Basic Information | |
---|---|
Family ID | F014893 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 259 |
Average Sequence Length | 44 residues |
Representative Sequence | AGSLAHIAVLAQRLSTEERVLFANPDYRAAMSGKPRFLPGLF |
Number of Associated Samples | 207 |
Number of Associated Scaffolds | 259 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.39 % |
% of genes near scaffold ends (potentially truncated) | 98.46 % |
% of genes from short scaffolds (< 2000 bps) | 89.58 % |
Associated GOLD sequencing projects | 188 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.961 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.235 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.027 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.124 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 259 Family Scaffolds |
---|---|---|
PF00106 | adh_short | 18.92 |
PF13561 | adh_short_C2 | 8.11 |
PF02585 | PIG-L | 1.16 |
PF01494 | FAD_binding_3 | 1.16 |
PF03745 | DUF309 | 0.77 |
PF08241 | Methyltransf_11 | 0.39 |
PF00535 | Glycos_transf_2 | 0.39 |
PF01588 | tRNA_bind | 0.39 |
PF06187 | DUF993 | 0.39 |
PF09922 | DUF2154 | 0.39 |
PF07973 | tRNA_SAD | 0.39 |
PF12867 | DinB_2 | 0.39 |
PF08541 | ACP_syn_III_C | 0.39 |
COG ID | Name | Functional Category | % Frequency in 259 Family Scaffolds |
---|---|---|---|
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.32 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.16 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.16 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.16 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.16 |
COG1547 | Predicted metal-dependent hydrolase | Function unknown [S] | 0.77 |
COG0073 | tRNA-binding EMAP/Myf domain | Translation, ribosomal structure and biogenesis [J] | 0.39 |
COG2517 | Predicted RNA-binding protein, contains C-terminal EMAP domain | General function prediction only [R] | 0.39 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.96 % |
Unclassified | root | N/A | 10.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10328221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300001686|C688J18823_10091666 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
3300002561|JGI25384J37096_10018034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2744 | Open in IMG/M |
3300002910|JGI25615J43890_1084122 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300002914|JGI25617J43924_10337852 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300002917|JGI25616J43925_10110230 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300004080|Ga0062385_11073136 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300004092|Ga0062389_100129500 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300004152|Ga0062386_100395962 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300004152|Ga0062386_101249782 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300004635|Ga0062388_100717181 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300005176|Ga0066679_10436951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
3300005332|Ga0066388_100152608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2890 | Open in IMG/M |
3300005332|Ga0066388_104396749 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300005439|Ga0070711_101239205 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300005444|Ga0070694_101930709 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005459|Ga0068867_101777607 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300005533|Ga0070734_10142810 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300005540|Ga0066697_10024019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3329 | Open in IMG/M |
3300005587|Ga0066654_10586071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300005591|Ga0070761_10334389 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300005602|Ga0070762_10571527 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300005921|Ga0070766_11201849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300005952|Ga0080026_10028173 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
3300005983|Ga0081540_1237702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 640 | Open in IMG/M |
3300006031|Ga0066651_10390511 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300006034|Ga0066656_10154813 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
3300006052|Ga0075029_100551052 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300006057|Ga0075026_100603435 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300006086|Ga0075019_10145763 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300006162|Ga0075030_100931593 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300006172|Ga0075018_10362199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300006172|Ga0075018_10823949 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300006796|Ga0066665_10831226 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300006800|Ga0066660_10898194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300006804|Ga0079221_10797771 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300006914|Ga0075436_101368141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 536 | Open in IMG/M |
3300007255|Ga0099791_10122773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
3300007258|Ga0099793_10137927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
3300007258|Ga0099793_10243043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300007258|Ga0099793_10531710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300007265|Ga0099794_10500740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300007265|Ga0099794_10517867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300007788|Ga0099795_10092158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
3300009038|Ga0099829_10259696 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
3300009088|Ga0099830_10683514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300009088|Ga0099830_11012960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300009089|Ga0099828_10888722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300009090|Ga0099827_10491959 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300009143|Ga0099792_10682620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300009174|Ga0105241_12508362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300009553|Ga0105249_11283866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300010043|Ga0126380_11500883 | Not Available | 597 | Open in IMG/M |
3300010046|Ga0126384_12084698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300010048|Ga0126373_10922219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
3300010358|Ga0126370_12679481 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300010359|Ga0126376_11454205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300010359|Ga0126376_11531367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300010360|Ga0126372_12880863 | Not Available | 533 | Open in IMG/M |
3300010361|Ga0126378_10317245 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300010361|Ga0126378_10458789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1388 | Open in IMG/M |
3300010361|Ga0126378_11568396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300010362|Ga0126377_10395954 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300010398|Ga0126383_12641940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300010401|Ga0134121_11452599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300010403|Ga0134123_10289829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1446 | Open in IMG/M |
3300011120|Ga0150983_14281021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300011120|Ga0150983_15834899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1537 | Open in IMG/M |
3300011120|Ga0150983_16718177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
3300011269|Ga0137392_10000499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 20855 | Open in IMG/M |
3300011269|Ga0137392_10194119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1658 | Open in IMG/M |
3300011269|Ga0137392_11079170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300011271|Ga0137393_10110864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2252 | Open in IMG/M |
3300011271|Ga0137393_11658387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300012198|Ga0137364_10477583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
3300012198|Ga0137364_10793480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300012200|Ga0137382_10253238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
3300012202|Ga0137363_10544511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
3300012203|Ga0137399_11706796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300012205|Ga0137362_11761476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300012211|Ga0137377_10077627 | All Organisms → cellular organisms → Bacteria | 3119 | Open in IMG/M |
3300012211|Ga0137377_11112219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300012351|Ga0137386_10682024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300012357|Ga0137384_10504192 | Not Available | 993 | Open in IMG/M |
3300012359|Ga0137385_10922940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300012361|Ga0137360_10532445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
3300012362|Ga0137361_10491482 | Not Available | 1127 | Open in IMG/M |
3300012582|Ga0137358_10981399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300012683|Ga0137398_10325314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
3300012918|Ga0137396_10137325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1773 | Open in IMG/M |
3300012918|Ga0137396_10399660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
3300012918|Ga0137396_10524455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300012925|Ga0137419_11710947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300012930|Ga0137407_11155834 | Not Available | 734 | Open in IMG/M |
3300012931|Ga0153915_13462682 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012944|Ga0137410_10756293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300012976|Ga0134076_10149646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
3300012984|Ga0164309_11815429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300014969|Ga0157376_13051283 | Not Available | 507 | Open in IMG/M |
3300015052|Ga0137411_1230151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300015053|Ga0137405_1301531 | All Organisms → cellular organisms → Bacteria | 4202 | Open in IMG/M |
3300015054|Ga0137420_1117112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2173 | Open in IMG/M |
3300015054|Ga0137420_1373887 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300015197|Ga0167638_1091018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300015241|Ga0137418_10661106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
3300015242|Ga0137412_10130501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2033 | Open in IMG/M |
3300015264|Ga0137403_10529661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
3300015372|Ga0132256_101486651 | Not Available | 788 | Open in IMG/M |
3300016341|Ga0182035_10011245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5233 | Open in IMG/M |
3300016357|Ga0182032_11615993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300016371|Ga0182034_10279155 | Not Available | 1330 | Open in IMG/M |
3300016445|Ga0182038_11678604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300017924|Ga0187820_1006709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2707 | Open in IMG/M |
3300017955|Ga0187817_10283213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
3300017961|Ga0187778_10619188 | Not Available | 727 | Open in IMG/M |
3300017974|Ga0187777_10088836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2019 | Open in IMG/M |
3300017975|Ga0187782_10207054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1468 | Open in IMG/M |
3300018006|Ga0187804_10242868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300018085|Ga0187772_10884346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300018085|Ga0187772_11409485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300018468|Ga0066662_12838910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300018482|Ga0066669_10325695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
3300019789|Ga0137408_1457332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3055 | Open in IMG/M |
3300020199|Ga0179592_10533651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300020579|Ga0210407_11437384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300020580|Ga0210403_11009896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300020580|Ga0210403_11326205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300020581|Ga0210399_10534123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
3300020581|Ga0210399_10719973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300020581|Ga0210399_11062450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300020581|Ga0210399_11413717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300020583|Ga0210401_10460718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
3300021046|Ga0215015_10890555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300021086|Ga0179596_10463488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300021170|Ga0210400_10047374 | All Organisms → cellular organisms → Bacteria | 3343 | Open in IMG/M |
3300021170|Ga0210400_11121712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300021171|Ga0210405_10020966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5304 | Open in IMG/M |
3300021401|Ga0210393_11226952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300021402|Ga0210385_10221883 | Not Available | 1381 | Open in IMG/M |
3300021403|Ga0210397_11468276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300021405|Ga0210387_10086892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2592 | Open in IMG/M |
3300021405|Ga0210387_11115921 | Not Available | 687 | Open in IMG/M |
3300021406|Ga0210386_11747485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300021407|Ga0210383_10004684 | All Organisms → cellular organisms → Bacteria | 12099 | Open in IMG/M |
3300021407|Ga0210383_10389737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
3300021420|Ga0210394_10248936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
3300021420|Ga0210394_10710738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300021420|Ga0210394_10971727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300021474|Ga0210390_10476451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300021477|Ga0210398_11080163 | Not Available | 638 | Open in IMG/M |
3300021478|Ga0210402_10847092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300021478|Ga0210402_10992759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300021479|Ga0210410_11315924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300021559|Ga0210409_10800764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300021560|Ga0126371_12834303 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Puia → Puia dinghuensis | 588 | Open in IMG/M |
3300021560|Ga0126371_13139304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300022533|Ga0242662_10048278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
3300023075|Ga0224520_1087380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300024178|Ga0247694_1005406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1730 | Open in IMG/M |
3300024179|Ga0247695_1050351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300024181|Ga0247693_1055257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300024284|Ga0247671_1044370 | Not Available | 694 | Open in IMG/M |
3300024286|Ga0247687_1080949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300024347|Ga0179591_1034976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2406 | Open in IMG/M |
3300025454|Ga0208039_1053149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300025928|Ga0207700_10888077 | Not Available | 798 | Open in IMG/M |
3300025936|Ga0207670_11347371 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300025939|Ga0207665_10217804 | Not Available | 1398 | Open in IMG/M |
3300025939|Ga0207665_10340915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
3300025961|Ga0207712_10891669 | Not Available | 786 | Open in IMG/M |
3300026041|Ga0207639_12241429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300026088|Ga0207641_12512323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300026089|Ga0207648_11597613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300026089|Ga0207648_12226272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300026285|Ga0209438_1063690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
3300026301|Ga0209238_1018889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2644 | Open in IMG/M |
3300026304|Ga0209240_1050528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
3300026305|Ga0209688_1098290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300026313|Ga0209761_1301701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300026334|Ga0209377_1248060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300026360|Ga0257173_1006594 | Not Available | 1231 | Open in IMG/M |
3300026467|Ga0257154_1039664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300026481|Ga0257155_1090123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300026514|Ga0257168_1149689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300026542|Ga0209805_1175506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
3300026557|Ga0179587_11083573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300026845|Ga0207760_113814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300026999|Ga0207949_1011086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
3300027090|Ga0208604_1015402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300027562|Ga0209735_1043924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
3300027591|Ga0209733_1032113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
3300027610|Ga0209528_1104329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300027663|Ga0208990_1185313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300027681|Ga0208991_1145702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300027738|Ga0208989_10070331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
3300027745|Ga0209908_10246241 | Not Available | 503 | Open in IMG/M |
3300027812|Ga0209656_10299498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300027812|Ga0209656_10368244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300027842|Ga0209580_10104325 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300027842|Ga0209580_10570283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300027862|Ga0209701_10039900 | All Organisms → cellular organisms → Bacteria | 3035 | Open in IMG/M |
3300027862|Ga0209701_10397883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300027862|Ga0209701_10503007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300027875|Ga0209283_10327078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
3300027884|Ga0209275_10104420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1455 | Open in IMG/M |
3300027884|Ga0209275_10718393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300027889|Ga0209380_10119443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1532 | Open in IMG/M |
3300027894|Ga0209068_10614990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300028563|Ga0265319_1221778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300028563|Ga0265319_1237529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300028573|Ga0265334_10110323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
3300029636|Ga0222749_10179311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1048 | Open in IMG/M |
3300030740|Ga0265460_12670707 | Not Available | 534 | Open in IMG/M |
3300031057|Ga0170834_110435990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300031057|Ga0170834_113373736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1716 | Open in IMG/M |
3300031128|Ga0170823_12880258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300031128|Ga0170823_16245975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300031231|Ga0170824_101343138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300031561|Ga0318528_10667253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300031640|Ga0318555_10572329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300031708|Ga0310686_100510352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300031715|Ga0307476_11216820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300031720|Ga0307469_10635496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
3300031720|Ga0307469_12546565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300031724|Ga0318500_10298062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300031744|Ga0306918_10670756 | Not Available | 811 | Open in IMG/M |
3300031747|Ga0318502_10378973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300031753|Ga0307477_10755655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300031780|Ga0318508_1246229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300031820|Ga0307473_10804519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300031879|Ga0306919_10771702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
3300031910|Ga0306923_10505420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1366 | Open in IMG/M |
3300031910|Ga0306923_10722475 | Not Available | 1107 | Open in IMG/M |
3300031910|Ga0306923_11291803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300031942|Ga0310916_10101740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2310 | Open in IMG/M |
3300031945|Ga0310913_10438429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
3300031946|Ga0310910_10432151 | Not Available | 1044 | Open in IMG/M |
3300031946|Ga0310910_10558058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300031954|Ga0306926_10596516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
3300031954|Ga0306926_12768406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300031962|Ga0307479_10215396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1893 | Open in IMG/M |
3300031962|Ga0307479_10471071 | Not Available | 1240 | Open in IMG/M |
3300031962|Ga0307479_10636987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
3300032001|Ga0306922_11072360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
3300032008|Ga0318562_10035416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2681 | Open in IMG/M |
3300032035|Ga0310911_10252534 | Not Available | 1010 | Open in IMG/M |
3300032059|Ga0318533_10789366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300032076|Ga0306924_12491124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300032180|Ga0307471_100103375 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
3300032180|Ga0307471_101075837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
3300032261|Ga0306920_100107729 | All Organisms → cellular organisms → Bacteria | 4129 | Open in IMG/M |
3300032261|Ga0306920_103525773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300032829|Ga0335070_11937867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300032829|Ga0335070_12089362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300032955|Ga0335076_10257538 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
3300033004|Ga0335084_12426006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300033158|Ga0335077_10780842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
3300033755|Ga0371489_0435621 | Not Available | 594 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.41% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.86% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.86% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.70% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.32% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.93% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.93% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.16% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.16% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.16% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.16% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.39% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.39% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.39% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.39% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.39% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.39% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.39% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.39% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.39% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.39% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.39% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.39% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.39% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.39% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.39% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023075 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25 | Environmental | Open in IMG/M |
3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_103282211 | 3300001593 | Forest Soil | TAWITAVVGTLAHIGVLSMRLSTEERILLANPEYQATMANKPRFIPGVF* |
C688J18823_100916663 | 3300001686 | Soil | ITAVAGSLAHMAVLAQRLSTEEAVLFANPNYRAAMTGKPRFLPGLF* |
JGI25384J37096_100180344 | 3300002561 | Grasslands Soil | TALAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
JGI25615J43890_10841221 | 3300002910 | Grasslands Soil | AAAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
JGI25617J43924_103378521 | 3300002914 | Grasslands Soil | IAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
JGI25616J43925_101102301 | 3300002917 | Grasslands Soil | AIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0062385_110731362 | 3300004080 | Bog Forest Soil | IHTAWITAVVGALGHIVVLSQRLSTEEQVLFANPDYRAAMSGKPRFLPGLF* |
Ga0062389_1001295004 | 3300004092 | Bog Forest Soil | AWITAIAGSLAHIVVLSQRLATEEKVLFSDAQYREAMTGKPRFLPGLF* |
Ga0062386_1003959621 | 3300004152 | Bog Forest Soil | AGSLAHIAVLAQRLSTEERVLFANPDYRAAMSGKPRFLPGLF* |
Ga0062386_1012497822 | 3300004152 | Bog Forest Soil | PLIHTAWITTLVGAITHVVVLTVRLSAEERVLFANPDYAAAMSSKPRFLPGLF* |
Ga0062388_1007171811 | 3300004635 | Bog Forest Soil | AWITALVGTVAHIVVLSQRLSTEERVLFANPDYRAAMAGKPRFLPGLF* |
Ga0066679_104369512 | 3300005176 | Soil | AVAGAIAHMGVLAERLSTEERVLFANPHYRAAMTGKPRFLPGLF* |
Ga0066388_1001526084 | 3300005332 | Tropical Forest Soil | WITAVVGAAAHIIVLSLRLSVEDPVLLSNPDYAAVMGSKPRFLPGLF* |
Ga0066388_1043967491 | 3300005332 | Tropical Forest Soil | HTAWITALVGAAAHVIVLSLRLSVEDPVLLSNPDYAAAMGSKPRFLPGLF* |
Ga0070711_1012392052 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGAIAHTIVLTLRLSTEERVLFANPDYAAAMSSKPRFFPGLF* |
Ga0070694_1019307091 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LIHTAWITATAGAIAHIRVLAQRLSTEERMLFANPDYRAAMTGKPRFLPGLF* |
Ga0068867_1017776072 | 3300005459 | Miscanthus Rhizosphere | LAHMAVLAQRLSTEEAVLFANPDYRAAMTGKPRFLPGLF* |
Ga0070734_101428103 | 3300005533 | Surface Soil | SWVLRHRLSLEEPVLEANPAYRAAMAGKPRFLPKLF* |
Ga0066697_100240191 | 3300005540 | Soil | AWITATVGAVAHAGILAQRLSTEERVLFANPDYRAAMNGKPRFLPGLF* |
Ga0066654_105860711 | 3300005587 | Soil | AWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0070761_103343891 | 3300005591 | Soil | WITAVVGSLAHMAVLSMRLSTEERVLLANPEYQATMASKPRFIPGVF* |
Ga0070762_105715271 | 3300005602 | Soil | SLAHIAVLSMRLSTEERVLLANPEYRATMADKPRFLPGVF* |
Ga0070766_112018492 | 3300005921 | Soil | VLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0080026_100281733 | 3300005952 | Permafrost Soil | AAVLTQRLSTEERVLFANPDYRAAMAGKPRFLPGLF* |
Ga0081540_12377022 | 3300005983 | Tabebuia Heterophylla Rhizosphere | IALPLMHSAWITASLGALAHTAVLYLRLSVEDPVLLANPDYAARMGSKPRFLPGLF* |
Ga0066651_103905111 | 3300006031 | Soil | AGSLAHAIVLSQRLATEEKVLFADPQYRAAMSSKPRFVPGLF* |
Ga0066656_101548133 | 3300006034 | Soil | GVLAQRLSTEERVLLANPDYRAAMMGKPRFLPGLF* |
Ga0075029_1005510521 | 3300006052 | Watersheds | ITALVGSLAHIVVLSMRLSTEERVLLANPEYQATMANKPRFIPGVF* |
Ga0075026_1006034352 | 3300006057 | Watersheds | IHTAWITAAAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0075019_101457633 | 3300006086 | Watersheds | ITAIAGAIAHIGVLAQRLSTEERVLLANPDYRAAMSGKPRFLPGLF* |
Ga0075030_1009315931 | 3300006162 | Watersheds | YALAISQRIAVEESVLLANPDYRAAMAGKPRFLPGLF* |
Ga0075018_103621992 | 3300006172 | Watersheds | VVLCQRLSTEERVLFSDAQYRAAMAGKPRFLPGLF* |
Ga0075018_108239492 | 3300006172 | Watersheds | HTAWITAIAGSLAHVLVLSQRLATEERVLFSDAQYRAAMTGKPRFLPGLF* |
Ga0066665_108312262 | 3300006796 | Soil | IHTAWITAIAGSLAHAIVLSQRLATEEKVLFADPQYRAAMSSKPRFVPGLF* |
Ga0066660_108981941 | 3300006800 | Soil | GAFAHIGVLAQRLSTEERVLSANPDYRAAMTGKPRFLPGLF* |
Ga0079221_107977712 | 3300006804 | Agricultural Soil | HTAWITALAGSLAHVAVLGQRLSTEERVLFANPEYRTAMGGKPRFLPGLF* |
Ga0075436_1013681411 | 3300006914 | Populus Rhizosphere | PLIHTAWITALAGAIAHAIVLSLRLSVEDPVLLSNPDYAAAMGSKPRFLPGLF* |
Ga0099791_101227732 | 3300007255 | Vadose Zone Soil | MGVLAQRLSTEERVLLANPDYRAAMMGKPRFLPGLF* |
Ga0099793_101379272 | 3300007258 | Vadose Zone Soil | HTAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTDKPRFLPGLF* |
Ga0099793_102430432 | 3300007258 | Vadose Zone Soil | HTAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0099793_105317101 | 3300007258 | Vadose Zone Soil | HIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0099794_105007402 | 3300007265 | Vadose Zone Soil | GVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0099794_105178672 | 3300007265 | Vadose Zone Soil | LIHTAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0099795_100921582 | 3300007788 | Vadose Zone Soil | VATISQRIALEESVLFANPAYRTAMAGKPRFLPGLF* |
Ga0099829_102596963 | 3300009038 | Vadose Zone Soil | AVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0099830_106835141 | 3300009088 | Vadose Zone Soil | ITAAAGTIAHIGVLAQRLSTEERVLFANPDYRAAMSGKPRFFPGLF* |
Ga0099830_110129602 | 3300009088 | Vadose Zone Soil | AHVAVLAQRLSTEERVLFANADYRAAMTGKPRFLPGLF* |
Ga0099828_108887222 | 3300009089 | Vadose Zone Soil | HSAWITAAVGTIAHIVVLSQRLATEERVLFADDHYRMAMSGKPRFVPGLF* |
Ga0099827_104919592 | 3300009090 | Vadose Zone Soil | WILSRRLAVEEPVLLASPAYRAAMAHKPRFLPGLF* |
Ga0099792_106826202 | 3300009143 | Vadose Zone Soil | ATAGAIAHAGVLAQRLSTEERVLSANPDYRAAMTGKPRFLPGLF* |
Ga0105241_125083621 | 3300009174 | Corn Rhizosphere | LAGAVAHIIVLSLRLSVEDPVLLSNPDYAATMGSKPRFLPGLF* |
Ga0105249_112838662 | 3300009553 | Switchgrass Rhizosphere | TALAGSLAHMAVLAQRLSTEEAVLFANPDYRAAMTGKPRFLPGLF* |
Ga0126380_115008831 | 3300010043 | Tropical Forest Soil | HTAWITALAGAALHVVVLALRLSVEDPMLLANPDYRAAMGGKPRFLPGLF* |
Ga0126384_120846981 | 3300010046 | Tropical Forest Soil | AIAGSLAHIIVLTQRLSTEEKVLFADPQYREAMSAKPRFVPRLF* |
Ga0126373_109222191 | 3300010048 | Tropical Forest Soil | VLSQRLATEERVLFSDARYREAMAGKPRFVPGLF* |
Ga0126370_126794811 | 3300010358 | Tropical Forest Soil | IAGSLAHIIVLSQRLSTEEKVLFADPKYREAMSSKPRFVPGLF* |
Ga0126376_114542051 | 3300010359 | Tropical Forest Soil | ALAGAFAHTIVLSLRLSVEDPMLLSNPDYAATMGSKPRFLPGLF* |
Ga0126376_115313671 | 3300010359 | Tropical Forest Soil | LIHAAWMTAVAGSLAHAAVLGQRIATEERALLANPDYRAAMAGKPKFWPRFL* |
Ga0126372_128808632 | 3300010360 | Tropical Forest Soil | AWITAVLGSAAHIAVLSQRLATEERVLFSDARYREAMSGKPRFVPGLF* |
Ga0126378_103172453 | 3300010361 | Tropical Forest Soil | GSLAHAAVLGQRIATEERALLANPDYRAAMAGKPKFWPRFL* |
Ga0126378_104587893 | 3300010361 | Tropical Forest Soil | WITAAFGSLAHLLVLSQRLATEERVLFADARYREVMSGKPRFLPGLF* |
Ga0126378_115683961 | 3300010361 | Tropical Forest Soil | HTAVLAQRLATEERVLFANPDYRAAMAGKPRFLPGLF* |
Ga0126377_103959543 | 3300010362 | Tropical Forest Soil | AWITAIAGSLAHAIVLTQRLSTEEKILFADPQYREAMSSKPRFVPRLF* |
Ga0126383_126419402 | 3300010398 | Tropical Forest Soil | AHVIVLMQRVSAEERVLLANADYRAAMAQKARFLPGVF* |
Ga0134121_114525992 | 3300010401 | Terrestrial Soil | AWITALAGSLAHAVVLAQRLSTEERVLLASEEYRLAMAAKPRFLPGLF* |
Ga0134123_102898291 | 3300010403 | Terrestrial Soil | HMAVLAQRLSTEEAVLFANPDYRAAMTGKPRFLPGLF* |
Ga0150983_142810211 | 3300011120 | Forest Soil | LAHVVVLAQRLSAEERVLFANSDYRAAMAGKPRFLPGMF* |
Ga0150983_158348991 | 3300011120 | Forest Soil | HIAVLSMRLSTEERVLLANPEYQASMANKPRFIPGVF* |
Ga0150983_167181772 | 3300011120 | Forest Soil | AHMGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0137392_100004991 | 3300011269 | Vadose Zone Soil | AVLAQRLSTEERVLFANADYRAAMTGKPRFLPGLF* |
Ga0137392_101941193 | 3300011269 | Vadose Zone Soil | AWITAAAGAMAHIAVLAQRLSTEERVLFANPAYRAAMTGKPRFLPGLF* |
Ga0137392_110791701 | 3300011269 | Vadose Zone Soil | IGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0137393_101108643 | 3300011271 | Vadose Zone Soil | LIHTAWITALAGAIAHVLVLALRLSTEERVLFANPDYAAAMASKPRFLPGLF* |
Ga0137393_116583872 | 3300011271 | Vadose Zone Soil | LIHTAWMTAAAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0137364_104775832 | 3300012198 | Vadose Zone Soil | IHTAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0137364_107934802 | 3300012198 | Vadose Zone Soil | GAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKRRFLPGLF* |
Ga0137382_102532382 | 3300012200 | Vadose Zone Soil | IHTAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKRRFLPGLF* |
Ga0137363_105445111 | 3300012202 | Vadose Zone Soil | AWITAIVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF* |
Ga0137399_117067962 | 3300012203 | Vadose Zone Soil | PMIHTAWITAIAGSLAHAIVLSQRLATEEKVLFADPQYRAAMSSKPRFVPGLF* |
Ga0137362_117614762 | 3300012205 | Vadose Zone Soil | TAWITAIVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSRKPRFLPGLF* |
Ga0137377_100776274 | 3300012211 | Vadose Zone Soil | WITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0137377_111122192 | 3300012211 | Vadose Zone Soil | ITAVGGAIAHMGVLAQRLSTEERVLFANPHYRAAMTGKPRFLPGLF* |
Ga0137386_106820242 | 3300012351 | Vadose Zone Soil | HTAWITATVGAIAHAGVLAQRLATEERVLSANPDYRAAMTGKPRFLPGLF* |
Ga0137384_105041921 | 3300012357 | Vadose Zone Soil | TALAGAIAHVIVLALRLSTEERVLLANPDYAAAMGSKPRFLPGLF* |
Ga0137385_109229401 | 3300012359 | Vadose Zone Soil | LVHTAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0137360_105324452 | 3300012361 | Vadose Zone Soil | HTAWITAIVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSRKPRFLPGLF* |
Ga0137361_104914822 | 3300012362 | Vadose Zone Soil | AWITALAGAIAHVAVLALRLSTEERVLLANPDYAAAMSSKPRFLPGLF* |
Ga0137358_109813992 | 3300012582 | Vadose Zone Soil | VVLAQRLSTEERVLFADPGYRSAMADKPRFLPGLF* |
Ga0137398_103253141 | 3300012683 | Vadose Zone Soil | IVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF* |
Ga0137396_101373253 | 3300012918 | Vadose Zone Soil | AGAIAHMGVLAQRLSTEERVLLSNPDYRAAMMGKPRFLPGLF* |
Ga0137396_103996601 | 3300012918 | Vadose Zone Soil | LAHATVLAQRLSTEERVLFANPDYRSAMTGKPRFLPGLF* |
Ga0137396_105244552 | 3300012918 | Vadose Zone Soil | PLMHTAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0137419_117109471 | 3300012925 | Vadose Zone Soil | LIHTAWITALAGAIAHIGVLAQRLSTEERVLFANPAYRAAMTGKPRFLPGLF* |
Ga0137407_111558342 | 3300012930 | Vadose Zone Soil | TAWIIAIAGSLAHAIVLSQRLATEEKVLFADPQYRAAMSSKPRFVPGLF* |
Ga0153915_134626822 | 3300012931 | Freshwater Wetlands | AHAFVLAQRVATEEHVLLANPEYRAAMAGKPRFLPELFR* |
Ga0137410_107562931 | 3300012944 | Vadose Zone Soil | AGAVAHMGVLAQRLSTEERVLLANPDYRAAMMGKPRFLPGLF* |
Ga0134076_101496462 | 3300012976 | Grasslands Soil | AWMTAAAGAIAHVGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0164309_118154291 | 3300012984 | Soil | HMAVLAQRLATEEAVLFANPDYRAAMTGKPRFLPGLF* |
Ga0157376_130512832 | 3300014969 | Miscanthus Rhizosphere | LAHIVVLSQRLSTEERVLFSDAQYRAAMAGKPRFLPGLF* |
Ga0137411_12301512 | 3300015052 | Vadose Zone Soil | IAHIGVLAQRLSTEERVLFANPDYRAAMSGKPRFLPGLF* |
Ga0137405_13015318 | 3300015053 | Vadose Zone Soil | MHMGVLAQRLSTEERVLLANPDYRAAMMGKAALLPGLF* |
Ga0137420_11171121 | 3300015054 | Vadose Zone Soil | YFGTLALVLSQRLVTEEKVLFSDAHYRDAMSRKPRFLPGLF* |
Ga0137420_13738873 | 3300015054 | Vadose Zone Soil | IGVLAQRLATEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0167638_10910181 | 3300015197 | Glacier Forefield Soil | LVGAVAHVAVLSQRLSTEERVLFANPAYRAAMAGKPRFIPGLF* |
Ga0137418_106611062 | 3300015241 | Vadose Zone Soil | GAMAHAGVLAQRLATEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0137412_101305011 | 3300015242 | Vadose Zone Soil | VGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF* |
Ga0137403_105296611 | 3300015264 | Vadose Zone Soil | IHTAWITAAAGAIVHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF* |
Ga0132256_1014866511 | 3300015372 | Arabidopsis Rhizosphere | HTAWITALVGAMAHIAVLYLRLSVEDPVLLSNPDYAAVMGSKPRFLPGLF* |
Ga0182035_100112455 | 3300016341 | Soil | LPLIHTAWITALAGALAHMIVLSLRLSVEDPVLLSNPHYAAAMGSKPRFFPGLF |
Ga0182032_116159932 | 3300016357 | Soil | WITALVGSTAHVLVLSQRLATEERVLFSDAHYRDAMSGKPRFLPGLF |
Ga0182034_102791551 | 3300016371 | Soil | PLIHTAWITALVGAALHVVILSLRLSIEDPVLLGNPDYAAAMGSKPRFLPGLF |
Ga0182038_116786042 | 3300016445 | Soil | LHCAWITAGVGAVAHLLVLSRRIHTGEHVLFADERYREAMSGKARFLPGLF |
Ga0187820_10067094 | 3300017924 | Freshwater Sediment | VGSAVHVLILSRRIHTEERVLFTDAHYREAMYGKPRFVPGLF |
Ga0187817_102832131 | 3300017955 | Freshwater Sediment | HILVLSQRLATEERVLFSDVHYREAMSSKPRFVPGLF |
Ga0187778_106191881 | 3300017961 | Tropical Peatland | LIHCAWITALAGSLAHVIVLSQRLATEERVLFSDAHYREAMYGKPRFVPGLF |
Ga0187777_100888364 | 3300017974 | Tropical Peatland | GSAAHVMVMSQRLATEERVLFSDAQYREAMARKPRFLPGLF |
Ga0187782_102070541 | 3300017975 | Tropical Peatland | AHIMVLSQRLATEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0187804_102428682 | 3300018006 | Freshwater Sediment | AWITALAGSLAHILVLSQRLATEERVLFADAQYRAAMSGKPRFVPGLF |
Ga0187772_108843462 | 3300018085 | Tropical Peatland | GSLAHILVLSQRLATEERVLFADAQYRAAMSHKPRFVPGLF |
Ga0187772_114094851 | 3300018085 | Tropical Peatland | VVGSAAHVLVLSQRLATEERVLLSDVHYREAMSGKPRFVPGLF |
Ga0066662_128389102 | 3300018468 | Grasslands Soil | HTAWITAVAGAIVHMGVLAQRLSTEERVLLANPDYRAAMMGKPRFLPGLF |
Ga0066669_103256951 | 3300018482 | Grasslands Soil | LIHTAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0137408_14573327 | 3300019789 | Vadose Zone Soil | SHSHCVDNGLAGSLGHAIVLSQRLSTEEKVLFADPDYRAAMSSKPRFLPGLF |
Ga0179592_105336512 | 3300020199 | Vadose Zone Soil | VLGAIAHIAVLSQRLSTEERVLFANPDYRTAMNGKPRFLPGLF |
Ga0210407_114373841 | 3300020579 | Soil | IHTAWITAIAGTIAHMGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0210403_110098962 | 3300020580 | Soil | WITAIVGSAAHILVLSQRLVTEEKVLFSDAHYRNAMSGKPRFLPGLF |
Ga0210403_113262052 | 3300020580 | Soil | LIHTAWITAIVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0210399_105341232 | 3300020581 | Soil | IAVLSMRLSTEERVLLANPEYQVSMANKPRFIPGVF |
Ga0210399_107199731 | 3300020581 | Soil | TAWITATAGAIAHIGVLAQRLSTEERVLLANPDYRAAMSGKPRFLPGLF |
Ga0210399_110624502 | 3300020581 | Soil | AATISQRISLEESVLLANPTYRTAMAGKPRFLPGLF |
Ga0210399_114137171 | 3300020581 | Soil | CCGALAHVVVLAQRLSAEERVLFANSDYRAAMAGKPRFLPGMF |
Ga0210401_104607181 | 3300020583 | Soil | TALAGSLAHVAVLGQRLSTEERVLFANPEYRNVMGGKPRFLPGLF |
Ga0215015_108905551 | 3300021046 | Soil | VYKRQALAGSLAHIGVLSQRLSTEERVLFANPDYRAAMAGKPRFLPGLF |
Ga0179596_104634882 | 3300021086 | Vadose Zone Soil | ITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0210400_100473744 | 3300021170 | Soil | IGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0210400_111217122 | 3300021170 | Soil | LAHIGVLTQRLSTEERVLFANPEYRAAMSSKPRFLPGLF |
Ga0210405_100209661 | 3300021171 | Soil | SAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0210393_112269521 | 3300021401 | Soil | TAWITAIAGAAAHVLVLSQRLSTEERVLFSDSNYRAAMSGKPRFVPGLF |
Ga0210385_102218833 | 3300021402 | Soil | VGTLGYVSVLAQRIPLEERTLFANPDYRAAMSAKPRFLPGLF |
Ga0210397_114682761 | 3300021403 | Soil | IHTAWITAAAGTLAHMGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0210387_100868924 | 3300021405 | Soil | GSLAHIVVLSQRLSTEERVLFSDAQYRAAMAGKPRFLPGLF |
Ga0210387_111159211 | 3300021405 | Soil | YVSVLAQRIPLEERALLANPDYRAAMSAKPRFLPGLF |
Ga0210386_117474852 | 3300021406 | Soil | TALIGSLAHIGVLTMRLSTEERVLLANPEYQATMANKPRFIPGVF |
Ga0210383_100046841 | 3300021407 | Soil | ITAAVGSAAHILVLSRRINTEERVLFSDAHYREAMYGKPRFLPGLF |
Ga0210383_103897371 | 3300021407 | Soil | GTLAHAAVLSQRLATEERVLFANPDYRAAMAGKPRFLPGLF |
Ga0210394_102489363 | 3300021420 | Soil | AAHILVLSQRLMTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0210394_107107381 | 3300021420 | Soil | LIHTAWITALIGSLAHIGVLTMRLSTEERVLLANPEYQATMANKPRFIPGVF |
Ga0210394_109717272 | 3300021420 | Soil | IHTAWITAIVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0210390_104764512 | 3300021474 | Soil | GTLAHAAVLSQRLSTEERVLFANPDYRAAMAGKPRFLPGLF |
Ga0210398_110801632 | 3300021477 | Soil | ALVLSRRINTEERVLFSDTRYREAMYGKPRFLPGLF |
Ga0210402_108470921 | 3300021478 | Soil | AVLARRLSTEERVLFADPAYRAAMAGKPRFLPGLF |
Ga0210402_109927592 | 3300021478 | Soil | LIHTAWITALAGSLAHMAVLTQRLSTEERVLFANPDYRAAMSGKPRFLPGLF |
Ga0210410_113159241 | 3300021479 | Soil | LVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0210409_108007641 | 3300021559 | Soil | LAHIVVLSQRLSTEERVLFSDAQYRAAMAGKPRFLPGLF |
Ga0126371_128343032 | 3300021560 | Tropical Forest Soil | IHTAWITALVGSTAHVLVLSQRLATEEKVLFSDAHYREAMSGKPRFLPGLF |
Ga0126371_131393042 | 3300021560 | Tropical Forest Soil | SLAHLLVLSQRLATEERVLFADARYREVMSGKPRFLPGLF |
Ga0213880_100798711 | 3300021953 | Exposed Rock | ANALILARRIAREEAGLLADPAYRAAMAGKPRFLPGLV |
Ga0242662_100482781 | 3300022533 | Soil | AAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0224520_10873801 | 3300023075 | Soil | LVLSQRLATEERVLFADAQYRAAMSDKPRFVPGLF |
Ga0247694_10054061 | 3300024178 | Soil | SLAHVAVLSQRLSTEERVLLANPEYRATMAGKPRFLPGVF |
Ga0247695_10503512 | 3300024179 | Soil | TALVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0247693_10552571 | 3300024181 | Soil | AWITALAGALAHIIVLSLRLSVEDPVLLSNPDYAATMGSKPRFLPGLF |
Ga0247671_10443701 | 3300024284 | Soil | PLIHTAWITALAGALAHIIVLSLRLSVEDPVLLSNPDYAATMGSKPRFLPGLF |
Ga0247687_10809492 | 3300024286 | Soil | AIAGSLAHAIVLSQRLATEEKVLFADPQYRAAMSSKPRFVPGLF |
Ga0179591_10349764 | 3300024347 | Vadose Zone Soil | ITAIVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSRKPRFLPGLF |
Ga0208039_10531492 | 3300025454 | Peatland | AGSLAHILVLSQRLATEERVLFADAQYRAAMSDKPRFVPGLF |
Ga0207700_108880771 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AGAVVHIVVLTFRLSAEERVLFADPEYAAAMSSKPRFLPGLF |
Ga0207670_113473711 | 3300025936 | Switchgrass Rhizosphere | GSLAHMAVLAQRLSTEEAVLFANPDYRAAMTGKPRFLPGLF |
Ga0207665_102178041 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ITALAGAIAHVIVLALRLSTEERVLLANPDYAAAMGSKPRFLPGLF |
Ga0207665_103409152 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TAWITAVAGAMAHMGVLAQRLSTEERVLFANPHYRAAMTGKPRFLPGLF |
Ga0207712_108916691 | 3300025961 | Switchgrass Rhizosphere | AWITALVGAMAHIAVLYLRLSVEDPVLLSNPDYAAVMGSKPRFLPGLF |
Ga0207639_122414292 | 3300026041 | Corn Rhizosphere | AIAHIVVLTLRLSVEDPMLLSNPDYAAAMGSKPRFLPGLF |
Ga0207641_125123231 | 3300026088 | Switchgrass Rhizosphere | VPLIHTAWITALVGAIAHIVVLTLRLSVEDPMLLSNPDYAAAMGSKPRFLPGLF |
Ga0207648_115976131 | 3300026089 | Miscanthus Rhizosphere | ADVRTALAGSLAHMAVLAQRLSTEEAVLFANPDYRAAMTGKPRFLPGLF |
Ga0207648_122262722 | 3300026089 | Miscanthus Rhizosphere | LPLMHTAWITALVGAMAHIAVLYLRLSVEDPVLLSNPDYAAVMGSKPRFLPGLF |
Ga0209438_10636903 | 3300026285 | Grasslands Soil | HIGVLAQRLSTEERVLFANPDYRAAMSGKPRFLPGLF |
Ga0209238_10188895 | 3300026301 | Grasslands Soil | LAHAIVLSQRLATEEKVLFADPQYRAAMSSKPRFVPGLF |
Ga0209240_10505283 | 3300026304 | Grasslands Soil | IHTAWITAAAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0209688_10982901 | 3300026305 | Soil | VAGAIAHMGVLAQRLSTEERVLFANPNYRAAMTGKPRFLPGLF |
Ga0209761_13017011 | 3300026313 | Grasslands Soil | GAIVHMGVLAQRLSTEERVLLANPDYRAAMMGKPRFLPGLF |
Ga0209377_12480602 | 3300026334 | Soil | ATVGAVAHAGILAQRLSTEERVLFANPDYRAAMNGKPRFLPGLF |
Ga0257173_10065941 | 3300026360 | Soil | AHVLVLTLRLSTEERVLFANPDYAAAMSSKPRFLPGLF |
Ga0257154_10396642 | 3300026467 | Soil | VAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0257155_10901231 | 3300026481 | Soil | ITAIAGAIAHIGVLAQRLSTEERVLLANPDYRAAMSGKPRFLPGLF |
Ga0257168_11496892 | 3300026514 | Soil | ITALIGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0209805_11755062 | 3300026542 | Soil | GVLAQRLSTEERVLFANPDYRAAMNGKPRFLPGLF |
Ga0179587_110835731 | 3300026557 | Vadose Zone Soil | IAVLSQRLFTEERVLLANPDYRTAMNGKPRFLPGLF |
Ga0207760_1138142 | 3300026845 | Tropical Forest Soil | ITAIVGSVGHVIVLSQRLATEERVLFSDAHYREAMAGKPRFVPGLF |
Ga0207949_10110861 | 3300026999 | Forest Soil | IGVLSQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0208604_10154022 | 3300027090 | Forest Soil | AVLGSLAHIAVLSMRLSTEERVLLANPEYQATMGNKPRFIPGVF |
Ga0209735_10439241 | 3300027562 | Forest Soil | AGAIAHTGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0209733_10321133 | 3300027591 | Forest Soil | LAGSLAHVVVLAQRLSTEERVLFADPGYRSAMAGKPRFLPGLF |
Ga0209528_11043292 | 3300027610 | Forest Soil | AWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0208990_11853131 | 3300027663 | Forest Soil | WITAIAGAIAHIGVLAQRLSTEERVLFANPDYRAAMSGKPRFLPGLF |
Ga0208991_11457021 | 3300027681 | Forest Soil | HIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0208989_100703313 | 3300027738 | Forest Soil | AWITALAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0209908_102462411 | 3300027745 | Thawing Permafrost | MAVLSQRLAMEERVLFANPDYRAAMAGKPRFLPGLF |
Ga0209656_102994982 | 3300027812 | Bog Forest Soil | HILVLSRRINTEERVLFSDAHYREAMSGKPRFLPGLF |
Ga0209656_103682441 | 3300027812 | Bog Forest Soil | PLIHTAWITTLVGAITHVVVLTVRLSAEERVLFANPDYAAAMSSKPRFLPGLF |
Ga0209580_101043251 | 3300027842 | Surface Soil | SLAHVAVLGQRLSTEERVLFANPEYRTVMGGKPRFLPGLF |
Ga0209580_105702831 | 3300027842 | Surface Soil | AVLSMRLSTEERVLLANPEYQATMASKARFIPGVF |
Ga0209701_100399001 | 3300027862 | Vadose Zone Soil | AGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0209701_103978831 | 3300027862 | Vadose Zone Soil | FAVTISQRIAVEEGVLLANPQYRAAMAGKPRFLPGLF |
Ga0209701_105030072 | 3300027862 | Vadose Zone Soil | HTAWITAAAGAVAHIGVLAQRLSTEERVLFANRDYRLAMSGKPRFLPGLF |
Ga0209283_103270782 | 3300027875 | Vadose Zone Soil | GAMAHIAVLAQRLSTEERVLFANPAYRAAMTGKPRFLPGLF |
Ga0209275_101044203 | 3300027884 | Soil | AWITAMVGSLAHIAVLSMRLSTEERVLLANPEYRATMADKPRFLPGVF |
Ga0209275_107183931 | 3300027884 | Soil | SLAHAAVLSMRLSTEERVLLANPEYQATMANKPRFIPGVF |
Ga0209380_101194433 | 3300027889 | Soil | LAHIAVLSMRLSTEERVLLANPEYQATMANKRRFIPGVF |
Ga0209068_106149901 | 3300027894 | Watersheds | IAHIGVLAQRLSTEERVLLANPDYRAAMSSKPRFLPGLF |
Ga0265319_12217781 | 3300028563 | Rhizosphere | IAVLSMRLSTEERVLLANPEYQATMANKPRFIPGVF |
Ga0265319_12375292 | 3300028563 | Rhizosphere | AIAGSLAHIAVLSMRLSTEERVLLANPEYQATMASKARFIPGVF |
Ga0265334_101103232 | 3300028573 | Rhizosphere | LGTLAHVLVLSERLTTEERVLFSDAKYRAAMAGKPRFLPGLF |
Ga0222749_101793111 | 3300029636 | Soil | MVGSLAHIAVLSMRLSTEERVLLANPEYQATMANKPRFIPGVF |
Ga0265460_126707072 | 3300030740 | Soil | MLALPLIHTAWITAIAGTVAHAAVLAQRLSTEERVLFANPDYRAAMAG |
Ga0170834_1104359902 | 3300031057 | Forest Soil | CFAVTISQRLAVEEGVLLANPQYRAAMAGKPRFVPGLF |
Ga0170834_1133737363 | 3300031057 | Forest Soil | AIVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0170823_128802581 | 3300031128 | Forest Soil | LIHTAWITALAGAVAHAIVLTFRLSAEERVLFADSQYAAAMRSKPRFLPGLF |
Ga0170823_162459752 | 3300031128 | Forest Soil | LIHTAWITALVGAIVHVAVLTVRLSAEERVLFANSDYAAAMSSKPRFLPGLF |
Ga0170824_1013431381 | 3300031231 | Forest Soil | AHIGVLAQRLSTEERVLLANPDYRAAMSGKPRFLPGLF |
Ga0318528_106672532 | 3300031561 | Soil | ALAGSLAHVLVLSQRLTTEERVLFADARYREAMSGKPRFLPGLF |
Ga0318555_105723291 | 3300031640 | Soil | ITAALGSLAHLLVLSQRLATEERVLFADARYREAMSGKPRFLPGLF |
Ga0310686_1005103522 | 3300031708 | Soil | AVLRHRLRLEEPVLDANPAYRAAMAGKPRFLPKLF |
Ga0307476_112168201 | 3300031715 | Hardwood Forest Soil | IAVLAQRLSTEERVLFANPDYRAAMAGKPRFLPGLF |
Ga0307469_106354961 | 3300031720 | Hardwood Forest Soil | WITAIVGSAAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0307469_125465651 | 3300031720 | Hardwood Forest Soil | TAIVGSVAHILVLSQRLVTEEKVLFSDAHYRDAMSGKPRFLPGLF |
Ga0318500_102980622 | 3300031724 | Soil | HMIVLSLRLSVEDPVLLSNPDYAAAMGSKPRFFPGLF |
Ga0306918_106707563 | 3300031744 | Soil | AAFGSLAHLLVLSQRLATEERVLFADARYREAMSGKPRFLPGLF |
Ga0318502_103789731 | 3300031747 | Soil | ITATVGALLHVVILSLRLSVEDPVLLANPDYAAAMGSKPRFLPGLF |
Ga0307477_107556551 | 3300031753 | Hardwood Forest Soil | VTISQRIALEENVLFANPDYRAAMAGKPRFLPGLF |
Ga0318508_12462291 | 3300031780 | Soil | AHLLVLSQRLATEERVLFADARYREVMSGKPRFLPGLF |
Ga0307473_108045191 | 3300031820 | Hardwood Forest Soil | TAIAGSLAHIVVLSQRLSTEERVLFSDAQYRAAMAGKPRFLPGLF |
Ga0306919_107717021 | 3300031879 | Soil | GSAAHVLVLSQRLATEERILFSDARYREAMARKPRFVPGLF |
Ga0306923_105054201 | 3300031910 | Soil | WITAAFGSLAHLLVLSQRLATEERVLFADARYREAMSGKPRFLPGLF |
Ga0306923_107224752 | 3300031910 | Soil | IHTAWITAFVGAGLHVVILSLRLSVEDPVLLGNPDYAAAMGSKPRFFPGLF |
Ga0306923_112918032 | 3300031910 | Soil | GSLAHLLVLSQRLATEERVLFADARYREAMSGKPRFLPGLF |
Ga0310916_101017401 | 3300031942 | Soil | GSLAHVLVLSQRLTTEERVLFADARYREAMSGKPRFLPGLF |
Ga0310913_104384291 | 3300031945 | Soil | HLLVLSQRLATEERVLFADARYREAMSGKPRFLPGLF |
Ga0310910_104321512 | 3300031946 | Soil | AWITASVGALLHVVILSLRLSVEDPVLLANPDYAAAMGSKPRFLPGLF |
Ga0310910_105580581 | 3300031946 | Soil | LLVLSRRIHTEEHVLFADERYREAMSGKARFLPGLF |
Ga0306926_105965163 | 3300031954 | Soil | LIHCAWITAVLGSAAHVAVLSQRLATEERVLFSDARYREAMAGKPRFVPGLF |
Ga0306926_127684062 | 3300031954 | Soil | VVVFSPRLATEERVLFSDARYREAMAGKPRFLPGLF |
Ga0307479_102153963 | 3300031962 | Hardwood Forest Soil | TAWITAVAGAIAHIGVLAQRLSTEERVLFANPDYRAAMTGKPRFLPGLF |
Ga0307479_104710711 | 3300031962 | Hardwood Forest Soil | WITALAGAIVHVLVLALRLSTEERVLFANPDYAAAMSSKPRFLPGLF |
Ga0307479_106369872 | 3300031962 | Hardwood Forest Soil | AGSLAHLVVLSQRLSTEERVLFSDAQYRAAMAGKPRFLPGLF |
Ga0306922_110723602 | 3300032001 | Soil | PLIHCAWIAAIVGSAAHVLVLSQRLATEERILFSDARYREAMARKPRFVPGLF |
Ga0318562_100354161 | 3300032008 | Soil | IHTAWITALAGALAHMIVLSLRLSVEDPVLLSNPHYAAAMGSKPRFFPGLF |
Ga0310911_102525342 | 3300032035 | Soil | IHTAWITALAGAIAHVIVLSVRLSSEERVLFANPDYAAAMSAKPRFIPGLF |
Ga0318533_107893661 | 3300032059 | Soil | AWITAGVGAVAHLLVLSRRIHTEEHVLFADERYREAMSGKARFLPGLF |
Ga0306924_124911242 | 3300032076 | Soil | SLAHMVVLSQRLSTEERVLFSDAQYRAAMAGKPRFLPGLF |
Ga0307471_1001033753 | 3300032180 | Hardwood Forest Soil | AWITALAGAVAHAIVLTFRLSAEERVLFADSQYAAAMRSKPRFLPGLF |
Ga0307471_1010758372 | 3300032180 | Hardwood Forest Soil | TATAGAIAHIGVLAQRLSTEERVLLANPDYRAAMMGKPRFLPGLF |
Ga0306920_1001077295 | 3300032261 | Soil | AVGSLAHLLVLSQRLATEERVLFADARYREVMSGKPRFLPGLF |
Ga0306920_1035257731 | 3300032261 | Soil | IHTAWITAVFGSLAHAAVLSQRLSTEEKVLFSDPSYRAAMSSKPRFVPRLF |
Ga0335070_119378671 | 3300032829 | Soil | TGSIAHILVLSQRLATEERVLFADAQYRAAMSDKPRFVPGLF |
Ga0335070_120893621 | 3300032829 | Soil | TAWITALAGSAAHILVLSQRLATEEKVLFSDAHYREAMSGKPRFLPGLF |
Ga0335076_102575383 | 3300032955 | Soil | VGALAHAVVLSQRLSTEERVLLANAEYRAAMGHKARFIPGLF |
Ga0335084_124260062 | 3300033004 | Soil | VAGSLAHIVVLSQRLATEERVLFANPDYRAKMAGKPRFLPGLF |
Ga0335077_107808421 | 3300033158 | Soil | HMMVLAQRLSTEEPVLFANQDYRAAMTGKPRFFPGLF |
Ga0371489_0435621_2_124 | 3300033755 | Peat Soil | SAAHLLILSRRIHTEEQVLFSDARYREAMFGKPRFLPGLF |
⦗Top⦘ |