Metagenome / Metatranscriptome Family F014144

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F014144
Family Type	Metagenome / Metatranscriptome
Number of Sequences	265
Average Sequence Length	39 residues
Representative Sequence	MQKGKVVICDICNKEIEVRWGIFAHDTLSRHRKAEHK
Number of Associated Samples	154
Number of Associated Scaffolds	265

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	49.11 %
% of genes near scaffold ends (potentially truncated)	23.77 %
% of genes from short scaffolds (< 2000 bps)	43.40 %
Associated GOLD sequencing projects	146
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (56.981 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (21.132 % of family members)
Environment Ontology (ENVO)	Unclassified (56.226 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (67.170 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 18.46% β-sheet: 9.23% Coil/Unstructured: 72.31%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 265 Family Scaffolds
PF03796	DnaB_C	12.08
PF13662	Toprim_4	6.04
PF13506	Glyco_transf_21	3.40
PF13641	Glyco_tranf_2_3	2.26
PF02945	Endonuclease_7	1.51
PF05050	Methyltransf_21	1.51
PF02811	PHP	1.51
PF00154	RecA	1.13
PF13640	2OG-FeII_Oxy_3	1.13
PF01521	Fe-S_biosyn	1.13
PF13524	Glyco_trans_1_2	0.75
PF05118	Asp_Arg_Hydrox	0.75
PF00565	SNase	0.75
PF05065	Phage_capsid	0.75
PF04586	Peptidase_S78	0.75
PF13884	Peptidase_S74	0.75
PF01807	zf-CHC2	0.75
PF02668	TauD	0.75
PF00436	SSB	0.75
PF08007	JmjC_2	0.75
PF07733	DNA_pol3_alpha	0.75
PF00041	fn3	0.75
PF00011	HSP20	0.75
PF13155	Toprim_2	0.75
PF09479	Flg_new	0.75
PF01370	Epimerase	0.38
PF00085	Thioredoxin	0.38
PF01476	LysM	0.38
PF09360	zf-CDGSH	0.38
PF02467	Whib	0.38
PF09458	H_lectin	0.38
PF05257	CHAP	0.38
PF07883	Cupin_2	0.38
PF16861	Carbam_trans_C	0.38
PF14020	DUF4236	0.38
PF00210	Ferritin	0.38
PF14279	HNH_5	0.38
PF14579	HHH_6	0.38
PF13385	Laminin_G_3	0.38
PF04577	Glyco_transf_61	0.38
PF00535	Glycos_transf_2	0.38
PF01464	SLT	0.38
PF04820	Trp_halogenase	0.38
PF02511	Thy1	0.38

COG ID	Name	Functional Category	% Frequency in 265 Family Scaffolds
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	12.08
COG1066	DNA repair protein RadA/Sms, contains AAA+ ATPase domain	Replication, recombination and repair [L]	12.08
COG4841	Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family	Function unknown [S]	1.13
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	1.13
COG0316	Fe-S cluster assembly iron-binding protein IscA	Posttranslational modification, protein turnover, chaperones [O]	1.13
COG0358	DNA primase (bacterial type)	Replication, recombination and repair [L]	0.75
COG0587	DNA polymerase III, alpha subunit	Replication, recombination and repair [L]	0.75
COG0629	Single-stranded DNA-binding protein	Replication, recombination and repair [L]	0.75
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.75
COG2176	DNA polymerase III, alpha subunit (gram-positive type)	Replication, recombination and repair [L]	0.75
COG2850	Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain	Translation, ribosomal structure and biogenesis [J]	0.75
COG2965	Primosomal replication protein N	Replication, recombination and repair [L]	0.75
COG3555	Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily	Posttranslational modification, protein turnover, chaperones [O]	0.75
COG3740	Phage head maturation protease	Mobilome: prophages, transposons [X]	0.75
COG4653	Predicted phage phi-C31 gp36 major capsid-like protein	Mobilome: prophages, transposons [X]	0.75
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.75
COG1351	Thymidylate synthase ThyX, FAD-dependent family	Nucleotide transport and metabolism [F]	0.38

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	66.04 %
Unclassified	root	N/A	33.96 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	62.26 %
Unclassified	root	N/A	33.96 %
cellular organisms	root	All Organisms → cellular organisms	3.77 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	56.98 %
Unclassified	root	N/A	33.96 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	56.98 %
Unclassified	root	N/A	33.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.64 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.13 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	56.98 %
Unclassified	root	N/A	33.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	2.26 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.13 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.38 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	56.98 %
Unclassified	root	N/A	33.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2.26 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.13 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.96 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	32.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	2.26 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	2.64 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	1.13 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.96 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %
Aphanizomenonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae	2.26 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1.13 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	1.51 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.96 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %
Aphanizomenon	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon	2.26 %
Samistivirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus	1.51 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.38 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.38 %
unclassified Flavobacteriales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.96 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %
Aphanizomenon flos-aquae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae	2.26 %
Streptomyces virus Jay2Jay	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay	1.51 %
unclassified Flavobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae	0.38 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.38 %
Flavobacteriales bacterium TMED228	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.96 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32.08 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	3.02 %
Aphanizomenon flos-aquae WA102	isolate	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	2.26 %
Streptomyces phage Jay2Jay	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	1.51 %
Flavobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	0.38 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.38 %
Flavobacteriales bacterium TMED228	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228	0.75 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001282\|B570J14230_10084181	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	981	Open in IMG/M
3300001838\|RCM33_1036351	Not Available	786	Open in IMG/M
3300001851\|RCM31_10010383	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1580	Open in IMG/M
3300001968\|GOS2236_1085288	All Organisms → Viruses → Predicted Viral	1635	Open in IMG/M
3300002161\|JGI24766J26685_10014723	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2042	Open in IMG/M
3300002200\|metazooDRAFT_1274714	Not Available	757	Open in IMG/M
3300002303\|B570J29644_1005216	Not Available	873	Open in IMG/M
3300003277\|JGI25908J49247_10028365	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	1602	Open in IMG/M
3300003430\|JGI25921J50272_10013781	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2313	Open in IMG/M
3300003430\|JGI25921J50272_10036771	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1177	Open in IMG/M
3300004096\|Ga0066177_10128422	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	995	Open in IMG/M
3300004112\|Ga0065166_10023043	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1858	Open in IMG/M
3300004112\|Ga0065166_10088203	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1108	Open in IMG/M
3300004112\|Ga0065166_10195141	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	795	Open in IMG/M
3300004772\|Ga0007791_10112159	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	817	Open in IMG/M
3300005527\|Ga0068876_10027645	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3545	Open in IMG/M
3300005527\|Ga0068876_10074952	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2035	Open in IMG/M
3300005527\|Ga0068876_10744737	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	521	Open in IMG/M
3300005528\|Ga0068872_10024971	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3956	Open in IMG/M
3300005528\|Ga0068872_10028023	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3700	Open in IMG/M
3300005528\|Ga0068872_10070583	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2138	Open in IMG/M
3300005580\|Ga0049083_10191235	Not Available	696	Open in IMG/M
3300005581\|Ga0049081_10013090	Not Available	3133	Open in IMG/M
3300005584\|Ga0049082_10083388	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1122	Open in IMG/M
3300005585\|Ga0049084_10001070	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	11097	Open in IMG/M
3300005662\|Ga0078894_10003332	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	12215	Open in IMG/M
3300005662\|Ga0078894_10433111	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1186	Open in IMG/M
3300005662\|Ga0078894_10735961	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	868	Open in IMG/M
3300005662\|Ga0078894_11301439	Not Available	611	Open in IMG/M
3300005805\|Ga0079957_1001701	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	20008	Open in IMG/M
3300005805\|Ga0079957_1006700	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	9164	Open in IMG/M
3300005805\|Ga0079957_1009878	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7271	Open in IMG/M
3300005805\|Ga0079957_1018977	All Organisms → Viruses → Predicted Viral	4866	Open in IMG/M
3300005805\|Ga0079957_1200285	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	964	Open in IMG/M
3300005805\|Ga0079957_1318438	Not Available	693	Open in IMG/M
3300006484\|Ga0070744_10000035	Not Available	34100	Open in IMG/M
3300006802\|Ga0070749_10552324	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	624	Open in IMG/M
3300006802\|Ga0070749_10585009	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	603	Open in IMG/M
3300006917\|Ga0075472_10026958	All Organisms → Viruses → Predicted Viral	2644	Open in IMG/M
3300007169\|Ga0102976_1005932	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1419	Open in IMG/M
3300007169\|Ga0102976_1160391	Not Available	2122	Open in IMG/M
3300007177\|Ga0102978_1108223	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	4824	Open in IMG/M
3300007200\|Ga0103273_1184213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2131	Open in IMG/M
3300007212\|Ga0103958_1167910	Not Available	1125	Open in IMG/M
3300007214\|Ga0103959_1221403	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1386	Open in IMG/M
3300007585\|Ga0102916_1133787	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	668	Open in IMG/M
3300007708\|Ga0102859_1000135	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	16176	Open in IMG/M
3300008107\|Ga0114340_1000539	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	25976	Open in IMG/M
3300008107\|Ga0114340_1070344	Not Available	3700	Open in IMG/M
3300008113\|Ga0114346_1051048	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3853	Open in IMG/M
3300008113\|Ga0114346_1108775	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1254	Open in IMG/M
3300008114\|Ga0114347_1075152	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2046	Open in IMG/M
3300008114\|Ga0114347_1212618	Not Available	631	Open in IMG/M
3300008116\|Ga0114350_1000468	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	25814	Open in IMG/M
3300008116\|Ga0114350_1002178	Not Available	12922	Open in IMG/M
3300008116\|Ga0114350_1006160	Not Available	14269	Open in IMG/M
3300008120\|Ga0114355_1004749	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	8156	Open in IMG/M
3300008120\|Ga0114355_1013025	Not Available	4601	Open in IMG/M
3300008120\|Ga0114355_1014578	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4300	Open in IMG/M
3300008120\|Ga0114355_1151458	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	822	Open in IMG/M
3300008120\|Ga0114355_1261231	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	501	Open in IMG/M
3300008261\|Ga0114336_1019009	Not Available	6437	Open in IMG/M
3300008448\|Ga0114876_1162466	Not Available	800	Open in IMG/M
3300008510\|Ga0110928_1036474	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1534	Open in IMG/M
3300008962\|Ga0104242_1030791	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	919	Open in IMG/M
3300008962\|Ga0104242_1046493	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	733	Open in IMG/M
3300009159\|Ga0114978_10000886	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	25141	Open in IMG/M
3300009161\|Ga0114966_10000104	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	77440	Open in IMG/M
3300009170\|Ga0105096_10574503	Not Available	591	Open in IMG/M
3300009184\|Ga0114976_10409165	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	709	Open in IMG/M
3300009385\|Ga0103852_1018302	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	666	Open in IMG/M
3300010354\|Ga0129333_10001184	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	23324	Open in IMG/M
3300010354\|Ga0129333_10023665	All Organisms → Viruses	5826	Open in IMG/M
3300010354\|Ga0129333_10025000	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5658	Open in IMG/M
3300010354\|Ga0129333_10345964	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1323	Open in IMG/M
3300010354\|Ga0129333_10409606	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1199	Open in IMG/M
3300010354\|Ga0129333_10695502	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	874	Open in IMG/M
3300010354\|Ga0129333_11395214	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	576	Open in IMG/M
3300010354\|Ga0129333_11471835	Not Available	559	Open in IMG/M
3300010370\|Ga0129336_10000250	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	30008	Open in IMG/M
3300010370\|Ga0129336_10584691	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	597	Open in IMG/M
3300010388\|Ga0136551_1005566	All Organisms → Viruses → Predicted Viral	2822	Open in IMG/M
3300011010\|Ga0139557_1000481	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	9576	Open in IMG/M
3300011116\|Ga0151516_10420	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	20829	Open in IMG/M
3300012000\|Ga0119951_1097975	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	706	Open in IMG/M
3300012012\|Ga0153799_1037141	Not Available	921	Open in IMG/M
3300012352\|Ga0157138_1006063	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2017	Open in IMG/M
3300012663\|Ga0157203_1000128	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	27491	Open in IMG/M
3300012665\|Ga0157210_1000208	Not Available	28971	Open in IMG/M
3300012665\|Ga0157210_1008357	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1909	Open in IMG/M
3300012667\|Ga0157208_10010320	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1320	Open in IMG/M
3300012667\|Ga0157208_10021396	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	868	Open in IMG/M
3300012968\|Ga0129337_1239352	Not Available	1582	Open in IMG/M
3300012968\|Ga0129337_1341318	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1968	Open in IMG/M
3300013004\|Ga0164293_10168923	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1608	Open in IMG/M
3300013004\|Ga0164293_10617189	Not Available	703	Open in IMG/M
3300013087\|Ga0163212_1097900	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	944	Open in IMG/M
(restricted) 3300013122\|Ga0172374_1032183	All Organisms → Viruses → Predicted Viral	2277	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10018438	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6744	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10081667	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2354	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10193047	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228	1291	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10406859	Not Available	769	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10038892	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4355	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10087152	Not Available	2423	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10110696	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2046	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10129390	Not Available	1835	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10658106	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	621	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10744378	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	575	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10837396	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	536	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10100891	All Organisms → Viruses	2443	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10783830	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	593	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10933852	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	528	Open in IMG/M
(restricted) 3300013138\|Ga0172371_10383120	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1064	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10092408	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2186	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10211185	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228	1224	Open in IMG/M
3300014819\|Ga0119954_1000004	Not Available	91275	Open in IMG/M
3300017766\|Ga0181343_1048248	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1257	Open in IMG/M
3300017784\|Ga0181348_1115163	Not Available	1037	Open in IMG/M
3300017788\|Ga0169931_10014967	Not Available	10433	Open in IMG/M
3300017788\|Ga0169931_10064462	All Organisms → Viruses	3776	Open in IMG/M
3300017788\|Ga0169931_10078860	Not Available	3286	Open in IMG/M
3300017788\|Ga0169931_10331467	All Organisms → Viruses → Predicted Viral	1171	Open in IMG/M
3300017788\|Ga0169931_10449078	Not Available	931	Open in IMG/M
3300017788\|Ga0169931_10724506	Not Available	651	Open in IMG/M
3300020048\|Ga0207193_1105440	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2545	Open in IMG/M
3300020074\|Ga0194113_10035249	Not Available	5123	Open in IMG/M
3300020074\|Ga0194113_10755868	Not Available	669	Open in IMG/M
3300020083\|Ga0194111_10439525	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	853	Open in IMG/M
3300020141\|Ga0211732_1593496	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2648	Open in IMG/M
3300020183\|Ga0194115_10033089	Not Available	3595	Open in IMG/M
3300020183\|Ga0194115_10235085	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	877	Open in IMG/M
3300020183\|Ga0194115_10459813	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	530	Open in IMG/M
3300020190\|Ga0194118_10480296	Not Available	603	Open in IMG/M
3300020190\|Ga0194118_10516082	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	569	Open in IMG/M
3300020196\|Ga0194124_10036590	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3217	Open in IMG/M
3300020205\|Ga0211731_11678992	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	4440	Open in IMG/M
3300020214\|Ga0194132_10004796	All Organisms → Viruses	22680	Open in IMG/M
3300020214\|Ga0194132_10508410	Not Available	593	Open in IMG/M
3300020222\|Ga0194125_10840140	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	521	Open in IMG/M
3300020493\|Ga0208591_1026818	Not Available	695	Open in IMG/M
3300020506\|Ga0208091_1000046	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	33345	Open in IMG/M
3300020543\|Ga0208089_1006928	All Organisms → Viruses → Predicted Viral	1980	Open in IMG/M
3300020560\|Ga0208852_1032970	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	924	Open in IMG/M
3300021519\|Ga0194048_10161915	Not Available	838	Open in IMG/M
3300022752\|Ga0214917_10000099	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	95645	Open in IMG/M
3300022752\|Ga0214917_10000352	Not Available	59817	Open in IMG/M
3300023174\|Ga0214921_10000872	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	53638	Open in IMG/M
3300023174\|Ga0214921_10016374	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8347	Open in IMG/M
3300023179\|Ga0214923_10001125	All Organisms → Viruses	38849	Open in IMG/M
3300023179\|Ga0214923_10038141	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3869	Open in IMG/M
3300023184\|Ga0214919_10001523	Not Available	37703	Open in IMG/M
3300023184\|Ga0214919_10002577	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	28372	Open in IMG/M
3300024289\|Ga0255147_1000022	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	104732	Open in IMG/M
3300024289\|Ga0255147_1061393	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	718	Open in IMG/M
3300024306\|Ga0255148_1050053	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	742	Open in IMG/M
3300024346\|Ga0244775_10161219	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1891	Open in IMG/M
3300024346\|Ga0244775_10204100	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1658	Open in IMG/M
3300024346\|Ga0244775_10370212	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1181	Open in IMG/M
3300024348\|Ga0244776_10001210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27856	Open in IMG/M
3300024348\|Ga0244776_10002850	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	17177	Open in IMG/M
3300024350\|Ga0255167_1004596	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3053	Open in IMG/M
3300024351\|Ga0255141_1002059	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3529	Open in IMG/M
3300024481\|Ga0256330_1107210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	589	Open in IMG/M
3300024500\|Ga0255143_1013371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	1390	Open in IMG/M
3300024503\|Ga0255152_1023963	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1162	Open in IMG/M
3300024857\|Ga0256339_1064488	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	769	Open in IMG/M
3300025585\|Ga0208546_1003243	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	4743	Open in IMG/M
3300026457\|Ga0255160_1049401	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	713	Open in IMG/M
3300026473\|Ga0255166_1022133	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1359	Open in IMG/M
3300026570\|Ga0255274_1027202	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1515	Open in IMG/M
3300027467\|Ga0255154_1058112	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	863	Open in IMG/M
3300027608\|Ga0208974_1011329	Not Available	2893	Open in IMG/M
3300027608\|Ga0208974_1014434	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	2512	Open in IMG/M
3300027621\|Ga0208951_1089109	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	852	Open in IMG/M
3300027644\|Ga0209356_1009911	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	3380	Open in IMG/M
3300027707\|Ga0209443_1012239	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4069	Open in IMG/M
3300027744\|Ga0209355_1001589	Not Available	12850	Open in IMG/M
3300027759\|Ga0209296_1000974	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	23358	Open in IMG/M
3300027760\|Ga0209598_10018383	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	4186	Open in IMG/M
3300027770\|Ga0209086_10000043	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	110973	Open in IMG/M
3300027770\|Ga0209086_10027965	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay	3415	Open in IMG/M
3300027793\|Ga0209972_10213812	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	886	Open in IMG/M
3300027808\|Ga0209354_10012258	All Organisms → Viruses → Predicted Viral	3428	Open in IMG/M
3300027892\|Ga0209550_10005416	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	11966	Open in IMG/M
3300027892\|Ga0209550_10115812	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1974	Open in IMG/M
3300028025\|Ga0247723_1003439	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7911	Open in IMG/M
3300028025\|Ga0247723_1014298	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2897	Open in IMG/M
3300028091\|Ga0255184_1095137	Not Available	554	Open in IMG/M
3300029930\|Ga0119944_1000039	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	20437	Open in IMG/M
3300031758\|Ga0315907_10000127	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	109458	Open in IMG/M
3300031758\|Ga0315907_10022767	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5781	Open in IMG/M
3300031758\|Ga0315907_10122606	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2218	Open in IMG/M
3300031758\|Ga0315907_10258841	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1441	Open in IMG/M
3300031758\|Ga0315907_11302158	Not Available	502	Open in IMG/M
3300031787\|Ga0315900_10057093	Not Available	4065	Open in IMG/M
3300031857\|Ga0315909_10022092	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6375	Open in IMG/M
3300031857\|Ga0315909_10143290	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1982	Open in IMG/M
3300031857\|Ga0315909_10364618	Not Available	1050	Open in IMG/M
3300031951\|Ga0315904_10001821	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	33667	Open in IMG/M
3300031951\|Ga0315904_10005853	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16953	Open in IMG/M
3300031951\|Ga0315904_10031414	Not Available	6186	Open in IMG/M
3300031951\|Ga0315904_10096971	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3110	Open in IMG/M
3300031951\|Ga0315904_10125290	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2650	Open in IMG/M
3300031951\|Ga0315904_11087899	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	625	Open in IMG/M
3300031951\|Ga0315904_11417915	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	517	Open in IMG/M
3300031963\|Ga0315901_10166889	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1943	Open in IMG/M
3300031963\|Ga0315901_10375607	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1148	Open in IMG/M
3300031963\|Ga0315901_10741657	Not Available	721	Open in IMG/M
3300032050\|Ga0315906_10366812	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1268	Open in IMG/M
3300032092\|Ga0315905_10011449	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9002	Open in IMG/M
3300032116\|Ga0315903_10006796	All Organisms → Viruses	14493	Open in IMG/M
3300032116\|Ga0315903_10150425	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2139	Open in IMG/M
3300032116\|Ga0315903_10419475	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1083	Open in IMG/M
3300032116\|Ga0315903_11160342	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	525	Open in IMG/M
3300033993\|Ga0334994_0029550	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3560	Open in IMG/M
3300033996\|Ga0334979_0024021	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4106	Open in IMG/M
3300034019\|Ga0334998_0383883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	811	Open in IMG/M
3300034071\|Ga0335028_0024850	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4156	Open in IMG/M
3300034071\|Ga0335028_0128065	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1636	Open in IMG/M
3300034104\|Ga0335031_0842956	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	508	Open in IMG/M
3300034105\|Ga0335035_0444213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	724	Open in IMG/M
3300034106\|Ga0335036_0001397	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	21375	Open in IMG/M
3300034112\|Ga0335066_0012843	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5965	Open in IMG/M
3300034121\|Ga0335058_0076393	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1954	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.25%
Terrestrial	Environmental → Terrestrial	0.75%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	88.30%
Marine	Environmental → Aquatic → Marine	10.94%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.75%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	47.17%
Lentic	Environmental → Aquatic → Freshwater → Lentic	19.25%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	11.32%
Coastal	Environmental → Aquatic → Marine → Coastal	6.79%
River	Environmental → Aquatic → Freshwater → River	5.66%
Lotic	Environmental → Aquatic → Freshwater → Lotic	3.40%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.26%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.89%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.75%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.38%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.38%
Ice	Environmental → Aquatic → Freshwater → Ice	0.38%
Pond	Environmental → Aquatic → Freshwater → Pond	0.38%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	46.79%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	15.47%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	11.32%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	6.79%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	5.66%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	3.77%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	3.40%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.26%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.51%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.75%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.38%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.38%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.38%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.38%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	0.38%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.38%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	21.13%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	11.32%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	10.57%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	8.68%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	6.79%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	5.66%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	4.15%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	3.77%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	3.40%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.40%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.40%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	2.64%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	2.64%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	2.64%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	1.89%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.51%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.75%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.75%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.38%
Lake	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake	0.38%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.38%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.38%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.38%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.38%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	0.38%
Water Bodies	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies	0.38%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	0.38%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.38%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	0.38%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.38%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.38%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001838	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a	Environmental	Open in IMG/M
3300001851	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b	Environmental	Open in IMG/M
3300001968	Marine microbial communities from Lake Gatun, Panama - GS020	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300002200	Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013	Environmental	Open in IMG/M
3300002303	Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003430	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD	Environmental	Open in IMG/M
3300004096	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)	Environmental	Open in IMG/M
3300004112	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)	Environmental	Open in IMG/M
3300004772	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental	Open in IMG/M
3300007169	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects	Environmental	Open in IMG/M
3300007177	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects	Environmental	Open in IMG/M
3300007200	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projects	Environmental	Open in IMG/M
3300007212	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects	Environmental	Open in IMG/M
3300007214	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects	Environmental	Open in IMG/M
3300007585	Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008510	Microbial Communities in Water bodies, Singapore - Site RA	Environmental	Open in IMG/M
3300008962	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009385	Microbial communities of water from Amazon river, Brazil - RCM5	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300010388	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300011011	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m	Environmental	Open in IMG/M
3300011116	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov	Environmental	Open in IMG/M
3300012000	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300012352	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300012667	Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15	Environmental	Open in IMG/M
3300012968	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013087	Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L	Environmental	Open in IMG/M
3300013122 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300013137 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m	Environmental	Open in IMG/M
3300013138 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300014819	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020083	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m	Environmental	Open in IMG/M
3300020109	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020183	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface	Environmental	Open in IMG/M
3300020190	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface	Environmental	Open in IMG/M
3300020196	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020214	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m	Environmental	Open in IMG/M
3300020222	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m	Environmental	Open in IMG/M
3300020493	Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020543	Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020546	Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020560	Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020570	Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021376	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024280	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d	Environmental	Open in IMG/M
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental	Open in IMG/M
3300024306	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300024350	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d	Environmental	Open in IMG/M
3300024351	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h	Environmental	Open in IMG/M
3300024481	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024500	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h	Environmental	Open in IMG/M
3300024503	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h	Environmental	Open in IMG/M
3300024857	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025585	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300026457	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h	Environmental	Open in IMG/M
3300026473	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d	Environmental	Open in IMG/M
3300026570	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027467	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027621	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)	Environmental	Open in IMG/M
3300027644	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027649	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)	Environmental	Open in IMG/M
3300027707	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027744	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027760	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028091	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h	Environmental	Open in IMG/M
3300028569 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m	Environmental	Open in IMG/M
3300029930	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034103	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034105	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034121	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J14230_100072762	3300001282	Freshwater	MEGGVVSSRFVVCDICNKEIELRWAIFGSDTLSRHRKAEHK*
B570J14230_100841811	3300001282	Freshwater	LLYTEYMTGKVVICPVCKKETEVRWGIFAHDTLNRHMKEHK*
RCM33_10363514	3300001838	Marine Plankton	MYNGYMANKAVVCNVCNKEIEVRWGIFAHETLNRHMKEHK*
RCM31_100103834	3300001851	Marine Plankton	MTSGRIVICSICNKEIEVRWGIFAHDTLSRHRKAEHKNV*
GOS2236_10852884	3300001968	Marine	MEKGRVVVCDICGKELEVRWGIFAHQTLSRHLKEHKNAEAA*
JGI24766J26685_100147234	3300002161	Freshwater And Sediment	MEGGIVENGRVVVCDICKKDIVVRWGIFANDTLSRHKKAEHK*
metazooDRAFT_12747143	3300002200	Lake	MEKGRVAICDLCNKEIEVRWGIFASDTLSRHKKVEHKNAA*
B570J29644_10052161	3300002303	Freshwater	VEGGLVEKSRAVTCDICNKDIEVRWGIFANETLNRHKKAEHK*
JGI25908J49247_100283652	3300003277	Freshwater Lake	MTNKRVAICEVCNKEIEVRWGIFANDTLKRHMKEHVNGA*
JGI25921J50272_100137814	3300003430	Freshwater Lake	MEGRVMEKGRVVTCDICNRDIEVRWGIFASDTLSRHKKAEHK*
JGI25921J50272_100367714	3300003430	Freshwater Lake	VEGGLVEKGRVVTCTICKKDIEVRWGIFANDTLTRHMKAEHK*
Ga0066177_101284221	3300004096	Freshwater Lake	MEGGLMEKSRVVVCDICKKDIVVRWGIFASDTLNRHKKAEHK*
Ga0065166_100230431	3300004112	Freshwater Lake	SVEGGLVEKGRVVTCTICKKDIEVRWGIFANDTLTRHMKAEHK*
Ga0065166_100882034	3300004112	Freshwater Lake	SVEGGLVEKGRVVTCTICKRDIEVRWGIFANDTLTRHKKAEHK*
Ga0065166_101951412	3300004112	Freshwater Lake	MEGGLMEKGRVVTCDICKKDIEVRWGIFAHDTLTRHKKAEHK*
Ga0007791_101121592	3300004772	Freshwater	MEGGVVEKGRVVICDICKKQIEVRWGYFANETLNRHKKADHK*
Ga0068876_100276452	3300005527	Freshwater Lake	MTGKVVICPVCKKETEVRWGIFAHDTLNRHLKEHK*
Ga0068876_100749524	3300005527	Freshwater Lake	MNNLKRYVICPNCSKEIELRWGIFGHNTLARHLKQH*
Ga0068876_107447372	3300005527	Freshwater Lake	MYNDYMDKGRVVVCDVCNKEIEVRWGIFAHDTLSRHLREHSNG*
Ga0068872_100249719	3300005528	Freshwater Lake	MSNKIVVCDICKKEIEVRWGIFAHDTLGRHMREHK*
Ga0068872_100280232	3300005528	Freshwater Lake	VEKGKSVICEICDKQIEVRWGIFAHETLTRHKKAEHK*
Ga0068872_100446613	3300005528	Freshwater Lake	MEGGVVSGRFVVCDTCGKEIELRWGIFGHDTLNRHRKAEH*
Ga0068872_100705834	3300005528	Freshwater Lake	MEGGGMTGKVVICPICKKETEVRWGIFAHDTLNRHLKEHK*
Ga0049083_101912352	3300005580	Freshwater Lentic	VEKSRVVTCDICNKDVEVRWGIFANETLNRHKKAEHK*
Ga0049081_1001309010	3300005581	Freshwater Lentic	MTNKRVAVCEVCNKEIEVRWGIFANDTLKRHIKEHVNGA*
Ga0049082_100833882	3300005584	Freshwater Lentic	MEGGLMEKGRVVTCDICNKDIEVRWGIFANDTLIRHKKAEHR*
Ga0049082_103352263	3300005584	Freshwater Lentic	GGVMANRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK*
Ga0049084_1000107015	3300005585	Freshwater Lentic	MSNRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK*
Ga0078894_100033328	3300005662	Freshwater Lake	MEKSRVVVCDICKKDIVVRWGIFASDTLNRHKKAEHK*
Ga0078894_100134165	3300005662	Freshwater Lake	MSGRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH*
Ga0078894_104331113	3300005662	Freshwater Lake	MEGGLVEKGRVVICDICKKDIVVRWGIFANDTLTRHKKAEHK*
Ga0078894_107359612	3300005662	Freshwater Lake	MEKGRVVICDICKKGIEVRWGIFANDTLLRHKKAAHK*
Ga0078894_113014392	3300005662	Freshwater Lake	MEGGVMEKSRVVTCDICKRDIEVRWGIFANDTLSRHKKAEHK*
Ga0079957_100170116	3300005805	Lake	MDKNKVVVCDICSKEIEVRWGIFAHDTLSRHRKAEH*
Ga0079957_100670011	3300005805	Lake	MSGRFVVCETCGKEIELRWGIFGHDTLSRHRKAEH*
Ga0079957_10098782	3300005805	Lake	MDKVVICDKCGKEIQVRWGIFAHETLSRHFKEHK*
Ga0079957_10189774	3300005805	Lake	MEKGRVVICTTCGRELEVRWGIFAHQTLSRHMKEHNNGKKSAEEAA*
Ga0079957_10309853	3300005805	Lake	MEGGRLMANRFVLCDICNKEIELRWGIFGHDALSRHKKEHK*
Ga0079957_12002852	3300005805	Lake	MEKGRITICDKCGKELEVRWGIFAHQTLSRHLKEHKNAKAA*
Ga0079957_13184382	3300005805	Lake	MEGGGMTSQNRVVICSECQKEIEVRWGIFASHTLSRHMKEHK*
Ga0070744_100000358	3300006484	Estuarine	MEGGVMEKSRVVTCDICKRDIEVRWGIFASDTLNRHKKAEHK*
Ga0070749_105523242	3300006802	Aqueous	MEKGRVVICDTCNKEIELRWGIFGHDALSRHKKEHKNA*
Ga0070749_105850091	3300006802	Aqueous	FGVRTSMEGGIVEKGKVVICNICNKETEVRFGIFAHDTLDRHIKKEHKDV*
Ga0075472_100269584	3300006917	Aqueous	MAGKVVICNICKKEIEVRSGIFAHDTLNRHMKEHK*
Ga0102976_10059323	3300007169	Freshwater Lake	MAGKVAICDICKKEIEVRWGIFAHDTLLRHRKAEHKNV*
Ga0102976_10250334	3300007169	Freshwater Lake	MEGGLVSSRVVVCEICKKEIEVRWGIFAHDTLGRHRKAEHT*
Ga0102976_11603913	3300007169	Freshwater Lake	MNRLVVCPNCKKEIEVRWGIFAHDTLNRHMKEHK*
Ga0102978_11082237	3300007177	Freshwater Lake	VYNRYMSNKIVVCDVCKKEIEVRWGIFAHDTLSRHMKGHK*
Ga0103273_11842135	3300007200	Freshwater Lake	MAGKVAICDICKKEIEVRWGIFAHDTLLRHRKAEH
Ga0103958_11679103	3300007212	Freshwater Lake	MEKGRFVVCDTCNKEIEVRWGIFAHDTLNRHIKEHKNAA*
Ga0103959_12214031	3300007214	Freshwater Lake	MDKGRVVICDTCNKEIEVRWGIFAHQTLSRHLKEHSNAS*
Ga0102916_11337871	3300007585	Estuarine	SMEGGVMEKSRVVTCDICKRDIEVRWGIFASDTLNRHKKAEHK*
Ga0102859_100013512	3300007708	Estuarine	MEKGRVVTCDICNKDIEVRWGIFANDTLTRHKKAEHK*
Ga0114340_100053919	3300008107	Freshwater, Plankton	MSNRIVKCDMCNKEIELRWGIFGHDTLNRHIKAEHK*
Ga0114340_10006668	3300008107	Freshwater, Plankton	MTNRVVICEICNKEIELRWGIFGSDTLSRHKKAEHK*
Ga0114340_10703445	3300008107	Freshwater, Plankton	MGLIKVASNRVVICDVCQKEIELRWGIFGHDTLNRHMKEHNG*
Ga0114343_11840851	3300008110	Freshwater, Plankton	MESRVAPARVVVCEICKKELVVRWGIFAHDTLSRHRK
Ga0114346_10510485	3300008113	Freshwater, Plankton	MEGGVVEKGRTVNCELCGRDIEVRWGIFANETLSRHKKAEHK*
Ga0114346_11087752	3300008113	Freshwater, Plankton	MDKGRVAVCDTCNKEIEVRWGIFAHDTINRHKKAEHK*
Ga0114347_10751526	3300008114	Freshwater, Plankton	MSNKIVVCDICKKEIEVRWGIFAHDTLSRHMREHK*
Ga0114347_12126182	3300008114	Freshwater, Plankton	MNGKIVICPVCKKETEVRWGIFAHDTLNRHMKEHK*
Ga0114350_100046822	3300008116	Freshwater, Plankton	MTGKVVVCPVCKKETEVRWGIFAHDTLSRHMKEHGDVRD*
Ga0114350_10021788	3300008116	Freshwater, Plankton	MEPKRVVVCPVCYKETELRWGIFAHDTLSRHMKAEHKK*
Ga0114350_100616035	3300008116	Freshwater, Plankton	MEKGKVVICNICSKEIEVRWGIFGHDTLNRHKREHRDE*
Ga0114350_10311951	3300008116	Freshwater, Plankton	MSGRFVVCEICGKEIELRWGIFGHDTLSRHRKAEH*
Ga0114355_10047496	3300008120	Freshwater, Plankton	MESRVTEKGRVVICDICNKSIEVRWGIFASDTLFRHKKAEHK*
Ga0114355_10130258	3300008120	Freshwater, Plankton	MSNKVVICYICSKEIEVRWGIFAHDTLSRHKKEHNGKM*
Ga0114355_10145784	3300008120	Freshwater, Plankton	MADPKRVVVCHKCNKEIELRWGIFAHDTLSRHMKAEHK*
Ga0114355_11514582	3300008120	Freshwater, Plankton	GRVYNRNMEKGRVAICDKCGKELEVRWGIFAHQTLSRHLKEHKNAKAA*
Ga0114355_12612311	3300008120	Freshwater, Plankton	MEKGRVVICDICNKEIEVRNNVFAHETLSRHLKEHKNG*
Ga0114336_10190093	3300008261	Freshwater, Plankton	MEKGRVVTCDICKRDIEVRWGIFANDTLNRHKKAEHK*
Ga0114876_11624661	3300008448	Freshwater Lake	YMGRVVICDVCKKEIELRWGIFAHDTLNRHRKEHK*
Ga0110928_10364743	3300008510	Water Bodies	MEKGRVAICDKCGKELEVRWGIFAHQTLSRHMKEHKDGQEAA*
Ga0104242_10307912	3300008962	Freshwater	MEGGIVEKGRVVICDICKKGIEVRWGIFANDTLSRHKKAEHK*
Ga0104242_10464931	3300008962	Freshwater	GMMSNRIVKCSICNKEIEVRWGIFANETLSRHMKEHK*
Ga0114968_101427981	3300009155	Freshwater Lake	RRELRASMESRVVPARVVVCEICKKELVVRWGIFAHDTLSRHRKAEH*
Ga0114978_1000088612	3300009159	Freshwater Lake	VEKRRVVTCDICNKDIEVRWGMFANETLNRHKKAEHK*
Ga0114966_1000010464	3300009161	Freshwater Lake	VEKSKVVTCDICNKDVEVRWGIFANETLNRHKKAEHK*
Ga0105096_105745033	3300009170	Freshwater Sediment	MELIKVSRIVICPVCKKELEVRKGIFAHDTLYRHSQEHK
Ga0114976_104091653	3300009184	Freshwater Lake	LEGGLVSNRFVVCEFCSKEIEVRWGIFASDTIQRHMRAEHK*
Ga0103852_10183023	3300009385	River Water	KAKVVICDICKKQIEVRWGIFAHDTLSRHKKAEHK*
Ga0129333_100011844	3300010354	Freshwater To Marine Saline Gradient	MSARLVICDKCNKEIELRWGIFAHDTLSRHLKAEHK*
Ga0129333_100236657	3300010354	Freshwater To Marine Saline Gradient	MEKGRVAICDKCGKELEVRWGIFAHQTLSRHLKEHKNAKAA*
Ga0129333_100250007	3300010354	Freshwater To Marine Saline Gradient	MANKVVVCDICKKEIEVRGGIFAHDTLNRHMKEHK*
Ga0129333_100560667	3300010354	Freshwater To Marine Saline Gradient	MVIMTNNRVVVCDICNKEIELRWGIFGHDTLSRHNKEHK*
Ga0129333_103459644	3300010354	Freshwater To Marine Saline Gradient	CASMEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK*
Ga0129333_104096061	3300010354	Freshwater To Marine Saline Gradient	MEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLK
Ga0129333_106955024	3300010354	Freshwater To Marine Saline Gradient	MEGGRMTGKVVTCPICKKETEVRWGIFAHDTLNRHLKEHK*
Ga0129333_113952142	3300010354	Freshwater To Marine Saline Gradient	MEKGRVVICEKCSKELEVRWGIFAHQTLSRHMKEHKNGEKSAEEAA*
Ga0129333_114718354	3300010354	Freshwater To Marine Saline Gradient	MSNRVVICDICSKEIEVRWGIFAHDSLNRHRKEHK*
Ga0129336_100002508	3300010370	Freshwater To Marine Saline Gradient	MEGGLVSSRVVVCEICKKEIEVRWGIFAHDTLSRHRKAEHK*
Ga0129336_105846913	3300010370	Freshwater To Marine Saline Gradient	VEKGKVVICDICKKEIEVRWGIFAHDTLNRHRKAEHK*
Ga0136551_10055663	3300010388	Pond Fresh Water	MSRIVVCPICKKELDVRKGIFAHDTLSRHSKEHK*
Ga0133913_100342117	3300010885	Freshwater Lake	MEGRIVSGRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH*
Ga0133913_106092946	3300010885	Freshwater Lake	MSSRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH*
Ga0139557_10004817	3300011010	Freshwater	VEKSRVVTCDICNKDIEVRWGIFANETLNRHKKAEHK*
Ga0139556_100010013	3300011011	Freshwater	MANRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK*
Ga0151516_1042017	3300011116	Freshwater	MAVGNRVTVCEICNKEIEVRWGIFASSTLSRHMKEHK*
Ga0119951_10979751	3300012000	Freshwater	MEGGLVEKGRTVKCELCGKEIEVRWGIFANDTLSRHRKAEHK*
Ga0153799_10371413	3300012012	Freshwater	MTNKRVAVCEVCNKEIEVRWGIFANDTLKRHMKEHVNGA*
Ga0157138_10060634	3300012352	Freshwater	MEKGRVVVCDICKKEVVVRWGIFANDTLTRHKKAEHK*
Ga0157203_100012812	3300012663	Freshwater	MEGRVMEKSRSVTCDICKRDIEVRWGIFASDTLSRHKKAEHK*
Ga0157210_100005423	3300012665	Freshwater	MSSRVVVCDICKKEIELRWGIFAHDTLSRHRKAEH*
Ga0157210_100020825	3300012665	Freshwater	MSREVICPKCKRGIEVRWGIFAMDTLNRHIKREH*
Ga0157210_10083573	3300012665	Freshwater	MEGGLVEKSRVVVCDICKKDIVVRWGIFASDTLNRHKKAEHK*
Ga0157208_100103202	3300012667	Freshwater	MEKGRVVICDICKKDIVVRWGIFANDTLTRHKKAEHK*
Ga0157208_100213962	3300012667	Freshwater	MEGGVMEKGRTVICDICKKEVEVRWGIFANETLSRHKRAEHK*
Ga0129337_10702494	3300012968	Aqueous	VSGRFVVCDTCGKEIELRWGIFGHDTLNRHRKAEH*
Ga0129337_12393521	3300012968	Aqueous	MNNKVVVCPICKKETEVRWGIFAHDTLNRHLKEHK*
Ga0129337_13413184	3300012968	Aqueous	VCASMEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK*
Ga0164293_101689233	3300013004	Freshwater	VEKSRAVTCDICNKDIEVRWGIFANETLNRHKKAEHK*
Ga0164293_106171891	3300013004	Freshwater	VEGGLVEKSRVVTCDICNKDVEVRWGIFANETLNRHKKAEHK*
Ga0163212_10979002	3300013087	Freshwater	NIRMQKGRVVICNMCGKELEVRWSIFAHETLSRHIREHKNVKAA*
(restricted) Ga0172374_10321833	3300013122	Freshwater	MEKGRVAVCDKCGKELEVRWGIFAHDTLNRHLKEHKNDKAA*
(restricted) Ga0172367_100184389	3300013126	Freshwater	MEGGIMTGRVAICPICNKEIEVRNNVFAHETLSRHMKEHK*
(restricted) Ga0172367_100816674	3300013126	Freshwater	MTDLKRLAICPECSKAIEVRWGIFASHTLSRHMKEHK*
(restricted) Ga0172367_101414683	3300013126	Freshwater	MEGGLMSSRIVICEICKKEIELRWGIFGHDTLSRHRKAEH
(restricted) Ga0172367_101930471	3300013126	Freshwater	VYNRIMEKGRVVVCDMCGKELEVRWSIFAHQTLSRHIREHKNGQKAA*
(restricted) Ga0172367_103674404	3300013126	Freshwater	MEGGLMSSRIVICEICKKEIELRWGIFGHDTLSRHRKAEH*
(restricted) Ga0172367_104068593	3300013126	Freshwater	MEKGRVVVCDMCGKELEVRWSIFAHQTLSRHIREH
(restricted) Ga0172373_100388926	3300013131	Freshwater	MDKRVVVCPVCNKETEVRWGIFAHDTLNRHMKEHK*
(restricted) Ga0172373_100871523	3300013131	Freshwater	MEKGRVVVCDMCGKELEVRWGIFAHQTLLRHIKEHKNGQKAA*
(restricted) Ga0172373_101106964	3300013131	Freshwater	MTSKVVICPVCNKETEVRWGIFAHDTLNRHMKEHGNVRD*
(restricted) Ga0172373_101293903	3300013131	Freshwater	MEKGRVVVCNMCGKELEVRWGIFAHQTLLRHIKEHKNDEKAA*
(restricted) Ga0172373_106581062	3300013131	Freshwater	NRSMEKGRVAVCDKCGKELEVRWGIFAHDTLNRHLKEHKNDKAA*
(restricted) Ga0172373_107443781	3300013131	Freshwater	NRSMEKGRVVVCDMCGKELEVRWGIFAHETLSRHLKEHKNAKAA*
(restricted) Ga0172373_108373961	3300013131	Freshwater	SMEKGRVVVCDMCGKELEVRWGIFAHETLSRHLKEHKNAKAA*
(restricted) Ga0172372_101008915	3300013132	Freshwater	MEKGRVVVCDMCGKELEVRWSIFAHQTLSRHIREHKNGQKAA*
(restricted) Ga0172372_107838302	3300013132	Freshwater	MEKGRVAVCDKCGKELEVRWGIFAHDTLNRHLKEHKNGKAA*
(restricted) Ga0172372_109338522	3300013132	Freshwater	GRVVVCDMCGKELEVRWGIFAHETLSRHLKEHKNAKAA*
(restricted) Ga0172375_101610474	3300013137	Freshwater	MASRFVLCDICNKEIELRWGIFGHDALSRHKKEHK*
(restricted) Ga0172371_103831202	3300013138	Freshwater	MEKGRVVVCDMCGKELEVRWGIFAHQTLLRHIKEHKNDEKAA*
(restricted) Ga0172376_100924083	3300014720	Freshwater	MEGGIMQKGKVAICDICNKEIEVRWGIFAHDTLSRHRKAEHK*
(restricted) Ga0172376_102111851	3300014720	Freshwater	KGRVVVCDMCGKELEVRWSIFAHQTLSRHIREHKNGQKAA*
Ga0119954_1000004125	3300014819	Freshwater	MEKGRVAVCDKCGKELEVRWGIFAHDTLSRHLKEHKNGQEAA*
Ga0181343_10482481	3300017766	Freshwater Lake	LLELIKITNKKVVVCEICKKEIEVRWGIFASDTLRRHTKEHK
Ga0181348_11151631	3300017784	Freshwater Lake	EGGLVEKSRVVTCDICNKDVEVRWGIFANETLNRHKKAEHK
Ga0169931_100149675	3300017788	Freshwater	MEGGIMTGRVAICPICNKEIEVRNNVFAHETLSRHMKEHK
Ga0169931_100644623	3300017788	Freshwater	MEKGRVVVCDMCGKELEVRWGIFAHQTLLRHIKEHKNGQKAA
Ga0169931_100788601	3300017788	Freshwater	VYNRIMEKGRVVVCDMCGKELEVRWSIFAHQTLSRHIREHKNGQKAA
Ga0169931_103314673	3300017788	Freshwater	MEKGRVAVCDKCGKELEVRWGIFAHDTLNRHLKEHKNDKAA
Ga0169931_104490783	3300017788	Freshwater	MTDLKRLAICPECSKAIEVRWGIFASHTLSRHMKEHK
Ga0169931_107245063	3300017788	Freshwater	MEKGRVVVCNMCGKELEVRWGIFAHQTLLRHIKEHKNDEKAA
Ga0207193_11054404	3300020048	Freshwater Lake Sediment	MSGRVVVCDLCKKEIELRWGIFAHDSLSRHRKAEH
Ga0194113_100352499	3300020074	Freshwater Lake	MEKGRVVICEMCGKELEVRWGIFAHDTLSRHIREHKNVKAA
Ga0194113_102003124	3300020074	Freshwater Lake	MASRFVLCDICNKEIELRWGIFGHDALSRHNKEHK
Ga0194113_107558684	3300020074	Freshwater Lake	VLVYNKSMNSKVVICPVCQKETEVRWGIFAHDTLNRHMREHK
Ga0194111_104395252	3300020083	Freshwater Lake	GRVVICEMCGKELEVRWGIFAHDTLSRHIREHKNVKAA
Ga0194112_101524104	3300020109	Freshwater Lake	MASRFVLCDICNKEIELRWGIFGHDALSRHKKEHK
Ga0211732_15934965	3300020141	Freshwater	MEGRVMEKGKVVTCDICKKDIEVRWGIFASDTLSRHKKAEHK
Ga0194115_100330895	3300020183	Freshwater Lake	MEKLRVVVCDLCGKELEVRWSIFAHSTLSRHMREHKNVKAA
Ga0194115_102350851	3300020183	Freshwater Lake	DKRYYVGYNRSMEKGRVVICEMCGKELEVRWGIFAHDTLSRHIREHKNVKAA
Ga0194115_104598132	3300020183	Freshwater Lake	DKRYYVGYNRSMEKGRVVICEMCGKELEVRWGIFAHDTLSRHVREHKNVKAA
Ga0194118_104802962	3300020190	Freshwater Lake	MEKGRVVICEMCGKELEVRWGIFAHDTLSRHVREHKNVKAA
Ga0194118_105160822	3300020190	Freshwater Lake	RYSVGYNRSMEKGRVVICEMCGKELEVRWSIFAHQTLSRHIREHKNVKAA
Ga0194124_100365902	3300020196	Freshwater Lake	MQKGKVVICDICNKEIEVRWGIFAHDTLSRHRKAEHK
Ga0211731_116789924	3300020205	Freshwater	MEKGKVVTCDICKKDIEVRWGIFASDTLSRHKKAEHK
Ga0194132_1000479611	3300020214	Freshwater Lake	MEKGRSVVCDKCGKEIQVRWGIFAYNTLSRHMREHKNVKAA
Ga0194132_105084102	3300020214	Freshwater Lake	MEKGRVVICEMCGKELEVRWGIFAYNTLSRHMREHKNVKAA
Ga0194125_108401401	3300020222	Freshwater Lake	SCMEGGVMQKGKVVICDICNKEIEVRWGIFAHDTLSRHRKSEHK
Ga0208591_10268182	3300020493	Freshwater	VEKSRAVTCDICNKDIEVRWGIFANETLNRHKKAEHK
Ga0208091_10000465	3300020506	Freshwater	VEKSRVVTCDICHKDIEVRWGIFANETLNRHKKAEHK
Ga0208089_10069281	3300020543	Freshwater	LLLYTEYMTGKVVICPVCKKETEVRWGIFAHDTLNRHMKEHK
Ga0208853_10431151	3300020546	Freshwater	MEGGVVSSRFVVCDICNKEIELRWAIFGSDTLSRHRKAEHK
Ga0208852_10329702	3300020560	Freshwater	VEKSRVVTCDICNKDVEVRWGIFANETLNRHKKAEHK
Ga0208465_10141131	3300020570	Freshwater	MESRVAPARVVVCEICKKELVVRWGIFAHDTLSRHRKAEH
Ga0194130_100221485	3300021376	Freshwater Lake	MEGGRLMASRFVLCDICNKEIELRWGIFGHDALSRHKKEHK
Ga0194048_101619153	3300021519	Anoxic Zone Freshwater	MAGKVIVCPICNKEVEVRWGIFASDTLGRHIKEHK
Ga0222714_100856372	3300021961	Estuarine Water	MANRFVLCDICNKEIELRWGIFGHDALSRHKKEHK
Ga0214917_1000009973	3300022752	Freshwater	MASRVVVCDICSKEIELRWGIFGHDALSRHRKAEHK
Ga0214917_1000035271	3300022752	Freshwater	MEKGRVAVCDKCGKELEVRWGIFAHDTLSRHLKEHKNGQEAA
Ga0214921_1000087286	3300023174	Freshwater	MEGGIVEKGRVVICDICKKGIEVRWGIFANDTLSRHKKAEHK
Ga0214921_100163743	3300023174	Freshwater	MTKRAVVCDVCKKEIEVRWAIFANETLGKHKKMEHK
Ga0214923_1000112540	3300023179	Freshwater	MEKGRVAVCNKCGKELEVRWGIFAHDTLSRHLKEHKNGQESA
Ga0214923_100381412	3300023179	Freshwater	MEKSRVVVCMTCSKELEVRWGIFAHQTLSRHIKEHNNGKKSAEEAA
Ga0214919_1000152310	3300023184	Freshwater	MTDSRVVICPECKKEIKVQLGIFAHATLSRHMKEHK
Ga0214919_1000257720	3300023184	Freshwater	MEKSRVVTCDICKRDIEVRWGIFASDTLNRHKKAEHK
Ga0255209_10294274	3300024280	Freshwater	GRLMANRFVLCDICNKEIELRWGIFGHDALSRHKKEHK
Ga0255147_100002228	3300024289	Freshwater	MEKGRVVICDLCNKTIEVRWGIFAHQSLYRHKKADHK
Ga0255147_10613931	3300024289	Freshwater	MEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK
Ga0255148_10500532	3300024306	Freshwater	MEKGRTVICTTCGRELEVRWGIFAHQTLSRHMKEHSNGK
Ga0244775_101612193	3300024346	Estuarine	MSGRFVICNVCKKEIEVRSGIFAHETLRRHIIKEHK
Ga0244775_102041003	3300024346	Estuarine	MEGGVMEKGRVVTCDICKRDIEVRWGIFANDTLSRHKKAEHK
Ga0244775_102576572	3300024346	Estuarine	MSSRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH
Ga0244775_103702124	3300024346	Estuarine	MEGGVVEKGRVVVCDICKKDVVVRWGIFANDTLSRHKKAEHK
Ga0244776_100012108	3300024348	Estuarine	MEGGVMEKSRVVTCDICKRDIEVRWGIFASDTLNRHKKAEHK
Ga0244776_1000285013	3300024348	Estuarine	MEKGRVVTCDICNKDIEVRWGIFANDTLTRHKKAEHK
Ga0255167_10045962	3300024350	Freshwater	MTGKVVICPVCKKETEVRWGIFAHDTLNRHLKEHK
Ga0255141_100205913	3300024351	Freshwater	YMGRVVICDVCKKEIEVRWGIFAHDTLNRHRKEHK
Ga0256330_11072102	3300024481	Freshwater	EKGRVVICDLCNKTIEVRWGIFAHQSLYRHKKADHK
Ga0255143_10133712	3300024500	Freshwater	MSNKVVICNVCKKEIEVRWGIFAHDTLSRHMKEHK
Ga0255152_10239634	3300024503	Freshwater	MEKGRTVICTTCGRELEVRWGIFAHQTLSRHMKEH
Ga0256339_10644882	3300024857	Freshwater	VICTTCGRELEVRWGIFAHQTLSRHMKEHSNGKKSAEEAA
Ga0208546_100324311	3300025585	Aqueous	MAGKVVICNICKKEIEVRSGIFAHDTLNRHMKEHK
Ga0255160_10494011	3300026457	Freshwater	MEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHL
Ga0255166_10221331	3300026473	Freshwater	QVRASMEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK
Ga0255274_10272021	3300026570	Freshwater	NRSMEKGRVVICDLCNKTIEVRWGIFAHQSLYRHKKADHK
Ga0255154_10581121	3300027467	Freshwater	KVCSSMEGGGIMSRIVICTECSKEIEVRWGIFAHDTLNRHLKEHK
Ga0208974_10113299	3300027608	Freshwater Lentic	MTNKRVAVCEVCNKEIEVRWGIFANDTLKRHIKEHVNGA
Ga0208974_10144345	3300027608	Freshwater Lentic	NKRVAVCEVCNKEIEVRWGIFANDTLKRHIKEHVNGA
Ga0208951_10891094	3300027621	Freshwater Lentic	SSVEGGLVEKSRVVTCDICNKDIEVRWGIFANETLNRHKKAEHK
Ga0209356_10099113	3300027644	Freshwater Lake	MEGRVMEKSRSVTCDICKRDIEVRWGIFASDTLSRHKKAEHK
Ga0208960_10048314	3300027649	Freshwater Lentic	MSNRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK
Ga0209443_10122397	3300027707	Freshwater Lake	VEGGLVEKSRVVTCDICNKDIEVRWGIFANETLNRHKKAEHK
Ga0209442_12435313	3300027732	Freshwater Lake	MESRVVPARVVVCEICKKELVVRWGIFAHDTLSRHRKAEH
Ga0209355_10015899	3300027744	Freshwater Lake	VEKSRVVTCDICNKDIEVRWGIFANETLNRHKKAEHK
Ga0209296_10009744	3300027759	Freshwater Lake	VEKRRVVTCDICNKDIEVRWGMFANETLNRHKKAEHK
Ga0209598_100183831	3300027760	Freshwater Lake	WKMEKSRVVTCDICNRDIEVRWGIFASDTLTRHKKAEHK
Ga0209770_100084675	3300027769	Freshwater Lake	MSGRVVVCDICKKEIELRWGIFAHDSLSRHRKAEH
Ga0209086_1000004332	3300027770	Freshwater Lake	VEKSKVVTCDICNKDVEVRWGIFANETLNRHKKAEHK
Ga0209086_100279651	3300027770	Freshwater Lake	KMEKSRSVTCDICNREIEVRWGIFASDTLGRHKKAEH
Ga0209972_102138125	3300027793	Freshwater Lake	MSNKIVVCDICKKEIEVRWGIFAHDTLGRHMREHK
Ga0209354_100122581	3300027808	Freshwater Lake	ILVMMTNKRVAICEVCNKEIEVRWGIFASDTLKRHMKEHN
Ga0209550_100054167	3300027892	Freshwater Lake	MEKSRVVVCDICKKDIVVRWGIFASDTLNRHKKAEHK
Ga0209550_101158124	3300027892	Freshwater Lake	MEGRVMEKGRVVTCDICNRDIEVRWGIFASDTLSRHKKAEHK
Ga0247723_10034395	3300028025	Deep Subsurface Sediment	MEKSRYIICEVCGREIEVRWGIFASDTLVRHMKEHKE
Ga0247723_10142985	3300028025	Deep Subsurface Sediment	VEKGRVVICDICKKGIEVRWGIFANDTLLRHKKAAHK
Ga0255184_10951371	3300028091	Freshwater	MGRVVICDVCKKEIEVRWGIFAHDTLNRHRKEHKXPKKL
(restricted) Ga0247843_10884073	3300028569	Freshwater	ELIKITSKRVVVCEICKKEIEVRSGIFAYDTLTRHLKEHK
Ga0119944_100003914	3300029930	Aquatic	MTGKVVICPVCGKETDVRWGIFAHDTLNRHMKEHK
Ga0315907_10000127104	3300031758	Freshwater	MSNRIVKCDMCNKEIELRWGIFGHDTLNRHIKAEHK
Ga0315907_100210314	3300031758	Freshwater	MEGGVVSGRFVVCDTCGKEIELRWGIFGHDTLNRHRKAEH
Ga0315907_100227678	3300031758	Freshwater	MGLIKVASNRVVICDVCQKEIELRWGIFGHDTLNRHMKEHNG
Ga0315907_101226067	3300031758	Freshwater	MSNKVVICYICSKEIEVRWGIFAHDTLSRHKKEHNGKM
Ga0315907_102588412	3300031758	Freshwater	MTGKVVVCPVCKKETEVRWGIFAHDTLSRHMKEHGDVRD
Ga0315907_113021582	3300031758	Freshwater	MEPKRVVVCPVCYKETELRWGIFAHDTLSRHMKAEHKK
Ga0315900_100570938	3300031787	Freshwater	MYNDYMDKGRVVVCDVCNKEIEVRWGIFAHDTLSRHLREHSNG
Ga0315900_102167434	3300031787	Freshwater	MSGRFVICEACGKEIELRWGIFGHDTLSRHRKAEH
Ga0315909_100220926	3300031857	Freshwater	MEKGKVVICNICSKEIEVRWGIFGHDTLNRHKREHRDE
Ga0315909_101432909	3300031857	Freshwater	KGRVAVCDTCNKEIEVRWGIFAHDTINRHKKAEHK
Ga0315909_103646183	3300031857	Freshwater	MEKGRIAICDTCNKEIEVRWGIFAHDTINRHKKAEHK
Ga0315904_1000182127	3300031951	Freshwater	MSGRFVVCEICGKEIELRWGIFGHDTLSRHRKAEH
Ga0315904_1000585328	3300031951	Freshwater	MEKGRVVICDICNKEIEVRNNVFAHETLSRHLKEHKNG
Ga0315904_100314144	3300031951	Freshwater	MADPKRVVVCHKCNKEIELRWGIFAHDTLSRHMKAEHK
Ga0315904_100341503	3300031951	Freshwater	MNRVVICDICKKEIELRWGIFGHDALSRHKGKEHK
Ga0315904_100969716	3300031951	Freshwater	MSGRVVICPICKKETEVRTGIFAHDTLSRHMKEHK
Ga0315904_101252903	3300031951	Freshwater	VEKGKSVICEICDKQIEVRWGIFAHETLTRHKKAEHK
Ga0315904_110878992	3300031951	Freshwater	SMDKGRVAVCDTCNKEIEVRWGIFAHDTINRHKKAEHK
Ga0315904_114179151	3300031951	Freshwater	MEKGRVVICDTCNKEIELRWGIFGHDALSRHKKEHKNAA
Ga0315901_101668892	3300031963	Freshwater	MDKGRVAVCDTCNKEIEVRWGIFAHDTINRHKKAEHK
Ga0315901_103756074	3300031963	Freshwater	QRIGGIMSSRVVICPKCKKEIELRWGIFAHDTLSRHMKEHK
Ga0315901_107416573	3300031963	Freshwater	MPGKFVICDICKKEIEVRSGIFAHDTLNRHMKEHKXNHISL
Ga0315906_103668123	3300032050	Freshwater	VEGGVVEKGKSVICEICDKQIEVRWGIFAHETLTRHKKAEHK
Ga0315905_100114494	3300032092	Freshwater	MEGRVMEKSRAVTCDICKRDIEVRWGIFASDTLSRHKKAEHK
Ga0315903_1000679632	3300032116	Freshwater	MEKGRVAICDKCGKELEVRWGIFAHQTLSRHLKEHKNAKAA
Ga0315903_101504251	3300032116	Freshwater	RQLYKIGRLLYTGYMTGKVVICPVCKKETEVRWGIFAHDTLNRHMKEHK
Ga0315903_104194753	3300032116	Freshwater	NRNMEKGRVAICDKCGKELEVRWGIFAHQTLSRHMKEHKNAKAA
Ga0315903_111603422	3300032116	Freshwater	MEGGMMSNRIVKCSICNKEIEVRWGIFANETLSRHMKEHK
Ga0334977_0100564_964_1077	3300033978	Freshwater	MSRFVICSDCKKEIEVRWGIFGHDTLSRHSKECKGGK
Ga0334982_0017982_1396_1518	3300033981	Freshwater	MESGVAQARVVVCEVCKKELVVRWGIFAHDTLSRHRKAEH
Ga0334992_0053624_2_112	3300033992	Freshwater	VAQARVVVCEVCKKELVVRWGIFAHDTLSRHRKAEH
Ga0334994_0029550_959_1087	3300033993	Freshwater	VEGGLVEKSRVVTCDICHKDIEVRWGIFANETLNRHKKAEHK
Ga0334979_0024021_2925_3038	3300033996	Freshwater	MEKSRAVTCDICNKDIEVRWGIFANETLNRHKKAEHK
Ga0334985_0029527_2_112	3300034018	Freshwater	MESRVAPARVVVCEVCKKELVVRWGIFAHDTLSRHRK
Ga0334998_0383883_3_107	3300034019	Freshwater	MTSKVVVCPICNKETEVRWGIFAHDTLSRPMKEHG
Ga0335028_0024850_4016_4126	3300034071	Freshwater	MSAKVVICDKCSKEIEVRQGIFASATLSRHYKAEHK
Ga0335028_0128065_2_139	3300034071	Freshwater	CSSMEGRVMEKIRAVTCDICKRDIEVRWGIFASDTLSRHKKAEHK
Ga0335022_0163419_2_145	3300034095	Freshwater	RRELCASMESRVAPARVVVCEICKKELVVRWGIFAHDTLSRHRKAEH
Ga0335030_0116893_1_141	3300034103	Freshwater	RFRASMEGGVMSNRVVVCDICNKEIDLRWAIFASDTLRRHIKAEHK
Ga0335031_0842956_385_507	3300034104	Freshwater	VVEKTRVVVCDICSKSIEVRWGIFANDTLSRHKKVEHKNE
Ga0335035_0444213_3_128	3300034105	Freshwater	LELIKITDKKVVICETCKKEIEVRWGIFASDTLKRHTKEHK
Ga0335036_0001397_5545_5658	3300034106	Freshwater	MEKSRVVTCDICHKDIEVRWGIFANETLNRHKKAEHK
Ga0335066_0000770_23031_23153	3300034112	Freshwater	MESRVAQARVVVCEVCKKELVVRWGIFAHDTLSRHRKAEH
Ga0335066_0012843_1289_1408	3300034112	Freshwater	MTSKVVVCPICNKETEVRWGIFAHDTLSRHMKEHGDVRD
Ga0335058_0076393_715_843	3300034121	Freshwater	MEGRVMEKIRAVTCDICKRDIEVRWGIFASDTLSRHKKAEHK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters