740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Bristolvirus2166Open in IMG/M
3300031784|Ga0315899_10010017Not Available10152Open in IMG/M
3300031784|Ga0315899_11373301Not Available600Open in IMG/M
3300031787|Ga0315900_10059736All Organisms → Viruses → Predicted Viral3952Open in IMG/M
3300031857|Ga0315909_10015293Not Available7886Open in IMG/M
3300031857|Ga0315909_10155235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H11877Open in IMG/M
3300031857|Ga0315909_10572264Not Available762Open in IMG/M
3300031857|Ga0315909_10815254All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl588Open in IMG/M
3300031951|Ga0315904_10348480All Organisms → Viruses → Predicted Viral1364Open in IMG/M
3300031951|Ga0315904_10409460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1226Open in IMG/M
3300031951|Ga0315904_10464770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H11126Open in IMG/M
3300032050|Ga0315906_10243389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Kajamvirus → Synechococcus virus SRIP11659Open in IMG/M
3300032050|Ga0315906_10926320Not Available665Open in IMG/M
3300032093|Ga0315902_10083364Not Available3524Open in IMG/M
3300032136|Ga0316201_11101548All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium666Open in IMG/M
3300033816|Ga0334980_0016589All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.3173Open in IMG/M
3300033816|Ga0334980_0021001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales2803Open in IMG/M
3300033816|Ga0334980_0150112Not Available954Open in IMG/M
3300033978|Ga0334977_0274727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4819Open in IMG/M
3300033981|Ga0334982_0171731Not Available1090Open in IMG/M
3300034012|Ga0334986_0000145Not Available58647Open in IMG/M
3300034012|Ga0334986_0019750Not Available4618Open in IMG/M
3300034019|Ga0334998_0228557Not Available1140Open in IMG/M
3300034061|Ga0334987_0002454Not Available17959Open in IMG/M
3300034061|Ga0334987_0646045Not Available616Open in IMG/M
3300034072|Ga0310127_006868Not Available9250Open in IMG/M
3300034072|Ga0310127_277914Not Available582Open in IMG/M
3300034073|Ga0310130_0001567Not Available12200Open in IMG/M
3300034073|Ga0310130_0001607All Organisms → Viruses11932Open in IMG/M
3300034104|Ga0335031_0066725All Organisms → cellular organisms → Bacteria2573Open in IMG/M
3300034118|Ga0335053_0047630All Organisms → cellular organisms → Bacteria3065Open in IMG/M
3300034355|Ga0335039_0454429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.649Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous26.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient7.81%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake7.03%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.47%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.69%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.30%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil3.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.73%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.34%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.34%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.56%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water1.56%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.17%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic1.17%
Methane SeepEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Methane Seep1.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.78%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.78%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.78%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.39%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.39%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.39%
Drinking Water Treatment PlantEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant0.39%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.39%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.39%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.39%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.39%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.39%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.39%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.39%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.39%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.39%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.39%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.39%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000126Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5mEnvironmentalOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001687Deep Marine Sediments WOR-3-8_10EnvironmentalOpen in IMG/M
3300005346Saline sediment microbial community from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007214Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009450Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009492Marine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 6-8 cmbsfEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300011984Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107EnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014801Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FWEnvironmentalOpen in IMG/M
3300016697Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020378Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300024354Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8dEnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025283Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027683Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027814Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300029933Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1000215323300000116MarineMNKALIVYLVNNKKKVARQDIESQRALKELKKQTTASF*
DelMOSpr2010_10005981103300000116MarineMNKALIVYLVNQKKKQARKNVESKHAVTELKKQSAATF*
DelMOSpr2010_1000853853300000116MarineMNKALIVYLVNQKKKQARKEIESKHAVAELKKQYAATF*
DelMOSpr2010_1006695823300000116MarineMSKALIVYLIDKRKKQARLDVESKHAVAELKKQSAATF*
DelMOSpr2010_1009387923300000116MarineMNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF*
DelMOSpr2010_1013236423300000116MarineMNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF*
BS_KBA_SWE12_21mDRAFT_1017529523300000124MarineMNQALIVYLQGQKKQAARKDVESKHAAKQLEKQATATF*
BS_KBB_SWE26_205mDRAFT_100314213300000126MarineMNKALIVYLVDRKKKVARKDAESKHAIKQLEKQTTATF*
FwDRAFT_1004787813300000882Freshwater And MarineMNKALIVYLIDRKKKVARKDVESKHAIKQLEKQTTATF*
JGIcombinedJ13530_10833409523300001213WetlandMNKALIVYLVDKRKKLARKNVESKHATAELKKQSAATF*
WOR8_1002032893300001687Marine SedimentMNKALIVYLIDKRKKQARMDVEFKHAVTELKKQSAATF*
Ga0074242_1111043143300005346Saline Water And SedimentMNKALSRFTWLNQKKKQARKEIESKHAVAELKKQYAATF*
Ga0070374_1061424313300005517Freshwater LakeMNKALIVYLVGQKKKAARKDVESKHGIKQLEKQTTATF*SLIVYV
Ga0068876_10000190433300005527Freshwater LakeMNKALIIYLVDKKKKAARKDVESKHAVKQLEKQTTATF*
Ga0068876_1028556823300005527Freshwater LakeMNKALIVYLVDKKKKLARKDVESKHAVTELKKQSAATF*
Ga0068876_1030101123300005527Freshwater LakeMNKALIVYLADRKKKVARKDVESKHAIKQLEKQTTATF*
Ga0078894_1052463333300005662Freshwater LakeMNKALIVYLMNKKKKLARKDVESKHAVTELKKQSAATF*
Ga0078894_1087819823300005662Freshwater LakeMKPALIVYLVSTKKKMTRKDVESKHAVTELKKQSAATF*
Ga0079957_114325743300005805LakeMNKALIVYLVDKRKKLARKDVESKHATTELKKQSAATF*
Ga0075474_1018345013300006025AqueousMNKALIVYLVNQKKKQARKDVESKHAVTELKKQNA
Ga0075478_1000288623300006026AqueousMNKALIIYLVNKKKKVARQDIESQRALKELKKQTTASF*
Ga0075478_1007948123300006026AqueousMSKALIVYLIDKRKKQARLDMESKHAVAELKKQSAATF*
Ga0075478_1013325713300006026AqueousMNKALIVYLVNQKKKQTRKDVESKHAVTELKKQSAATF*
Ga0075470_1001097033300006030AqueousMNKALIVYLVDRKKKVARKDVESKHAIKELKKQTTATF*
Ga0098073_100309633300006734MarineMNQALIVYLVGQKKQAARKDVESKRAVKELKKQPAATF*
Ga0098073_100837313300006734MarineALIVYLVNQKKKLARKDVESKHAVTELKKQSAATF*
Ga0098073_101730713300006734MarineMNKALIVYLVNNKKKVARQDIESQRALKELKKQTT
Ga0098073_104642723300006734MarineMNKALIVYLVNQKKKQARKDVESKHAVTELKKQSAATF*
Ga0070749_1006183123300006802AqueousMNKALIVYLVNQKKKQARKDVESKHAVEELKKQYAATF*
Ga0070749_1007055073300006802AqueousRSNQMNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF*
Ga0070749_1011195433300006802AqueousMNKALIVYLVDRKKKVARKDVESKHAIKQLEKQTTATF*
Ga0070749_1017834423300006802AqueousMNKALIVYLVDKKKKQARKEIESKHAVAELKKQYAATF*
Ga0070749_1020631733300006802AqueousMNQALLVYLANQKKKQTRKDVESKRAIKELKKQPAEVVV*
Ga0070749_1023143713300006802AqueousMNKALIVYLVNQKKKQARKEIESKHAVKQLEKQTTATF*
Ga0070749_1031499213300006802AqueousMNKALIVYLVNQKKKQTRKDMESKHAVTELKKQSAATF*
Ga0070754_10007117113300006810AqueousMNKALIVYLVNQKKKQARKDVESKHAVTELKKQNAATF*
Ga0070754_1044376333300006810AqueousMNKALIVYLVGQKKDKARKDVESKRAVKELKKETAATF*
Ga0075476_1009127413300006867AqueousLIVYLVNQKKKQARKDVESKHAVTELKKQNAATF*
Ga0075476_1034730513300006867AqueousMNKALIVYLVNQKKKQTRKDVESKHAVTELKKQSAATF*SPL
Ga0075477_1002482663300006869AqueousVNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF*
Ga0075477_1033119713300006869AqueousMNKALIVYLVDKKKKQARKEIESKHAVVELKKQYAATF*
Ga0075479_1005777813300006870AqueousMNKALIVYLVNQKKKQARLDVESKHAVTELKKQSAA
Ga0070750_1013258433300006916AqueousSNQMNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF*
Ga0070746_1001704073300006919AqueousMNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF*SPLV*
Ga0070746_1032092623300006919AqueousHRRSNQMNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF*
Ga0103959_113804043300007214Freshwater LakeMNKALIVYLVSQKKKEARKDVESKHAIKELKKQPSVTF*
Ga0070745_107340233300007344AqueousMNKALIVYLVNQKKKQARKEVESKHAVAELKKQYAATF*
Ga0099851_100114473300007538AqueousMNKALIVYLVDKKKKMARTDVESKHAIKELKKQSAATF*
Ga0099851_101733383300007538AqueousMNKALIVYLVDKRKKLARKDVESKHATAELKKQSAATF*
Ga0099851_101972583300007538AqueousRSNQMNKALIVYLVDKRKKQARKDVESKHAVTELKKQSAATF*
Ga0099851_106603423300007538AqueousMNKALIVYLVDKKKKVARKDVESKHAIAELKKQSAATF*
Ga0099851_108338223300007538AqueousMNKALIVYLIDKRKKQARMDVESKHAVTELKKQSAATF*
Ga0099851_111084023300007538AqueousMNKALIVYLVGQKKKVARKDVESKHALAELKKQSAATF*
Ga0099851_119651623300007538AqueousMKPALIVYLVSTKKKLARKEIESKHAIKELKKQYAATF*
Ga0099851_127828213300007538AqueousMNKALIVYLVDKRKKQARKDVESKHAVTELKKQSAATF*
Ga0099849_109585713300007539AqueousMNKALIVYLVNQKKKQARKDVESKHAVTELKKQNAA
Ga0099848_1006260123300007541AqueousMNKALIVYLVDKRKKLARKDVESKHATGELKKQSAATF*
Ga0099848_104313813300007541AqueousSNQMNKALIVYLIDKRKKQARMDVESKHAVTELKKQSAATF*
Ga0099848_124059213300007541AqueousMNKALIVYLVDKRKKQTRKDVESKHAVTELKKQSAATF*
Ga0099848_127915323300007541AqueousMNKALIVYLVDKKKKTARKEVESKHAVQELKKQYAATF*
Ga0099848_129733313300007541AqueousNQMNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF*
Ga0099846_110497623300007542AqueousMNKALIVYLVNQKKKLARKDVESKHAVTELKKQSAATF*
Ga0070751_122074523300007640AqueousMNKALIVYLVNQKKKQARKDMESKHAVTELKKQSAATF*
Ga0099850_105751813300007960AqueousALIVYLVDKKKKVARKDVESKHAIAELKKQSAATF*
Ga0099850_113936633300007960AqueousMNKALVVYLINKKKKMTRSDVESKHAIKELQKQSAATF*
Ga0105746_123614713300007973Estuary WaterMNKALIVYLVDKKKKTARKEIESKHAVEELKKQCAATF*
Ga0108970_1041047223300008055EstuaryMDQALLVYLANQKKKQTRKDVESKRAIKELKKQPAEVVV*
Ga0114355_105501323300008120Freshwater, PlanktonMNKALIVYLIDKRKKQTRKDVESKHAVKQLEKQATATF*
Ga0114355_109656213300008120Freshwater, PlanktonQMNKALIVYLVDKRKKLTRKDVESKHAVSELKKQSAATF*
Ga0114337_112833723300008262Freshwater, PlanktonMNKALIVYLVGRKKKVARKDVESKHAIAELKKQSAATF*
Ga0102963_102915033300009001Pond WaterMNKALIVYLVDKRKKQARLDVESKHAVTELKKQSAATF*
Ga0105105_1023396443300009009Freshwater SedimentMNKALIVYLVDKRKKLARKDIESKHAVTELKKQSAATF*
Ga0105105_1041406123300009009Freshwater SedimentMNKALIVYLVNKKKKLARKDVESKHAVTELKKQSAATF*
Ga0102957_109556833300009027Pond WaterMSKALIVYLIDKRKKQARLDVESKHAVTELKKQSAATF*
Ga0105090_1066417913300009075Freshwater SedimentTNQMNKALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF*
Ga0105102_1048174323300009165Freshwater SedimentMNKALIVYLVNRRKKLARKDVESKHAVTELKKQSAATF*
Ga0105102_1051796813300009165Freshwater SedimentRHWKTNQMNKALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF*
Ga0105097_1008067923300009169Freshwater SedimentMNKALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF*
Ga0105096_1053801133300009170Freshwater SedimentMNKALIVYLVDRRKKLARKDVASKHAVTELKKQNAATF*
Ga0127391_1001591133300009450Meromictic PondMNKALIVYLVNQKKKQARKDVESLHAVTELKKQSAATF*
Ga0127412_1000779923300009492Methane SeepMNKALIVYLEAQKKKVARKDVESKHAAEQLEKQATATF*
Ga0127412_1000997623300009492Methane SeepMSKALIVYLVNQKKKQARLDVESKHAVTELKKQSAATF*
Ga0127412_1002264723300009492Methane SeepMNQALIVYLINQKKKQARKDVESKHAVTELKKQSAATF*
Ga0129348_117729113300010296Freshwater To Marine Saline GradientMKKALIVYLVNQKKKQARKEIESKHAVAELKKQYAATF*
Ga0129348_117937213300010296Freshwater To Marine Saline GradientMNKALIVYLVSQKKKQARKEIESKHAVAELKKQYAATF*
Ga0129345_126892813300010297Freshwater To Marine Saline GradientMNKALIVYLVNQKKKLARKDVESKHAVTELKKQSA
Ga0129342_118678633300010299Freshwater To Marine Saline GradientMNKALIVYLVNQKKKQARKEIESKHAVAELKKQYA
Ga0129333_1000612283300010354Freshwater To Marine Saline GradientMNKALIVYLVDRKKKVARKDVESNHAIKQLEKQTTATF*
Ga0129333_1004859753300010354Freshwater To Marine Saline GradientMNKALIVYLVDKKKKVARKDVESKHAIKELKKQTTATF*
Ga0129333_1005628653300010354Freshwater To Marine Saline GradientMKPALIVYLVNTKKKLARKEIESKHAITELKKQYAATF*
Ga0129333_1033754823300010354Freshwater To Marine Saline GradientMNKALIVYLVDKRKKMARKDIESKHATTELKKQSAATF*
Ga0129333_1034562833300010354Freshwater To Marine Saline GradientMNKALIVYLIDQKKKTARRDIESKHAIKELKKQPASTF*
Ga0129333_1044386733300010354Freshwater To Marine Saline GradientMSKALIVYLIDKRKKQARKDIESKHAVTELKKQSAATF*
Ga0129333_1059067823300010354Freshwater To Marine Saline GradientMNKALIVYLVDKRKKLARKDVESKHAVKELKEQSTATF*
Ga0129333_1071257043300010354Freshwater To Marine Saline GradientNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF*
Ga0129333_1073968623300010354Freshwater To Marine Saline GradientMNKALIVYLVDKRKKLARKDVESKHAVTELKKQNAATF*
Ga0129333_1074163013300010354Freshwater To Marine Saline GradientMNKALIVYLVDKKKKVARKDVESKHAIKQLEKQTTATF*
Ga0129333_1122042323300010354Freshwater To Marine Saline GradientMNKALIVYLVGQKKKVARKDVESKHAVKQLEKQATATF*
Ga0129333_1127640323300010354Freshwater To Marine Saline GradientMNKALIVYLVNQKKKQTRKDVESQHAVTELKKQSAATF*
Ga0129333_1134949713300010354Freshwater To Marine Saline GradientMKPALIVYLVDAKKKLARKEIESKHAIKELKKQYAATF*
Ga0129333_1175571423300010354Freshwater To Marine Saline GradientMKPALIVYLVSTKKKMARKDVESKHAVTELKKQSAATF*
Ga0129336_1009201323300010370Freshwater To Marine Saline GradientMNKALIVYLVNKKKKVARKDIESKHAIKELKKQATATF*
Ga0129336_1028836613300010370Freshwater To Marine Saline GradientLIVYLVDKRKKLARKDVEYKHAVTELKKQSAATF*
Ga0136549_1003093783300010389Marine Methane Seep SedimentMNKALIVYLVNQKKKQARKDVESKHATAELKKQSAATF*
Ga0119931_101861123300011984Drinking Water Treatment PlantMNKALIVYLVDRKKKMARQDIESKHAIKELKKQPASTF*
Ga0119951_102568413300012000FreshwaterMNKALIVYLVDQKKKTARKDTEFKHAIKELKKQPASTF*
Ga0153805_105804523300012013Surface IceMNQALIVYLVNQKKKTTRKEIESKHAIEALKKQYAATF*
Ga0163212_115330233300013087FreshwaterMNKVLIVYLVNQKKKAARKDIESKRAIKELKKQSTVTF*
(restricted) Ga0172367_1014092823300013126FreshwaterMNKALIVYLVDQKKKTARKDIESKHAIKELKKQPTVTF*
(restricted) Ga0172373_1017747933300013131FreshwaterMNKALIVYLVNQKKKEARKDIESKHAIKELKKQSTVTF*
(restricted) Ga0172375_1003848233300013137FreshwaterMNKALIVYLVDQRKKTARKDIESKHALKELKKQPTVTF*
Ga0119952_100459823300014050FreshwaterMNKALIVYLVDQKKKTARKDTEFKHAIKELKKQPTVTF*
(restricted) Ga0172376_1028820433300014720FreshwaterMNKALIVYLVVQKKKTARKDIESKHALKELKKQPTVTF*
Ga0119946_101736113300014801AquaticMNKALIVYLVDRKRKVVRKDVESKHAIKELKKQTTATF*
Ga0180057_105894913300016697FreshwaterMDQALLVYLANQKKKQTRKDVESKRAIQELKKQPAEVVV
Ga0181363_100164363300017707Freshwater LakeMNKALIVYLVDKRKKMARKDVESKHAITELKKQSAATF
Ga0181352_101568433300017747Freshwater LakeMKPALIVYLVSTKKKMTRKDVESKHAVTELKKQSAATF
Ga0181355_121437433300017785Freshwater LakeMNKALIVYLVDRRKKLARKDIESKHAVTELKKQSAATF
Ga0169931_1005168743300017788FreshwaterMNKALIVYLVNQKKKIARKEIESKHAVNELKKQYAATF
Ga0169931_1022818023300017788FreshwaterMNKALITYLVDKKKKATRKDIESVRAIKELEKQPTSTF
Ga0169931_1027919023300017788FreshwaterMNKALIVYLVDQRKKTARKDIESKHALKELKKQPTVTF
Ga0181577_1003892983300017951Salt MarshMNKALIVYLVNNKKKVARQDIESQRALKELKKQTTASF
Ga0181580_1030525923300017956Salt MarshMNKALIVYLVDKKKKQARKEIESKHAVAELKKQYAATF
Ga0180437_1058012723300017963Hypersaline Lake SedimentMNKALIVYLVNQKKKQARKDMESQHATAELKKQSVATF
Ga0181587_1066402213300017968Salt MarshMNKALIVYLVIQKKKQARKEIESKHAVAELKKQYAATF
Ga0181587_1101765523300017968Salt MarshMNKALIVYLVDKKKKQARKEIESKHAVAELKKQYAATFXSP
Ga0181359_100442153300019784Freshwater LakeMDQALLVYLANQKKKQTRKDVESKRAIKELKKQPAEVVV
Ga0181359_100846283300019784Freshwater LakeMNKALIVYLVDRKKKVARKDVESKHAIKQLEKQTTATF
Ga0181359_115603633300019784Freshwater LakeMNKALIVYLVDKKKKLARKDVESKHAVTELKKQSAATF
Ga0194113_1003662063300020074Freshwater LakeMNKALIVYLVNQKKKEARKDIESKHAIKELKKQSTVTF
Ga0194113_1024274323300020074Freshwater LakeMKQALIVYLVSQKKKRARQENESKHAIKELKKQAAVTLG
Ga0194113_1044669623300020074Freshwater LakeMNKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF
Ga0194113_1073497223300020074Freshwater LakeMNKALIVYLVNQKKKAARKDIESKRAIKELKKQSTVTF
Ga0194112_1023894833300020109Freshwater LakeMNKALIVYLVHQQKKVARKDVESKHAIKELEKQTT
Ga0194134_10003009233300020179Freshwater LakeMNKALIIYLIDKKKKTTRTNVESVRAIKELEKQKSATF
Ga0194134_1000624073300020179Freshwater LakeMNKALIVYLVNQKKKTARKDIESKHAIKELKKQPTVTF
Ga0194134_1020773023300020179Freshwater LakeMNKALIIYLVHQQKKVARKDVESKHAIKELEKQTTATF
Ga0194134_1027051523300020179Freshwater LakePNQMNKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF
Ga0194115_1005081973300020183Freshwater LakeMNKALIVYLAQQQKRVARKDVESKHAIKELEKQTTATF
Ga0194115_1029739913300020183Freshwater LakeKPNQMNKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF
Ga0194118_1010334413300020190Freshwater LakeNKALIIYLVHQQKKVARKDVESKHAIKELEKQTTATF
Ga0194116_1003850613300020204Freshwater LakeKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF
Ga0211527_1004773953300020378MarineMNTALLVHLLNKKKKQTRKEIELKHAVAELKKQYAATF
Ga0208050_100393923300020498FreshwaterMNQALLVYLANQKKKQTRKDVESKRAIKELKKQPAEVVV
Ga0208360_101370223300020551FreshwaterMNKALIVYLVNQKKKTTRKEIESKHAIEALKKQYAATF
Ga0208222_100294613300020566FreshwaterMNKALIVYLVDKRKKLARKDIESKHAVTELKKQSAATF
Ga0194122_1026542423300021092Freshwater LakeQINKALIIYLVHQQKKVARKDVESKHAIKELEKQTTATF
Ga0194122_1066941923300021092Freshwater LakeNKALIVYLAHQQKKVARKDVESKHAIKELEKQTTATF
Ga0213867_1001530283300021335SeawaterMNKALIVYLVNNKKKVARQDIESQRALKELKKQTTAAF
Ga0213858_1038875623300021356SeawaterMNKALIVYLVNQKKKQARKEIESKHAVAELKKQYAATF
Ga0194130_1016778733300021376Freshwater LakeMNKALITYLVDKKKKTTRKDIESVRAIKELEKQPTSTF
Ga0194130_1038820013300021376Freshwater LakeNQMNKALIVYLVHQQKKVARKDVESKHAIKELEKQTTATF
Ga0222715_1014273123300021960Estuarine WaterMNKALIVYLVDRKKKVTRKDVESKHAIKELKKQTTATF
Ga0222714_10001421473300021961Estuarine WaterMNKALIVYLVDKRKKLARKDVESKHATTELKKQSAATF
Ga0222714_1003632223300021961Estuarine WaterMKKALIVYLVNQQKKVARKDVESKRALKELKKETAASF
Ga0222714_1003797273300021961Estuarine WaterMNKALIVYLVNQKKKVARKDVESKHAIKELEKQTTATF
Ga0222714_1009546613300021961Estuarine WaterNQMNKALIVYLVGQKKKAARKDVESKHAVKALEKQATATF
Ga0222714_1016181223300021961Estuarine WaterMKPALIVYLVETKKKLARKENESKHAIKELKKQYAATF
Ga0222713_1000680463300021962Estuarine WaterMNKALIVYLVDRKKKVARKDVESKHAIKQLEKQATATF
Ga0222713_1005307053300021962Estuarine WaterMKPALIVYLVDTKKKLARKENESKHAIKELKKQYAATF
Ga0222713_1037428823300021962Estuarine WaterMKQALIVYLVNQKKKKARRDIESQHAIKELKKQAAVTLG
Ga0222712_1021704733300021963Estuarine WaterMNKALIVYLIDQKKKTARKDIESKHAIKELKKQPASTF
Ga0222719_1046794923300021964Estuarine WaterMNKALIVYLVNQKKKQARLDVESKHAVAELKKQSAATF
Ga0212026_101740523300022069AqueousMSKALIVYLIDKRKKQARLDMESKHAVAELKKQSAATF
Ga0212031_100863423300022176AqueousMNKALIVYLVDKKKKMARTDVESKHAIKELKKQSAATF
Ga0212031_102422823300022176AqueousMNKALIVYLVNQKKKLARKDVESKHAVTELKKQSAATF
Ga0181353_100337643300022179Freshwater LakeMKPALIVYLVSTKKKMTRKDMESKHAVTELKKQSAATF
Ga0181353_106673423300022179Freshwater LakeMNKALIVYLMNKKKKLARKDVESKHAVTELKKQSAATF
Ga0196899_110964033300022187AqueousMNKALIVYLVNQKKKQARKDVESKHAVTELKKQNAATF
Ga0196905_1000292293300022198AqueousMNKALIVYLVDKKKKVARKDVESKHAIAELKKQSAATF
Ga0196905_100306683300022198AqueousMNKALIVYLVDKRKKLARKDVESKHATAELKKQSAATF
Ga0196905_103539113300022198AqueousQMNKALIVYLVNQKKKQARKDVESKHAVTELKKQSAATF
Ga0196905_115140813300022198AqueousMNKALIVYLVNQKKKQARKDVESKHAVEELKKQYAATFXSPLC
Ga0196905_116326013300022198AqueousMNKALIVYLVDKKKKVARKDVESKHAIAELKKQSAATFXSPFV
Ga0196901_100781043300022200AqueousMNKALIVYLVDKRKKLARKDVESQHAVTELKKQSAATF
Ga0196901_1008814103300022200AqueousMNKALIVYLVGQKKKVARKDVESKHALAELKKQSAATF
Ga0196901_107936223300022200AqueousMNKALIVYLVGQKKDKARKDVESKRAVKELKKETAATF
Ga0181351_103759953300022407Freshwater LakeMNKALIVYLVDKKKKVARKDVESKHAIKELKKQTTATF
Ga0214917_1011758023300022752FreshwaterMNKALIVYLVDQKKKTARKDTEFKHAIKELKKQPTVTF
Ga0214917_1026602923300022752FreshwaterMNKALIVYLVDQKKKTARKDTESKHAIKELKKQPTVTF
Ga0255751_1015016313300023116Salt MarshWRSNQMNKALIVYLVDKKKKQARKEIESKHAVAELKKQYAATF
Ga0255772_1024426723300023176Salt MarshMNKALIVYLVDQKKKQARKEIESKHAVAELKKQYAATF
Ga0255171_109956213300024354FreshwaterMNKALIVYLVDKRKKLARKDVESKHATSELKKQSAATF
Ga0208018_100365133300025057MarineMNQALIVYLVGQKKQAARKDVESKRAVKELKKQPAATF
Ga0208018_10137073300025057MarineMNKALIVYLVNQKKKQTRKDVESKHAVTELKKQSAATF
Ga0208018_10986033300025057MarineMNKALIVYLVDRKKKMARKDVESKHAVTELKKQSAATF
Ga0208048_100373943300025283FreshwaterMNKALIVYLFNQKKKEARKDIESKHAIKELKKQSTVTF
Ga0208149_100157593300025610AqueousMNKALIIYLVNKKKKVARQDIESQRALKELKKQTTASF
Ga0208161_103943043300025646AqueousMNKALIVYLVNQKKKQARKDVESKHAVTELKKQSAATF
Ga0208161_105243323300025646AqueousMNKALIVYLVDKRKKQARKDVESKHAVTELKKQSAATF
Ga0208161_109778023300025646AqueousMNKALIVYLVNQKKKQARKDVESKHAVEELKKQYAAT
Ga0208161_110383823300025646AqueousMNKALIVYLVNQKKKQARKDVESQHAVTELKKQSAATF
Ga0208161_110772023300025646AqueousMKPALIVYLVSTKKKLARKEIESKHAIKELKKQYAATF
Ga0208161_115540223300025646AqueousMNKALIVYLVDKRKKQTRKDVESQHAVTELKKQSAATF
Ga0208160_108055013300025647AqueousMNKALIVYLVNQKKKQARKDVESKHAVEELKKQYAATF
Ga0208160_110586213300025647AqueousMNKALIVYLVSQKKKQARKEIESKHAVAELKKQYAATFXSPLIQT
Ga0208795_114155123300025655AqueousMNKALIVYLVDKRKKQARKDVESKHAVTELKKQSAATFXSPLI
Ga0208898_115416323300025671AqueousMNKALIVYLVNQKKKQARKDMESKHAVTELKKQSAATF
Ga0208547_108079513300025828AqueousLCHRRTNQMNKALIVYLVNQKKKQARKDVESKHAVTELKKQNAATF
Ga0208645_104707363300025853AqueousMNKALIVYLVNQKKKQARLDVESKHAVTELKKQSAATF
Ga0208645_113450113300025853AqueousMNKALIVYLVNQKKKQTRKDMESKHAVTELKKQSAATF
Ga0209392_106944223300027683Freshwater SedimentMNKALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF
Ga0209704_111385833300027693Freshwater SedimentMNKALIVYLVDKRKKLARKDVESKHAVTELKKQSAATF
Ga0209704_117075123300027693Freshwater SedimentMNKALIVYLVNRRKKLARKDVESKHAVTELKKQSAATF
Ga0209033_124981113300027697Freshwater LakeMNKALIVYLLDKRKKLARKDIESKHAVTELKKQSAATF
Ga0209288_1012106133300027762Freshwater SedimentMNKALIVYLVDKKKKLARKDVESKHAVTELKKQSAAT
Ga0209288_1012382013300027762Freshwater SedimentNQMNKALIVYLVDKKKKLARKDVESKHAVTELKKQSAATF
Ga0209972_1014611943300027793Freshwater LakeMNKALIIYLVDKKKKAARKDVESKHAVKQLEKQTTATF
Ga0209742_1005867723300027814Marine SedimentMNKALIVYLIDKRKKQARMDVEFKHAVTELKKQSAATF
Ga0209742_1029042413300027814Marine SedimentMNKALIVYLVNQKKKQARKEIESKHAVAELKKQYAAT
Ga0209550_1007783143300027892Freshwater LakeMNKALIVYLVGQKKKAARKDVESKHGIKQLEKQTTATF
Ga0209536_10026075513300027917Marine SedimentMNKALIVYLVDKRKKLARKDVESKHATGELKKQSAATF
Ga0119944_100348243300029930AquaticMNKALIVYLVDRKKKMARQDIESKHAIKELKKQPASTF
Ga0119945_103646113300029933AquaticMNKALIVYLVGQKKKVARKDIESKHAIKELKKQATATF
Ga0307380_1017241963300031539SoilRHRRSNQMNQALIVYLVGQKKKAVRKDVESKHAAKQLEKQATATF
Ga0307380_1050560823300031539SoilMNQALIIYLQGQKKQAARKDVESKHAAKQLEKQATATF
Ga0307380_1068405423300031539SoilMNQALIVYLQGQKKLAVRKDVESKHAAKQLEKQATATF
Ga0307380_1120258923300031539SoilMNQALIVYLQGQKKQAARKDVESKHAAKQLEKQATATF
Ga0307379_1021399823300031565SoilMNQALIVYLVGQKKKAVRKDVESKHAAKQLEKQATATF
Ga0307379_1125576423300031565SoilMNKALIVYLQGQKKQAARKDVESKHAAKQLEKQATATF
Ga0307378_1153424523300031566SoilIVYLQAQKKKVARKDVESKHAAKQLEKQATATFXSPLV
Ga0307376_1025939543300031578SoilMNQALIVYLQGQKKQATRKDVESKHAAKQLEKQAT
Ga0307375_1020176543300031669SoilMNQALIVYLVGQKKKAVRKDVESKHAAKQLEKQATATFXLQLDG
Ga0307377_1057529123300031673SoilMNQALIVYLQGQKKLAVRKDVESKHAAKQLEKQATATFXSPLV
Ga0315907_1012774043300031758FreshwaterMNKALIVYLADRKKKVARKDVESKHAIKQLEKQTTATF
Ga0315899_1001001753300031784FreshwaterMNKALIVYLVDRKKKVARKDVESKHAIAELKKQSAATF
Ga0315899_1137330113300031784FreshwaterMNKALIVYLVDRKKKVARKDVESKHAAKQLEKQATATF
Ga0315900_1005973633300031787FreshwaterMNKALIVYLVGRKKKVARKDVESKHAIAELKKQSAATF
Ga0315909_10015293183300031857FreshwaterMNKALIVYLIDKRKKQTRKDVESKHAVKQLEKQATATF
Ga0315909_1015523513300031857FreshwaterELTKMNNALITYLIDKKKKATRKDVESKHAIKQLEKQTTATF
Ga0315909_1057226423300031857FreshwaterMKQALIVYLVSQKKKKARRDTESQHAIKELKKQAAVTLG
Ga0315909_1081525423300031857FreshwaterMNKALIVYLVGQKKKAARKDVESKHAVKELEKQATATFXSPLV
Ga0315904_1034848023300031951FreshwaterMDQALLVYLANQKKKQTRRDVESKRAIKELKKQPAEVVV
Ga0315904_1040946023300031951FreshwaterMNKALIVYLVDKRKKLTRKDVESKHAVTELKKQSAATF
Ga0315904_1046477033300031951FreshwaterMNKALIIYLVDKRKKLARKDVESKHAVTELKKQSAATF
Ga0315906_1024338933300032050FreshwaterMNKALIVYLVGRKKKVARKDVESKHAIAELKKQSAATFXSPLV
Ga0315906_1092632013300032050FreshwaterMNKALIVYLVDKRKKLARKDVESKHAVTELKKQSA
Ga0315902_1008336433300032093FreshwaterMNKALIVYLVDKKKKVARKDMESKHAIKQLEKQTTATF
Ga0316201_1110154823300032136Worm BurrowMNKSLIIYLVNKKKKVARQDIESQRALKELKKQTTASF
Ga0334980_0016589_1506_16223300033816FreshwaterMNQALIVYLVNQKKKTTRKEIESKHAIEALKKQYAATF
Ga0334980_0021001_976_10953300033816FreshwaterMDQALLVYLANQKKKQIRKDVESKRAIKELKKQPAEVVV
Ga0334980_0150112_292_4083300033816FreshwaterMNKALIVYLVNRRKKLARKDVESKHAVTELRKQSAATF
Ga0334977_0274727_521_6403300033978FreshwaterMDQALLVYLTNQKKKQTRKDVESKRAIKELKKQPAEVVV
Ga0334982_0171731_886_10023300033981FreshwaterMNKALIVYLIDQKKKTARKETESKHAIKELKKQPTVTF
Ga0334986_0000145_34148_342643300034012FreshwaterMKPALIVYLVNTKKKLARKDVESKHAIRELKKQYAATF
Ga0334986_0019750_4330_44463300034012FreshwaterMNQALIVYLVDKKKKTARKEIESKHAIEALKKQYAATF
Ga0334998_0228557_1029_11393300034019FreshwaterKALIVYLIDQKKKTARKDIESKHAIKELKKQPASTF
Ga0334987_0002454_16650_167663300034061FreshwaterMKPALIVYLVNTKKKLARKDVESKHAIKELKKQYTATF
Ga0334987_0646045_253_3693300034061FreshwaterMNMALIVYLVDRRKKLARKDVESKHAVTELKKQSAATF
Ga0310127_006868_6465_65813300034072Fracking WaterMKPALIVYLVNTKKKLARKEVESKHAIKELKKQYAATF
Ga0310127_277914_325_4413300034072Fracking WaterMNKALIVYLVNKKKKLARKDVESKHAVTELRKQSAATF
Ga0310130_0001567_4275_43913300034073Fracking WaterMNKALIVYLVDKRKKMARKDVESKHATTELKKQSAATF
Ga0310130_0001607_1747_18633300034073Fracking WaterMNKALIVYLVNKKKKMTRSDVESKHAIKELQKQSVATF
Ga0335031_0066725_22_1383300034104FreshwaterMNKALIVYLIDKRKKMARKDVESKHAVTELKKQSAATF
Ga0335053_0047630_2958_30653300034118FreshwaterMDQALLVYLANQKKKQTRKDVESKRAIKELKKQPAE
Ga0335039_0454429_2_1123300034355FreshwaterMNKALIVYLTAQKKKTARKDTESKHAIRELKKQPTVT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.