Metagenome Family F014101

Overview

Basic Information

• Family ID: F014101
• Family Type: Metagenome
• Number of Sequences: 265
• Average Sequence Length: 39 residues
• Representative Sequence: PNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA
• Number of Associated Samples: 32
• Number of Associated Scaffolds: 265

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 26.98 %
• % of genes near scaffold ends (potentially truncated): 88.30 %
• % of genes from short scaffolds (< 2000 bps): 87.17 %
• Associated GOLD sequencing projects: 25
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (65.283 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater (84.528 % of family members)
• Environment Ontology (ENVO): Unclassified (91.698 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (88.302 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Fibrous
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 18.18%
  β-sheet: 0.00%
  Coil/Unstructured: 81.82%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 265 Family Scaffolds
PF14329	DUF4386	1.51
PF13676	TIR_2	1.51
PF11185	DUF2971	1.51
PF10592	AIPR	1.51
PF00583	Acetyltransf_1	1.51
PF03235	DUF262	1.13
PF13175	AAA_15	1.13
PF00069	Pkinase	1.13
PF08867	FRG	0.75
PF12697	Abhydrolase_6	0.75
PF01381	HTH_3	0.75
PF13391	HNH_2	0.75
PF13302	Acetyltransf_3	0.75
PF01042	Ribonuc_L-PSP	0.75
PF14022	DUF4238	0.75
PF03887	YfbU	0.75
PF04365	BrnT_toxin	0.75
PF01926	MMR_HSR1	0.38
PF00226	DnaJ	0.38
PF13289	SIR2_2	0.38
PF01551	Peptidase_M23	0.38
PF13673	Acetyltransf_10	0.38
PF13304	AAA_21	0.38
PF07589	PEP-CTERM	0.38
PF13560	HTH_31	0.38
PF13271	DUF4062	0.38
PF00893	Multi_Drug_Res	0.38
PF08534	Redoxin	0.38
PF14534	DUF4440	0.38
PF00692	dUTPase	0.38
PF12681	Glyoxalase_2	0.38
PF13649	Methyltransf_25	0.38
PF02518	HATPase_c	0.38
PF08241	Methyltransf_11	0.38
PF05257	CHAP	0.38
PF01391	Collagen	0.38
PF14834	GST_C_4	0.38
PF00078	RVT_1	0.38
PF12847	Methyltransf_18	0.38
PF14491	DUF4435	0.38
PF07603	DUF1566	0.38
PF13091	PLDc_2	0.38
PF08861	DUF1828	0.38
PF16162	DUF4868	0.38
PF06094	GGACT	0.38
PF13432	TPR_16	0.38
PF00023	Ank	0.38
PF13489	Methyltransf_23	0.38
PF07110	EthD	0.38
PF14072	DndB	0.38
PF05015	HigB-like_toxin	0.38
PF00533	BRCT	0.38
PF05168	HEPN	0.38
PF11528	DUF3224	0.38
PF14384	BrnA_antitoxin	0.38
PF13643	DUF4145	0.38
PF01909	NTP_transf_2	0.38
PF14279	HNH_5	0.38

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 265 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	4.53
COG1479	DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains	Defense mechanisms [V]	1.13
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.75
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.75
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	0.38
COG0756	dUTP pyrophosphatase (dUTPase)	Defense mechanisms [V]	0.38
COG1895	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	0.38
COG2076	Multidrug transporter EmrE and related cation transporters	Defense mechanisms [V]	0.38
COG2250	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	0.38
COG3549	Plasmid maintenance system killer protein	Defense mechanisms [V]	0.38

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	65.28 %
Unclassified	root	N/A	34.72 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	65.28 %
Unclassified	root	N/A	34.72 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	65.28 %
Unclassified	root	N/A	34.72 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	48.68 %
Unclassified	root	N/A	34.72 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.51 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.75 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.75 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.72 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	29.43 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6.42 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.13 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.38 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.38 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.75 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.75 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	0.75 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.72 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	17.36 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	2.26 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	2.26 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.89 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1.89 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.13 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1.13 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	0.38 %
Oceanospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales	0.38 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.38 %
Neisseriales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales	0.38 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.38 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.38 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.75 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.75 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	0.75 %
Leptospirales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales	0.75 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.72 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	5.28 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	3.02 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	2.64 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	1.89 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	1.13 %
Zoogloeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae	1.13 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	1.51 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.51 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.38 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.38 %
Alteromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae	0.38 %
unclassified Burkholderiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	0.38 %
Oceanospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae	0.38 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.38 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.38 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.38 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	0.38 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.38 %
Sterolibacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae	0.38 %
Azonexaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae	0.38 %
Pseudanabaenales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales	0.38 %
Marinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae	0.38 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.38 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.38 %
Leptospiraceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae	0.75 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.75 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.75 %
beta proteobacterium AAP51	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51	0.75 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.75 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.75 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.72 %
Massilia group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group	1.89 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	1.13 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	1.13 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	1.13 %
Candidatus Nitrotoga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga	1.13 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.51 %
Bordetella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella	0.38 %
Nitrosomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas	0.38 %
Oceanospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Oceanospirillum	0.38 %
Marinobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter	0.38 %
Janthinobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium	0.38 %
Hydrogenophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga	0.38 %
Polaromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas	0.38 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.38 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.38 %
Formivibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Formivibrio	0.38 %
Ferribacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium	0.38 %
Aquabacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium	0.38 %
Limnobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Limnobacter	0.38 %
Rhizobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter	0.38 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.38 %
Chitinimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas	0.38 %
Candidatus Accumulibacter phosphatis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter phosphatis	0.38 %
Pelomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas	0.38 %
Methyloversatilis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis	0.38 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	0.38 %
Paraglaciecola	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola	0.38 %
Chamaesiphonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Chamaesiphonaceae	0.38 %
Pseudanabaenaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae	0.38 %
Burkholderiales bacterium PBB4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB4	0.38 %
Quisquiliibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium	0.38 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.38 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.38 %
Leptospira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	0.75 %
Comamonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas	0.75 %
Xanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas	0.75 %
Methylomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas	0.75 %
Acidovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	0.75 %
Rubrivivax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax	0.75 %
Rugamonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas	0.75 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.75 %
beta proteobacterium AAP51	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51	0.75 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.72 %
unclassified Thauera	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera	1.13 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.51 %
Myxococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae	0.38 %
Methylomonas methanica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas methanica	0.38 %
Pseudanabaena	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena	0.38 %
Desulfobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter	0.38 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.38 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.38 %
Xanthomonas arboricola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas arboricola	0.38 %
Oceanospirillum multiglobuliferum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Oceanospirillum → Oceanospirillum multiglobuliferum	0.38 %
Ferribacterium limneticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum	0.38 %
Formivibrio citricus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Formivibrio → Formivibrio citricus	0.38 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	0.38 %
unclassified Pseudomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas	0.38 %
Chamaesiphon	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Chamaesiphonaceae → Chamaesiphon	0.38 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.38 %
Comamonas thiooxydans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas thiooxydans	0.38 %
Pseudomonas reinekei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas reinekei	0.38 %
Acidovorax carolinensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax carolinensis	0.38 %
Rhodanobacter glycinis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter glycinis	0.38 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.38 %
Methylomonas paludis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas paludis	0.38 %
Marinobacter salarius	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter salarius	0.38 %
Quisquiliibacterium transsilvanicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium → Quisquiliibacterium transsilvanicum	0.38 %
Paraglaciecola hydrolytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola → Paraglaciecola hydrolytica	0.38 %
Chitinimonas arctica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas arctica	0.38 %
unclassified Nitrosomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas	0.38 %
unclassified Janthinobacterium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → unclassified Janthinobacterium	0.38 %
Hydrogenophaga aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga aromaticivorans	0.38 %
unclassified Limnohabitans	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans	0.38 %
unclassified Bordetella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella	0.38 %
unclassified Limnobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Limnobacter → unclassified Limnobacter	0.38 %
unclassified Polaromonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas	0.38 %
unclassified Comamonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas	0.38 %
unclassified Methyloversatilis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis	0.38 %
unclassified Rhizobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter	0.38 %
unclassified Candidatus Nitrotoga	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga	0.38 %
unclassified Acidovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax	0.38 %
Aquabacterium terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium terrae	0.38 %
Variovorax terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax terrae	0.38 %
Candidatus Accumulibacter phosphatis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter phosphatis	0.38 %
Pelomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas	0.38 %
Burkholderiales bacterium PBB4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB4	0.38 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.38 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.38 %
Duganella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella	0.75 %
Leptospira kmetyi	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira kmetyi	0.75 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.75 %
Rugamonas rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → Rugamonas rubra	0.75 %
Pseudoduganella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Pseudoduganella	0.75 %
beta proteobacterium AAP51	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51	0.75 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.72 %
Thauera sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp.	1.13 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.51 %
Desulfobacter postgatei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → Desulfobacter postgatei	0.38 %
Corallococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus	0.38 %
Nitrosomonas sp. Is79A3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. Is79A3	0.38 %
unclassified Chitinophagaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae	0.38 %
Comamonas sp. B-9	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas → Comamonas sp. B-9	0.38 %
Chamaesiphon minutus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Chamaesiphonaceae → Chamaesiphon → Chamaesiphon minutus	0.38 %
Bordetella sp. N	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella → Bordetella sp. N	0.38 %
Methyloversatilis sp. RAC08	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08	0.38 %
Janthinobacterium sp. TND4EL3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → unclassified Janthinobacterium → Janthinobacterium sp. TND4EL3	0.38 %
Limnobacter sp. SAORIC-690	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Limnobacter → unclassified Limnobacter → Limnobacter sp. SAORIC-690	0.38 %
Limnohabitans sp. TS-CS-82	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. TS-CS-82	0.38 %
Pseudomonas sp. PB120	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. PB120	0.38 %
unclassified Pseudanabaena	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena	0.38 %
Variovorax sp. dw_954	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. dw_954	0.38 %
Rhizobacter sp. AJA081-3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. AJA081-3	0.38 %
Polaromonas sp. CG_9.11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. CG_9.11	0.38 %
Acidovorax sp. JG5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JG5	0.38 %
Candidatus Nitrotoga sp. 1052	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga → Candidatus Nitrotoga sp. 1052	0.38 %
Methylomonas methanica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas methanica	0.38 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.38 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.38 %
Xanthomonas arboricola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas arboricola	0.38 %
Oceanospirillum multiglobuliferum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Oceanospirillum → Oceanospirillum multiglobuliferum	0.38 %
Ferribacterium limneticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum	0.38 %
Formivibrio citricus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Formivibrio → Formivibrio citricus	0.38 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	0.38 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.38 %
Comamonas thiooxydans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas thiooxydans	0.38 %
Pseudomonas reinekei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas reinekei	0.38 %
Acidovorax carolinensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax carolinensis	0.38 %
Rhodanobacter glycinis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter glycinis	0.38 %
Methylomonas paludis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas paludis	0.38 %
Marinobacter salarius	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter salarius	0.38 %
Quisquiliibacterium transsilvanicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium → Quisquiliibacterium transsilvanicum	0.38 %
Paraglaciecola hydrolytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola → Paraglaciecola hydrolytica	0.38 %
Chitinimonas arctica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas arctica	0.38 %
Hydrogenophaga aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga aromaticivorans	0.38 %
Aquabacterium terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium terrae	0.38 %
Variovorax terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax terrae	0.38 %
Candidatus Accumulibacter phosphatis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter phosphatis	0.38 %
Pelomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas	0.38 %
Burkholderiales bacterium PBB4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB4	0.38 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.38 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.38 %
Pseudoduganella rivuli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Pseudoduganella → Pseudoduganella rivuli	0.75 %
Duganella lactea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella lactea	0.75 %
Leptospira kmetyi	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira kmetyi	0.75 %
Rugamonas rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → Rugamonas rubra	0.75 %
beta proteobacterium AAP51	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51	0.75 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.72 %
Thauera sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp.	1.13 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.51 %
Pseudanabaena sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp.	0.38 %
Desulfobacter postgatei 2ac9	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → Desulfobacter postgatei → Desulfobacter postgatei 2ac9	0.38 %
Chamaesiphon minutus PCC 6605	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Chamaesiphonaceae → Chamaesiphon → Chamaesiphon minutus → Chamaesiphon minutus PCC 6605	0.38 %
Chitinophagaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	0.38 %
Corallococcus llansteffanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus llansteffanensis	0.38 %
Nitrosomonas sp. Is79A3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. Is79A3	0.38 %
Comamonas sp. B-9	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas → Comamonas sp. B-9	0.38 %
Bordetella sp. N	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella → Bordetella sp. N	0.38 %
Methyloversatilis sp. RAC08	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08	0.38 %
Janthinobacterium sp. TND4EL3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → unclassified Janthinobacterium → Janthinobacterium sp. TND4EL3	0.38 %
Limnobacter sp. SAORIC-690	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Limnobacter → unclassified Limnobacter → Limnobacter sp. SAORIC-690	0.38 %
Limnohabitans sp. TS-CS-82	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. TS-CS-82	0.38 %
Pseudomonas sp. PB120	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. PB120	0.38 %
Variovorax sp. dw_954	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. dw_954	0.38 %
Rhizobacter sp. AJA081-3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. AJA081-3	0.38 %
Polaromonas sp. CG_9.11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. CG_9.11	0.38 %
Acidovorax sp. JG5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JG5	0.38 %
Candidatus Nitrotoga sp. 1052	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga → Candidatus Nitrotoga sp. 1052	0.38 %
Methylomonas methanica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas methanica	0.38 %
Rubrivivax gelatinosus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	0.38 %
Variovorax paradoxus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	0.38 %
Xanthomonas arboricola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas arboricola	0.38 %
Oceanospirillum multiglobuliferum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Oceanospirillum → Oceanospirillum multiglobuliferum	0.38 %
Ferribacterium limneticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum	0.38 %
Formivibrio citricus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Formivibrio → Formivibrio citricus	0.38 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	0.38 %
Rubrivivax benzoatilyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	0.38 %
Comamonas thiooxydans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas thiooxydans	0.38 %
Pseudomonas reinekei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas reinekei	0.38 %
Acidovorax carolinensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax carolinensis	0.38 %
Rhodanobacter glycinis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter glycinis	0.38 %
Methylomonas paludis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas paludis	0.38 %
Marinobacter salarius	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter salarius	0.38 %
Quisquiliibacterium transsilvanicum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium → Quisquiliibacterium transsilvanicum	0.38 %
Paraglaciecola hydrolytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola → Paraglaciecola hydrolytica	0.38 %
Chitinimonas arctica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas arctica	0.38 %
Hydrogenophaga aromaticivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga aromaticivorans	0.38 %
Aquabacterium terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium terrae	0.38 %
Variovorax terrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax terrae	0.38 %
Candidatus Accumulibacter phosphatis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter phosphatis	0.38 %
Pelomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas	0.38 %
Burkholderiales bacterium PBB4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB4	0.38 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.38 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.38 %
Pseudoduganella rivuli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Pseudoduganella → Pseudoduganella rivuli	0.75 %
Duganella lactea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella lactea	0.75 %
Leptospira kmetyi	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira kmetyi	0.75 %
Rugamonas rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → Rugamonas rubra	0.75 %
beta proteobacterium AAP51	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51	0.75 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300002835|B570J40625_100451110	All Organisms → cellular organisms → Bacteria → Proteobacteria	1228
3300005487|Ga0074211_101670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1321
3300005639|Ga0077110_1015422	All Organisms → cellular organisms → Bacteria	1897
3300005982|Ga0075156_10266798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	901
3300007517|Ga0105045_10085232	Not Available	2773
3300007517|Ga0105045_10113876	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus llansteffanensis	2333
3300007517|Ga0105045_10184363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1721
3300007517|Ga0105045_10297810	Not Available	1253
3300007517|Ga0105045_10346710	Not Available	1128
3300007517|Ga0105045_10352855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1115
3300007517|Ga0105045_10353675	Not Available	1113
3300007517|Ga0105045_10356416	Not Available	1107
3300007517|Ga0105045_10383788	Not Available	1053
3300007517|Ga0105045_10391437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp.	1039
3300007517|Ga0105045_10415437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	997
3300007517|Ga0105045_10420694	All Organisms → cellular organisms → Bacteria → Proteobacteria	988
3300007517|Ga0105045_10427612	Not Available	977
3300007517|Ga0105045_10438610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JG5	960
3300007517|Ga0105045_10442602	Not Available	954
3300007517|Ga0105045_10484359	All Organisms → cellular organisms → Bacteria → Proteobacteria	896
3300007517|Ga0105045_10501981	Not Available	875
3300007517|Ga0105045_10517875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium → Quisquiliibacterium transsilvanicum	856
3300007517|Ga0105045_10519133	Not Available	855
3300007517|Ga0105045_10544517	All Organisms → cellular organisms → Bacteria	827
3300007517|Ga0105045_10550778	All Organisms → cellular organisms → Bacteria	821
3300007517|Ga0105045_10584198	Not Available	788
3300007517|Ga0105045_10598478	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	775
3300007517|Ga0105045_10632843	All Organisms → cellular organisms → Bacteria	745
3300007517|Ga0105045_10678563	Not Available	711
3300007517|Ga0105045_10721741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella lactea	682
3300007517|Ga0105045_10729832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	677
3300007517|Ga0105045_10765329	Not Available	655
3300007517|Ga0105045_10811269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → Acidovorax carolinensis	630
3300007517|Ga0105045_10813467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	629
3300007517|Ga0105045_10848892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	611
3300007517|Ga0105045_10897414	Not Available	589
3300007517|Ga0105045_10904621	Not Available	586
3300007517|Ga0105045_10992049	All Organisms → cellular organisms → Bacteria → Proteobacteria	551
3300007521|Ga0105044_10185995	All Organisms → cellular organisms → Bacteria → Proteobacteria	2129
3300007521|Ga0105044_10231884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51	1825
3300007521|Ga0105044_10242640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. AJA081-3	1767
3300007521|Ga0105044_10414254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1206
3300007521|Ga0105044_10598670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax paradoxus	924
3300007521|Ga0105044_10644391	All Organisms → cellular organisms → Bacteria → Proteobacteria	876
3300007521|Ga0105044_10674775	All Organisms → cellular organisms → Bacteria → Proteobacteria	847
3300007521|Ga0105044_10684243	Not Available	839
3300007521|Ga0105044_10733277	Not Available	798
3300007521|Ga0105044_10734193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	797
3300007521|Ga0105044_10920521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	678
3300007521|Ga0105044_10987232	Not Available	645
3300007521|Ga0105044_11272384	Not Available	541
3300007799|Ga0105049_10172855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas arboricola	1894
3300007799|Ga0105049_10175468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → Rugamonas rubra	1874
3300007799|Ga0105049_10300148	Not Available	1297
3300007799|Ga0105049_10308860	Not Available	1272
3300007799|Ga0105049_10489968	Not Available	920
3300007799|Ga0105049_10634045	Not Available	767
3300007799|Ga0105049_10775924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	665
3300007799|Ga0105049_10880850	Not Available	609
3300007799|Ga0105049_10972584	All Organisms → cellular organisms → Bacteria	569
3300007799|Ga0105049_11005513	Not Available	556
3300007799|Ga0105049_11011183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas arctica	554
3300009032|Ga0105048_10149937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2929
3300009032|Ga0105048_10160539	All Organisms → cellular organisms → Bacteria	2794
3300009032|Ga0105048_10166178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium terrae	2727
3300009032|Ga0105048_10220556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2235
3300009032|Ga0105048_10241354	All Organisms → cellular organisms → Bacteria → Proteobacteria	2097
3300009032|Ga0105048_10273038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus	1919
3300009032|Ga0105048_10294127	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Chamaesiphonaceae → Chamaesiphon → Chamaesiphon minutus → Chamaesiphon minutus PCC 6605	1818
3300009032|Ga0105048_10365099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas methanica	1552
3300009032|Ga0105048_10389517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga → Candidatus Nitrotoga sp. 1052	1478
3300009032|Ga0105048_10390241	Not Available	1476
3300009032|Ga0105048_10397260	All Organisms → cellular organisms → Bacteria	1457
3300009032|Ga0105048_10446513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → unclassified Bordetella → Bordetella sp. N	1334
3300009032|Ga0105048_10450216	All Organisms → cellular organisms → Bacteria	1326
3300009032|Ga0105048_10493078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Pseudoduganella → Pseudoduganella rivuli	1237
3300009032|Ga0105048_10508506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1208
3300009032|Ga0105048_10546441	Not Available	1143
3300009032|Ga0105048_10569451	Not Available	1107
3300009032|Ga0105048_10654476	All Organisms → cellular organisms → Bacteria	994
3300009032|Ga0105048_10664226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	983
3300009032|Ga0105048_10665695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	981
3300009032|Ga0105048_10672223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum	974
3300009032|Ga0105048_10684893	Not Available	959
3300009032|Ga0105048_10736112	Not Available	907
3300009032|Ga0105048_10740465	Not Available	902
3300009032|Ga0105048_10768174	All Organisms → cellular organisms → Bacteria	877
3300009032|Ga0105048_10769080	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp.	876
3300009032|Ga0105048_10807896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter salarius	843
3300009032|Ga0105048_10820258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	833
3300009032|Ga0105048_10837274	All Organisms → cellular organisms → Bacteria	820
3300009032|Ga0105048_10916410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas	764
3300009032|Ga0105048_11064926	All Organisms → cellular organisms → Bacteria	680
3300009032|Ga0105048_11075330	Not Available	675
3300009032|Ga0105048_11090364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	668
3300009032|Ga0105048_11107759	Not Available	660
3300009032|Ga0105048_11334732	Not Available	573
3300009032|Ga0105048_11351326	Not Available	568
3300009032|Ga0105048_11476357	All Organisms → cellular organisms → Bacteria	532
3300009032|Ga0105048_11477190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. PB120	531
3300009083|Ga0105047_10030981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	7872
3300009083|Ga0105047_10117720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	3278
3300009083|Ga0105047_10142012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2879
3300009083|Ga0105047_10149325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas reinekei	2781
3300009083|Ga0105047_10178764	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	2448
3300009083|Ga0105047_10197857	All Organisms → cellular organisms → Bacteria	2277
3300009083|Ga0105047_10215166	All Organisms → cellular organisms → Bacteria	2143
3300009083|Ga0105047_10221162	All Organisms → cellular organisms → Bacteria → Proteobacteria	2102
3300009083|Ga0105047_10251597	All Organisms → cellular organisms → Bacteria → Proteobacteria	1914
3300009083|Ga0105047_10285312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. Is79A3	1747
3300009083|Ga0105047_10293289	All Organisms → cellular organisms → Bacteria	1712
3300009083|Ga0105047_10321934	All Organisms → cellular organisms → Bacteria → Proteobacteria	1599
3300009083|Ga0105047_10334595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1554
3300009083|Ga0105047_10336430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Formivibrio → Formivibrio citricus	1548
3300009083|Ga0105047_10369378	All Organisms → cellular organisms → Bacteria → Proteobacteria	1445
3300009083|Ga0105047_10409224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1338
3300009083|Ga0105047_10417671	All Organisms → cellular organisms → Bacteria → Proteobacteria	1317
3300009083|Ga0105047_10430977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1287
3300009083|Ga0105047_10444306	Not Available	1257
3300009083|Ga0105047_10477039	Not Available	1192
3300009083|Ga0105047_10492744	Not Available	1163
3300009083|Ga0105047_10545715	All Organisms → cellular organisms → Bacteria → Proteobacteria	1076
3300009083|Ga0105047_10545744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Limnobacter → unclassified Limnobacter → Limnobacter sp. SAORIC-690	1076
3300009083|Ga0105047_10596578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1005
3300009083|Ga0105047_10679246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	910
3300009083|Ga0105047_10702622	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → Desulfobacter postgatei → Desulfobacter postgatei 2ac9	887
3300009083|Ga0105047_10708189	Not Available	882
3300009083|Ga0105047_10709750	Not Available	880
3300009083|Ga0105047_10790900	Not Available	810
3300009083|Ga0105047_10800240	Not Available	803
3300009083|Ga0105047_10860805	Not Available	759
3300009083|Ga0105047_10890087	Not Available	741
3300009083|Ga0105047_11207487	All Organisms → cellular organisms → Bacteria	589
3300009083|Ga0105047_11316444	All Organisms → cellular organisms → Bacteria → Proteobacteria	553
3300009083|Ga0105047_11382664	Not Available	534
3300009083|Ga0105047_11386371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	533
3300009083|Ga0105047_11461724	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga	513
3300009083|Ga0105047_11504807	Not Available	503
3300009084|Ga0105046_10300423	All Organisms → cellular organisms → Bacteria	1714
3300009084|Ga0105046_10308239	All Organisms → cellular organisms → Bacteria → Proteobacteria	1682
3300009084|Ga0105046_10319699	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira kmetyi	1638
3300009084|Ga0105046_10328480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → Hydrogenophaga aromaticivorans	1606
3300009084|Ga0105046_10332467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter phosphatis	1591
3300009084|Ga0105046_10342761	All Organisms → cellular organisms → Bacteria	1556
3300009084|Ga0105046_10457891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. dw_954	1252
3300009084|Ga0105046_10503226	All Organisms → cellular organisms → Bacteria → Proteobacteria	1164
3300009084|Ga0105046_10550434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter glycinis	1087
3300009084|Ga0105046_10641743	Not Available	965
3300009084|Ga0105046_10661949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	942
3300009084|Ga0105046_10678101	Not Available	925
3300009084|Ga0105046_10788458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas	823
3300009084|Ga0105046_10792108	Not Available	820
3300009084|Ga0105046_10851916	All Organisms → cellular organisms → Bacteria	774
3300009084|Ga0105046_10858935	Not Available	770
3300009084|Ga0105046_10935547	All Organisms → cellular organisms → Bacteria	720
3300009084|Ga0105046_10939030	Not Available	718
3300009084|Ga0105046_10956269	Not Available	708
3300009084|Ga0105046_10978548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Oceanospirillum → Oceanospirillum multiglobuliferum	696
3300009084|Ga0105046_11016686	Not Available	676
3300009084|Ga0105046_11022680	All Organisms → cellular organisms → Bacteria	673
3300009084|Ga0105046_11041159	Not Available	664
3300009084|Ga0105046_11073919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	648
3300009084|Ga0105046_11504904	Not Available	505
3300009183|Ga0114974_10184309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1285
3300009686|Ga0123338_10102243	All Organisms → cellular organisms → Bacteria	1477
3300010158|Ga0114960_10409320	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	662
3300012044|Ga0136636_10062084	All Organisms → cellular organisms → Bacteria	1842
3300012044|Ga0136636_10075328	Not Available	1640
3300012044|Ga0136636_10138060	All Organisms → cellular organisms → Bacteria → Proteobacteria	1133
3300012044|Ga0136636_10172641	Not Available	987
3300012044|Ga0136636_10194500	All Organisms → cellular organisms → Bacteria → Proteobacteria	917
3300012044|Ga0136636_10245317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp.	793
3300012044|Ga0136636_10347080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga	639
3300012044|Ga0136636_10431148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella lactea	560
3300012044|Ga0136636_10451149	Not Available	544
3300013097|Ga0136639_10337135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus	590
3300013286|Ga0136641_1107568	Not Available	772
3300013286|Ga0136641_1134082	All Organisms → cellular organisms → Bacteria	675
3300015360|Ga0163144_10109570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4318
3300015360|Ga0163144_10320250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1948
3300015360|Ga0163144_10467007	All Organisms → cellular organisms → Bacteria	1453
3300015360|Ga0163144_10512152	Not Available	1351
3300015360|Ga0163144_10524449	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	1326
3300015360|Ga0163144_10591293	All Organisms → cellular organisms → Bacteria → Proteobacteria	1206
3300015360|Ga0163144_10642297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1130
3300015360|Ga0163144_11222387	Not Available	688
3300015360|Ga0163144_11462408	Not Available	603
3300015360|Ga0163144_11685559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → Methylomonas paludis	544
3300020180|Ga0163155_10328155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	704
3300020180|Ga0163155_10493606	Not Available	519
3300020192|Ga0163147_10453477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	621
3300020201|Ga0163154_10162573	All Organisms → cellular organisms → Bacteria	1230
3300020201|Ga0163154_10164438	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium AAP51	1219
3300020203|Ga0163148_10285586	Not Available	859
3300020203|Ga0163148_10306558	All Organisms → cellular organisms → Bacteria → Proteobacteria	814
3300020219|Ga0163146_10183291	All Organisms → cellular organisms → Bacteria	1339
3300020596|Ga0163149_10430592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	686
3300022561|Ga0212090_10338813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1134
3300025147|Ga0209511_1111578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1112
3300027823|Ga0209490_10381518	Not Available	824
3300027823|Ga0209490_10489698	All Organisms → cellular organisms → Bacteria	679
3300027823|Ga0209490_10506913	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	661
3300027850|Ga0209591_10490458	Not Available	811
3300027850|Ga0209591_10585575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. RAC08	704
3300027850|Ga0209591_10692894	Not Available	613
3300027850|Ga0209591_10697775	Not Available	610
3300027850|Ga0209591_10836574	All Organisms → cellular organisms → Bacteria	523
3300027878|Ga0209181_10133353	All Organisms → cellular organisms → Bacteria → Proteobacteria	2352
3300027878|Ga0209181_10210684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → unclassified Janthinobacterium → Janthinobacterium sp. TND4EL3	1737
3300027878|Ga0209181_10222265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → Rugamonas rubra	1675
3300027878|Ga0209181_10253810	All Organisms → cellular organisms → Bacteria → Proteobacteria	1529
3300027878|Ga0209181_10260199	All Organisms → cellular organisms → Bacteria → Proteobacteria	1503
3300027878|Ga0209181_10265534	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira kmetyi	1482
3300027878|Ga0209181_10278567	Not Available	1433
3300027878|Ga0209181_10333495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Pseudoduganella → Pseudoduganella rivuli	1262
3300027878|Ga0209181_10398049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → Variovorax terrae	1110
3300027878|Ga0209181_10531972	Not Available	895
3300027878|Ga0209181_10540563	Not Available	884
3300027878|Ga0209181_10678575	Not Available	741
3300027878|Ga0209181_10735282	All Organisms → cellular organisms → Bacteria → Proteobacteria	695
3300032420|Ga0335397_10106925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas thiooxydans	2867
3300032420|Ga0335397_10149249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB4	2309
3300032420|Ga0335397_10289254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1465
3300032420|Ga0335397_10309636	All Organisms → cellular organisms → Bacteria	1395
3300032420|Ga0335397_10343961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Paraglaciecola → Paraglaciecola hydrolytica	1292
3300032420|Ga0335397_10379483	All Organisms → cellular organisms → Bacteria → Proteobacteria	1202
3300032420|Ga0335397_10392289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp.	1172
3300032420|Ga0335397_10438695	All Organisms → cellular organisms → Bacteria → Proteobacteria	1078
3300032420|Ga0335397_10549952	Not Available	905
3300032420|Ga0335397_10629648	Not Available	813
3300032420|Ga0335397_10677922	Not Available	766
3300032420|Ga0335397_10833655	Not Available	648
3300032420|Ga0335397_10852767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	636
3300032420|Ga0335397_10941660	Not Available	586
3300032431|Ga0335395_10087180	All Organisms → cellular organisms → Bacteria	2217
3300032431|Ga0335395_10135424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → unclassified Comamonas → Comamonas sp. B-9	1764
3300032431|Ga0335395_10217355	All Organisms → cellular organisms → Bacteria	1352
3300032431|Ga0335395_10251152	All Organisms → cellular organisms → Bacteria	1239
3300032431|Ga0335395_10330931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. CG_9.11	1042
3300032431|Ga0335395_10350813	All Organisms → cellular organisms → Bacteria → Proteobacteria	1003
3300032431|Ga0335395_10635675	All Organisms → cellular organisms → Bacteria → Proteobacteria	657
3300032431|Ga0335395_10712337	Not Available	602
3300032431|Ga0335395_10893029	All Organisms → cellular organisms → Bacteria → Proteobacteria	503
3300032456|Ga0335394_10249727	All Organisms → cellular organisms → Bacteria → Proteobacteria	1651
3300032456|Ga0335394_10335967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1338
3300032456|Ga0335394_10337320	Not Available	1334
3300032456|Ga0335394_10470045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1041
3300032456|Ga0335394_10471058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. TS-CS-82	1040
3300032456|Ga0335394_10483249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1019
3300032456|Ga0335394_10618173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	838
3300032456|Ga0335394_10720328	All Organisms → cellular organisms → Bacteria	740
3300032456|Ga0335394_10872858	All Organisms → cellular organisms → Bacteria	632

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.62%
Engineered	Engineered	0.38%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.62%
Wastewater	Engineered → Wastewater	0.38%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	99.62%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.38%

Type

Habitat	Taxonomy	Distribution
Ice	Environmental → Aquatic → Freshwater → Ice	89.43%
Lake	Environmental → Aquatic → Freshwater → Lake	9.06%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.13%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	0.38%

Subtype

Habitat	Taxonomy	Distribution
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	84.53%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	9.06%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	3.77%
Glacier	Environmental → Aquatic → Freshwater → Ice → Glacier	1.13%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.75%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.38%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	0.38%

Habitat

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	84.53%
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	7.17%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	3.77%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.13%
Glacier Valley	Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley	1.13%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment	0.75%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.75%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.38%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	0.38%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental
3300005487	Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment	Environmental
3300005639	Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Combined assembly reannotation Gp0050987, Gp0050988, Gp0050989, Gp0050990, Gp0050991	Environmental
3300005982	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA	Engineered
3300007517	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly)	Environmental
3300007521	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01	Environmental
3300007799	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06	Environmental
3300009032	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05	Environmental
3300009083	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)	Environmental
3300009084	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)	Environmental
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental
3300009686	Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG	Environmental
3300010158	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG	Environmental
3300012044	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06)	Environmental
3300013097	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06)	Environmental
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental
3300015360	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1	Environmental
3300019093	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43	Environmental
3300020180	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1	Environmental
3300020192	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1	Environmental
3300020201	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1	Environmental
3300020203	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2	Environmental
3300020219	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1	Environmental
3300020596	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1	Environmental
3300022561	Borup_combined assembly	Environmental
3300025147	Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG (SPAdes)	Environmental
3300027823	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes)	Environmental
3300027850	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes)	Environmental
3300027878	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes)	Environmental
3300032420	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)	Environmental
3300032431	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (spades assembly)	Environmental
3300032456	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly)	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J40625_1004511102	3300002835	Freshwater	VLPNPSLKLSANGMSRWPSSAWPAAHFALAVQRAMPLSPA*
Ga0074211_1016701	3300005487	Sediment	MPNPSFKPSPNSVARQPSSAGPAAHFALAVQRATLSVPAYLER
Ga0077110_10154222	3300005639	Sediment	MPNPSFKLSPNSVARQSSSAGASPHFALAAQRATPLVPA*
Ga0075156_102667981	3300005982	Wastewater Effluent	VLPNPSLKLSPNGVAHWPSSARASPHFALAVQRATPLV
Ga0105045_100852323	3300007517	Freshwater	SLKRSANGMSRRPASAGPAAHFALAVQRAMPSSPA*
Ga0105045_101138761	3300007517	Freshwater	PSLKRSANGMSRWPSSAGPAAHFALAVQRAKPSSPA*
Ga0105045_101246481	3300007517	Freshwater	ALPNPSLKLSTNGVAHWPPGAGASPHFAPAVQRAKPLAPA*
Ga0105045_101843631	3300007517	Freshwater	VTPNPSLKRSANGMSHWPSSAGPSAHFALSVQRAM
Ga0105045_102978103	3300007517	Freshwater	PRAVTPNPSLKRSTNGVARWPSSAGPSAHFALAVQHATPLAPA*
Ga0105045_103467101	3300007517	Freshwater	FKPSPNSVARRPSSAGPAAHFALAVRRTTLSVPA*
Ga0105045_103528552	3300007517	Freshwater	SLKRSANGMARWPSSAGASPHFALDGQRAMPSSPA*
Ga0105045_103536751	3300007517	Freshwater	VTPNPSLKRSANGMSRWPSSAGPPAHFALAVQRAMPS
Ga0105045_103564162	3300007517	Freshwater	MRMKPNPALTRSANGMSRLPSSAGPAADFALAAQRAMPPSPAYLER*
Ga0105045_103837881	3300007517	Freshwater	LAGFSGALTPNPSLKRSANGMSRWPSSAGPAAHFTLAVQRVLPLSPA*
Ga0105045_103914371	3300007517	Freshwater	LKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105045_104154371	3300007517	Freshwater	MSTRTVTPNPSLKRSANGMARWPSSAGPAAHFALAVQRAMPLSPA
Ga0105045_104206941	3300007517	Freshwater	SLKRSANGMARWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105045_104276122	3300007517	Freshwater	SLKLSPNGVARWPSSAGPSAHSALAVQRATPSVPA*
Ga0105045_104386101	3300007517	Freshwater	SLKRSPNGVAHWPSSAGPAAHFALAVQRATPSVPA*
Ga0105045_104426021	3300007517	Freshwater	MPNPSLKRSANGMSRWSSSAGPAAHFALAVQRAMPS
Ga0105045_104843591	3300007517	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105045_105019811	3300007517	Freshwater	LKRRANGMSRWPSSAGPLAHFALAVQRATPSVPA*
Ga0105045_105178752	3300007517	Freshwater	SLKRSANGMARWPSSAGPAAHFALAVQRAMPWSPA*
Ga0105045_105191332	3300007517	Freshwater	SLKRSPNGMAHWPSSAEPSAHFALAVQRATPSVPA*
Ga0105045_105445171	3300007517	Freshwater	VLPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATP
Ga0105045_105507781	3300007517	Freshwater	MVTAEVTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA
Ga0105045_105841981	3300007517	Freshwater	LRAVKPNPSLKRSANGMARWPSSAGPAGHFALAAQRAMPLAPA*
Ga0105045_105984781	3300007517	Freshwater	MPNPSLKRSANGMSRWPSSAGPAAHFALSAQRAMP
Ga0105045_106328432	3300007517	Freshwater	LKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA*
Ga0105045_106785631	3300007517	Freshwater	VMPNPSLKRSTNGVAHWPSSAGPSAHFALAVQHATPLVPA*
Ga0105045_107217411	3300007517	Freshwater	MYAETAATPNPSLKRSANGMSRWPSSAGPTAHFALAVQRAMPSSPA
Ga0105045_107298322	3300007517	Freshwater	MLLLLQATPNHSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA
Ga0105045_107653292	3300007517	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRATPLSPA*
Ga0105045_108112691	3300007517	Freshwater	ARNMAAKEVTPKPSFKRSANGMAHWPSSAGPAAHFALAVQRAMPLAPA*
Ga0105045_108134672	3300007517	Freshwater	PNPSLKRSANGMARWPSSAGPAAHFALAVQRATPSSPA*
Ga0105045_108488921	3300007517	Freshwater	MRPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPSSPA
Ga0105045_108974141	3300007517	Freshwater	SLKRSANGMAHWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105045_109046212	3300007517	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRAMPSVPA*
Ga0105045_109920491	3300007517	Freshwater	MATPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMP
Ga0105044_101859951	3300007521	Freshwater	LKRSDNGMAHWPSSAGPSAHFALAVQRAMPSPPA*
Ga0105044_102318841	3300007521	Freshwater	MAAKEVTPNPSFKRSDNGMAHWPLSAGPAAHFALAVQRATPLSPA*
Ga0105044_102426402	3300007521	Freshwater	SLKRSDNGMSRWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105044_104142541	3300007521	Freshwater	MLCSSAGTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAT
Ga0105044_105986701	3300007521	Freshwater	MTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA
Ga0105044_106443911	3300007521	Freshwater	MPNPSLKLSANGMAHWPSGAGPAAHFAPAVQRATP
Ga0105044_106747751	3300007521	Freshwater	MPNPSLKRSANGMSRWSSSAGPSAHFALAVQRATPLSP
Ga0105044_106842432	3300007521	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA*
Ga0105044_106874062	3300007521	Freshwater	AVGSAMPNTSLKLSANGVAHWPSGAGPAVQCTTPLSPA*
Ga0105044_107332772	3300007521	Freshwater	MPNPSLKRSDNGMSRWPSSAGPSAHFALAVQRDMPLS
Ga0105044_107341931	3300007521	Freshwater	MRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRDMP
Ga0105044_109205211	3300007521	Freshwater	MPNPSLKRSANGMSHWPSSAGPSAHFALAVQRAMP
Ga0105044_109872321	3300007521	Freshwater	LKRSANGMARWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105044_112723841	3300007521	Freshwater	PNPSLKRSANGMARWPSSAGPAAHFALAVQRAMP*
Ga0105049_101728551	3300007799	Freshwater	PSLKRSANGMSRWPSSAGPLAHFALAVQRATLLSPA*
Ga0105049_101754681	3300007799	Freshwater	PSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105049_103001481	3300007799	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRALPLSPA*
Ga0105049_103088601	3300007799	Freshwater	ARNMAAKEVTPNPSFKRSANGMAHWPSSAGPAAHFALAVQRPTPSSPA*
Ga0105049_104899681	3300007799	Freshwater	VTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPS
Ga0105049_106340451	3300007799	Freshwater	MKPNPALTRSANGMSRLPSSAGPAADFALAAQRAMPPSPAYLER*
Ga0105049_107759241	3300007799	Freshwater	SLKRSANGMARWPSSAGPAAHFALAVQRAMPSSPA*
Ga0105049_108808502	3300007799	Freshwater	MHNVVLPNPSLKRSANGMSRWPSSAGPAAHFALAVQRA
Ga0105049_109725841	3300007799	Freshwater	QECAPKVLPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPLSPA*
Ga0105049_110055131	3300007799	Freshwater	LKRSANGMSRWPSSAGPAAHFALAVQRVLPLSPA*
Ga0105049_110111832	3300007799	Freshwater	MPNPSLKRSANGMALRPSSAGPAAHFALAAQRAMP
Ga0105048_101499371	3300009032	Freshwater	SFKRSANGMAHWPSSAGPSAHFALAVQRATPSSTA*
Ga0105048_101605395	3300009032	Freshwater	MMPNPSLKRSANGMSRWPSSAGPAAHFALAGQRAMPLS
Ga0105048_101661783	3300009032	Freshwater	FKRSANGMAHWPSSAGPSAHFALAVQRATPSSTA*
Ga0105048_102205564	3300009032	Freshwater	SLKRSANGMSRWPSSAGPAAHFAPAVQRAMPLSPA*
Ga0105048_102413541	3300009032	Freshwater	VSKNEFASLLSPATPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA
Ga0105048_102730381	3300009032	Freshwater	FKRSANGMAHWPSSAGPAAHFALAVQRATPSSPA*
Ga0105048_102941271	3300009032	Freshwater	PSLKRSANGRPRWPSSAGPAAHFALAVQRALPLSPA*
Ga0105048_103650991	3300009032	Freshwater	MMPNPSLKRGADGMSRWPSSAGPAAHFALAGQRAMPLSPA*
Ga0105048_103895171	3300009032	Freshwater	MTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA
Ga0105048_103902413	3300009032	Freshwater	LKLSTNGVSRWPSGAGPAAHFAPAVQRATPLAPA*
Ga0105048_103972603	3300009032	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA*
Ga0105048_104465132	3300009032	Freshwater	MCSNGNRRALTPNPALKWGANGMSRWPSSAGPAAHFALAAQRAMP
Ga0105048_104502161	3300009032	Freshwater	LKRSANGMSHWPSSAGPAAHFALAGQRDMPSSPA*
Ga0105048_104930784	3300009032	Freshwater	SLKRSANGMARWPSSAGPAAHFALAVQRATPSSPA*
Ga0105048_105085062	3300009032	Freshwater	SLKRSANGMSRWPSSAGASPHFALAAQRATPSSPA*
Ga0105048_105464412	3300009032	Freshwater	SLKRSANGMPRWPSSAGPAAHFALAVQRAMPSSPA*
Ga0105048_105694511	3300009032	Freshwater	EWCPVGPNPSLKRSANGMSRWPSSAGPSAHFALAVQRATPLVPA*
Ga0105048_106544761	3300009032	Freshwater	VRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPS
Ga0105048_106642261	3300009032	Freshwater	SLKRSANGMSRWPSSAGPVAHFALAVQRAMPSSPA*
Ga0105048_106656951	3300009032	Freshwater	LKLSANGMAHWPSGAGPAAHFAPAVQRATPLAPA*
Ga0105048_106722232	3300009032	Freshwater	WQVLPNPSLKRSANGMAHWPASAGPAAHFALAVQRAMPSSPA*
Ga0105048_106848932	3300009032	Freshwater	LKRSANGMSHWPSSAGPSAHFALAVQRAMPPSPA*
Ga0105048_107361121	3300009032	Freshwater	AAVRPNTSLKLSANGVSRWPSSAGPSAHFALAVQRDTPLAPA*
Ga0105048_107404651	3300009032	Freshwater	LKRSANGMARWPSSAGPAAHFALAVQRAMPLAPA*
Ga0105048_107681741	3300009032	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRATPLAPA*
Ga0105048_107690802	3300009032	Freshwater	MITTSPATPNRSLKRSANGMAHRPSSAGPAADFALAAQRAMPPSPAYLER*
Ga0105048_108078961	3300009032	Freshwater	VTPNPSLKRSANGMSRWPSSAGPSAHFALAAQRAMP
Ga0105048_108202582	3300009032	Freshwater	SFKPSPNGVPRWPASAGPAAHFALAVQRGTPSVPA*
Ga0105048_108372741	3300009032	Freshwater	VTPNTSLKRSANGMSRWPSSAGPAAHFALAVQRAMP
Ga0105048_109164102	3300009032	Freshwater	PNTSLKLSANGMSRWPSGAGPAAHFAPAVQRATPLAPA*
Ga0105048_110649262	3300009032	Freshwater	MVTPEVTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA
Ga0105048_110749071	3300009032	Freshwater	GFGAAMPNTSLKLSANGVAHWPSGAGPAAHFAPAVQCATPSSPA*
Ga0105048_110753302	3300009032	Freshwater	RQERSHFGLPPAPPNPSPKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105048_110903641	3300009032	Freshwater	MPNPSLKRSANGMSRWSSSAGPAAHFALAVQRAMPLSPA
Ga0105048_111077592	3300009032	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAAQRATPLSPA*
Ga0105048_113347321	3300009032	Freshwater	MPNPSLKRRANGMSRWPSSAGPAAHFALAVQRAMPSS
Ga0105048_113513261	3300009032	Freshwater	MVSFIQVRAVRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPS
Ga0105048_114763572	3300009032	Freshwater	SLKRSANGMARWPSNAGASPHFALAVQRAMPLSHA*
Ga0105048_114771901	3300009032	Freshwater	MRAAPPNPSLKRSANGMAHWPSSAGPAAHFALAVQCAMP
Ga0105047_100309818	3300009083	Freshwater	LFSSDIAAPPAQPNPSLKRSANGMSRWPSSAGPAAHFALAVQRDMPSSP
Ga0105047_101177201	3300009083	Freshwater	MPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA*
Ga0105047_101420121	3300009083	Freshwater	LKRSANGMSHWPSSAGPAAHFALAVQRAMPSSPA*
Ga0105047_101493251	3300009083	Freshwater	FKRSANGVAHWPSSAGPAAHFALAVQRATPSPPA*
Ga0105047_101787641	3300009083	Freshwater	MPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA
Ga0105047_101978571	3300009083	Freshwater	MITIQVATPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPSSPA*
Ga0105047_102151663	3300009083	Freshwater	SLKLSANGVSRWPSSAGPSAHFALAVQRATPLAPA*
Ga0105047_102211623	3300009083	Freshwater	LKRSDNGMARWAVSAGPSAHFALTAQRAMPLSPA*
Ga0105047_102515973	3300009083	Freshwater	SLKRSANGMAHWPSSAGPAAHFALAVQRAMPSSPA*
Ga0105047_102853121	3300009083	Freshwater	SLKRSANGMSHWPSSAGPAAHFALAVQRAMPSSPA*
Ga0105047_102932891	3300009083	Freshwater	SLKRSANGMSRWPSSAGPSAHFALAVQRATPLVPA*
Ga0105047_103219344	3300009083	Freshwater	LGAQRPNPSLKRSANGVARWPSSAGPAAHFALAVQRATPSSPA*
Ga0105047_103345953	3300009083	Freshwater	LKRSANGMARWPSSAGPAAHFALAVQRATPSSPA*
Ga0105047_103356234	3300009083	Freshwater	EAMPNTSLKLSANGMAHWPSGAGPAAHFAPAVQRAPPPSPA*
Ga0105047_103364301	3300009083	Freshwater	SLKRSTNGVPHWPSSAGPAAHFALAVQRATPLVPA*
Ga0105047_103693782	3300009083	Freshwater	MPNPSLKRSANGMSRWPSSAGPAAHFALVVQRAMPS
Ga0105047_104092241	3300009083	Freshwater	MTPNPSLKRSDNGMSRWPSSAGPAAHFALAVQRAMPLS
Ga0105047_104176713	3300009083	Freshwater	FKPSPNSVARRPSSAGPAAYFALAVRRATLSVPA*
Ga0105047_104309772	3300009083	Freshwater	MQKIGKAGTRTLMPNPSLKRSANGMARWPSSAGASPHFALDGQRAMPSSPA*
Ga0105047_104443061	3300009083	Freshwater	MSQPTALTPNPSLKRSDNGMSRWPPSARPAAHFALAVQRAMPLSPA*
Ga0105047_104770393	3300009083	Freshwater	MSLSAVTPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPLAPA
Ga0105047_104927443	3300009083	Freshwater	SLKRSANGMSRWPSSAGPAAHFALDGQRAMPSSPA*
Ga0105047_105457152	3300009083	Freshwater	SLKRSANGMSRWPSSAGPSAHFALAVQRATPLAPA*
Ga0105047_105457441	3300009083	Freshwater	SNNAVLPNPSLKRSANGMSRWPSSAGPAAHFALAVHRAVPSPPA*
Ga0105047_105965781	3300009083	Freshwater	MTPNPSLKRSANGMSRWPSSAGPSAHFALAAQRAMPL
Ga0105047_106792461	3300009083	Freshwater	MPNPSLKRSANGMARWPSSAGPAAHFALAVQRAMPLAPA
Ga0105047_106941982	3300009083	Freshwater	AARRAAVGSAMPNTSLKLSANGVAHWPSGAGPAAHFAPAVQRATPLAPA*
Ga0105047_107026222	3300009083	Freshwater	NPSFKPSPNSVAPRPSSAGPAAHFALAVQRATLSVPA*
Ga0105047_107081891	3300009083	Freshwater	SLKRSANGMALWPSSAGPAAHFALAVQRAMLLSPA*
Ga0105047_107097502	3300009083	Freshwater	AGFSGALTPNPSLKRSANGMSRWPSSAGPSAHYALAVQRALPSPPA*
Ga0105047_107315042	3300009083	Freshwater	SLKLSANGVAHWPSGAGPAAHFAPAVQRATPLAPA*
Ga0105047_107909001	3300009083	Freshwater	LKRSANGMSRWPSSAGPSAHFALAVQRATPLSPA*
Ga0105047_108002401	3300009083	Freshwater	VKPNPSLKRSANGMSRWPSSAGPAAHFAPAVQRAMP
Ga0105047_108608051	3300009083	Freshwater	MPNPSFKRSANGMAHWPSSAGPAAHFALAVQRAMPSSPA
Ga0105047_108895723	3300009083	Freshwater	FSAARRAAVGHAMPNTSLKLSTNGMSRWPSSAGPAAHFALAVRRATLSVPA*
Ga0105047_108900872	3300009083	Freshwater	MQPNPSLKRSANGRPRRPSSAGPAAHFALAVQRVL
Ga0105047_109068921	3300009083	Freshwater	AVGEAMPNTSLKLSANGMAHWPSGAGPAAHFAPAVQRATPSSPA*
Ga0105047_112074872	3300009083	Freshwater	SLKLSTNGVSRWPSGAGPAAHFAPAVQRATPLAPA*
Ga0105047_113164442	3300009083	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQHAMPLAPA*
Ga0105047_113826642	3300009083	Freshwater	LKRSANGMSRWPSSAGPAAHFALAVQRAMPLAPA*
Ga0105047_113863711	3300009083	Freshwater	SIDVPQVKPNPSLKRSANGMSRWPSSAGPAPHFALAVQRGKPSSPA*
Ga0105047_114617242	3300009083	Freshwater	MASALPQVRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPS
Ga0105047_115048072	3300009083	Freshwater	SLKLSTNGMSRWPSSAGPSAHCALAVQRATPLAPA*
Ga0105046_102078034	3300009084	Freshwater	SLKLSANGMAHWPSGAGPAAHFAPAVQCATPLAPA*
Ga0105046_103004231	3300009084	Freshwater	SLKRSANGMSHRPSSAGPAAHFALAVQRAMPLAPA*
Ga0105046_103082392	3300009084	Freshwater	EAVMPNPSLKRSTNGVAHWPSSAGPSAHFALAVQRSLPLSPA*
Ga0105046_103196991	3300009084	Freshwater	MPNPSLKRSANGMSRWSSSAGPAAHFALAVQRAMPSS
Ga0105046_103284801	3300009084	Freshwater	MAVTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA
Ga0105046_103324671	3300009084	Freshwater	MPNPSLKRSANGMSRRPASAGPAAHFALAVQRAMP
Ga0105046_103427611	3300009084	Freshwater	LTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPL
Ga0105046_104578911	3300009084	Freshwater	PNPSLKRSANGMSRWPSSAGPAAHFALDGQRAMPSSPA*
Ga0105046_105032261	3300009084	Freshwater	RHGELMPNPSLKRSANGMSHWPSSAGPSAHFALAVQRAMP*
Ga0105046_105122533	3300009084	Freshwater	AAMPNTSLKLRANGVAHWPSGAGPAAHFAPAVQCTTPLSPA*
Ga0105046_105504342	3300009084	Freshwater	LVSAVKPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPAYLER*
Ga0105046_106417432	3300009084	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAAQRAMPSAPA*
Ga0105046_106619491	3300009084	Freshwater	MNVAALLPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAIP
Ga0105046_106781011	3300009084	Freshwater	MATPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPL
Ga0105046_107884581	3300009084	Freshwater	LKRSDNGMAHWPSSAGPAAHFALAVQRAMPSSPA*
Ga0105046_107921081	3300009084	Freshwater	QTAAFCIAVTPNPSLKRRANGMSRWPSSAGPAAHFALAVQRATPLVPA*
Ga0105046_108519161	3300009084	Freshwater	LKRSANGMSRWPSNAGPAAHFALAVQRALPLSPA*
Ga0105046_108589351	3300009084	Freshwater	MITTSPATPNRSLKRSANGMAHRPSSAGPAADYALAAQRAMPPSPAYLER*
Ga0105046_109355471	3300009084	Freshwater	VEEGPRAMVTAEVTPNPSLKRSANGMSRWPSSAGPAAHFAHAVHRAKPSVPA*
Ga0105046_109390301	3300009084	Freshwater	MMPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPL
Ga0105046_109562691	3300009084	Freshwater	MRPNTSLKLSANGVSRWPSSAGPSAHFALAVQRATPLA
Ga0105046_109785481	3300009084	Freshwater	MATAVTATPNPSLKRSTNGMPRWPSSAGPAAHFALVVQ
Ga0105046_110166861	3300009084	Freshwater	NPSLKRSANGMARWPSSAGPAAHFALAVQRATPS*
Ga0105046_110226803	3300009084	Freshwater	NPSLKRSANGMSRRPSSAGPAAHFALAVQRATPSVPA*
Ga0105046_110411591	3300009084	Freshwater	MPNPSLKRSDDGMSRWPSSAGPAAHFALAVQRAMP
Ga0105046_110739192	3300009084	Freshwater	NPSLKRSANGMSRWPSSAGPAAHFALAVQRAKPSPPA*
Ga0105046_111798351	3300009084	Freshwater	EAMPNTSLKLSANGMAHWPSGAGPAAHFAPAVQCATPLAPA*
Ga0105046_115049041	3300009084	Freshwater	MTPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPSS
Ga0114974_101843091	3300009183	Freshwater Lake	NPSLKLSANGVPRWPSSAGPAAYFALAVQRVTPLAPT*
Ga0123338_101022431	3300009686	Glacier Valley	VSKALPNPSFKPSPNGVARWSSSAGPAAHVALAAQHATPSVPA*
Ga0114960_104093201	3300010158	Freshwater Lake	KLTPNPSLKLSANGASRWSSGAGPAAHFAPATQRATPLAPA*
Ga0136636_100620844	3300012044	Polar Desert Sand	PPPPVKPNPSLKRSANGMSRWPSSAGPAAHIALAVQRAMPSSPA*
Ga0136636_100753281	3300012044	Polar Desert Sand	SLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPD*
Ga0136636_101380601	3300012044	Polar Desert Sand	VTPNPSLKRSANGMSRWPSSAGPAAHFALAAQRAMP
Ga0136636_101726411	3300012044	Polar Desert Sand	MRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAM
Ga0136636_101945001	3300012044	Polar Desert Sand	MRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMP
Ga0136636_102453171	3300012044	Polar Desert Sand	PNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA*
Ga0136636_103470801	3300012044	Polar Desert Sand	MASALPKARPNPSLKRSANGMSRWPSSAGPAAHFALAVQR
Ga0136636_104311481	3300012044	Polar Desert Sand	MYAETAATPNPSLKRSANGMSRWPSSAGPTAHFAL
Ga0136636_104511491	3300012044	Polar Desert Sand	MIRKLMPNPSLKRSANGMSRWPSSAGPAAHFALAVQRALP
Ga0136639_103371351	3300013097	Polar Desert Sand	SLKRSDDGMSRQPSSAGPAAHFALAVQRAMPLSPA*
Ga0136641_11075683	3300013286	Freshwater	SLKLSTNGVSRWSLGAGPAAHFAPSAQRATPLAPA*
Ga0136641_11340822	3300013286	Freshwater	MSISREMPPNPSLKLSTNGVSRWSLGAGPAAHFAPSAQRATPLAPA*
Ga0163144_101095706	3300015360	Freshwater Microbial Mat	RAVLPNPSLKRSANGMARWPSSAGPAAHFALAVQSAMPSSPA*
Ga0163144_103202504	3300015360	Freshwater Microbial Mat	SLKRSANGMSHWPSSAGPSAHFALAVQRAMPPSPA*
Ga0163144_104670074	3300015360	Freshwater Microbial Mat	SFKRSANGMAHWPSSAGPAAHFALAVQRATPSPPA*
Ga0163144_105121521	3300015360	Freshwater Microbial Mat	LKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA*
Ga0163144_105244492	3300015360	Freshwater Microbial Mat	SLKRSANGMSRWPSSAGPAAHFALSVQRATPSSPA*
Ga0163144_105912931	3300015360	Freshwater Microbial Mat	SLKLSPNGVAHWSSSAGASPHFALAAQRATPLGPA*
Ga0163144_106422971	3300015360	Freshwater Microbial Mat	MTPNPSLKRSANGMSRWPSSAGPAAHFALVVQRAMPSSP
Ga0163144_112223871	3300015360	Freshwater Microbial Mat	LNKNSSVSAALTPNPSLKLSANGVSRRPSSAGPAAHFALAVQRATP
Ga0163144_114624081	3300015360	Freshwater Microbial Mat	LPNPSLKRSANGMARWPSSAGPAAHFALDGQRAMPLSPA*
Ga0163144_116855591	3300015360	Freshwater Microbial Mat	SLKRSANGMAHWPSSAGPSAHFALAVQRATPSSPA*
Ga0187843_104362341	3300019093	Freshwater	RRNWKASHICGQQVTPNPSLKLSPNGAAHWPSSAGPAAHFALAVQRATPFVPA
Ga0163155_103281552	3300020180	Freshwater Microbial Mat	MRPNPSLKRSANGMSRWPSSAGPSAHFALAVQRAMPLALRL
Ga0163155_104936061	3300020180	Freshwater Microbial Mat	MPNPSLKRSTNGVAHWPSSAGPSAHLALAVQHATPLVLRLSEGLGIT
Ga0163147_104534771	3300020192	Freshwater Microbial Mat	MATPNPSLKLSDNGMSRWSCGAGASPHFAPPAQRATPLSPA
Ga0163154_101625731	3300020201	Freshwater Microbial Mat	AVSPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA
Ga0163154_101644381	3300020201	Freshwater Microbial Mat	MAAKEVTPNPSFKRSANGMAHWPSSAGPAAHFALAVQRATPSSPA
Ga0163148_102855861	3300020203	Freshwater Microbial Mat	VKPNPSLKRSANGMAHWPSSAGPAAHFALAVQRAMPSSPA
Ga0163148_103065582	3300020203	Freshwater Microbial Mat	MAAKEVTPNPSFKRSDNGMAHWPLSAGPAAHFALAVQRATPLSPA
Ga0163146_101832911	3300020219	Freshwater Microbial Mat	VTPNPSLKRSANGMSRWPSSAGPAAHFALAVQHATP
Ga0163149_104305922	3300020596	Freshwater Microbial Mat	MPNRSLKRSADGMAHRPSSAGPAAHFALAFQRAMPSALR
Ga0212090_103388131	3300022561	Glacier Valley	KALPNPSFKPSPNGVARWSSSAGPAAHVALAAQHATPSVPA
Ga0209511_11115782	3300025147	Glacier Valley	GVSKALPNPSFKPSPNGVARWSSSAGPAAHVALAAQHATPSVPA
Ga0209490_103815181	3300027823	Freshwater	PSFKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA
Ga0209490_104896981	3300027823	Freshwater	MVTAEVTPNPSLKRSANGMSRWPSSAGPTAHFALTVQRAMP
Ga0209490_105069131	3300027823	Freshwater	PAPPNPSLKPSANGMSRWPSSAGPAADFALAVQRATPLSPA
Ga0209591_104904581	3300027850	Freshwater	VTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMP
Ga0209591_105855752	3300027850	Freshwater	MTYWTGFAKTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSP
Ga0209591_106928941	3300027850	Freshwater	MPNPSLKRSTNGVAHWPSSAGPAAHFALAVQRATPSVPA
Ga0209591_106977751	3300027850	Freshwater	MPNPSLKRSANGMSRWPSSAGPSAHFGLSVQRATP
Ga0209591_108365741	3300027850	Freshwater	MVTAEVTPNPSLKRSANGMSRWPSSAGPTAHFALTVQRAKWA
Ga0209181_101333534	3300027878	Freshwater	TSLKLSTNGMSRWPSSAGPSAHFALAVQRATPLAPA
Ga0209181_102106841	3300027878	Freshwater	MPNPSLKRSADGMSRWPSSAGPAAHFALAVQRAMP
Ga0209181_102222651	3300027878	Freshwater	NPSLKLSPNGVARWPSSAGPAAHFALAVQRATPSVPA
Ga0209181_102538101	3300027878	Freshwater	MKPNPSLKRSANGMARWPSSAGPAAHFALAVQRAMP
Ga0209181_102601993	3300027878	Freshwater	SFKPSPNSVARRPSSAGPAAHFALAVQRATLSVPA
Ga0209181_102655341	3300027878	Freshwater	PSLKRSANGMAHWPSSAGPAAHFALAVQRAMPSSPA
Ga0209181_102785671	3300027878	Freshwater	MPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLS
Ga0209181_103334954	3300027878	Freshwater	PSLKRSANGMARWPSSAGPAAHFALAVQRATPSSPA
Ga0209181_103980491	3300027878	Freshwater	MRPNPSLKRSANGMSRWPSSAGPAAHFALAAQRAMPS
Ga0209181_105319722	3300027878	Freshwater	MIRKLMPNPSLKRSANGMSRWPSSAGPAAHFALAVQRALPSPP
Ga0209181_105405631	3300027878	Freshwater	MSSVPMRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSTA
Ga0209181_106785751	3300027878	Freshwater	MITTSPATPNRSLKRSANGMAHRPSSAGPAADFALAAQRAMPPSPAYLER
Ga0209181_107352821	3300027878	Freshwater	MTAAAERPNPSLKRSANGMSRWPSSAGPAAHFALAAQRAM
Ga0335397_101069253	3300032420	Freshwater	SLKRSDNGMSRWPSSAGPAAHFALAVQRAMPLSPA
Ga0335397_101492491	3300032420	Freshwater	VTPNPSLKRSANGMSRWPSSAGPLAHFALAVQRAMPSS
Ga0335397_102892541	3300032420	Freshwater	MIISNALTPNPSLKRSANGMSRWPSSAGPAAHFALAVQ
Ga0335397_103096363	3300032420	Freshwater	MPNPSLKRSANGMAHWPSSAGPAAHFALAVRCAMPL
Ga0335397_103439611	3300032420	Freshwater	PSLKRSANGMAHWPTSAGPVAHFALAVQRAKPLSPA
Ga0335397_103794831	3300032420	Freshwater	SLKRSTNGMSHWPSGAGPAAHFAPAVQRATPLMPA
Ga0335397_103922893	3300032420	Freshwater	PSLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA
Ga0335397_104386951	3300032420	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA
Ga0335397_105499521	3300032420	Freshwater	MQDAVELPAVPPNPSLKRSANGTSRWPSSAGPAAHFALAVQRA
Ga0335397_106296481	3300032420	Freshwater	MHAVRVLKPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSS
Ga0335397_106779221	3300032420	Freshwater	SLKRSANGMSRWPSSAGPAAHFALAVQRAMPLSPA
Ga0335397_108336551	3300032420	Freshwater	FTQFAAQLRPNPSLKRSANGMSRWPSSAGPAAYFALAVQRAMPLSPA
Ga0335397_108527671	3300032420	Freshwater	MLLLLQATPNHSLKRSANGMSRWPSSAGPAAHFALAVQRATP
Ga0335397_108623201	3300032420	Freshwater	SAARRAAVGSAMPNTSLKLSANGVAHWPSGAGPAAHFAPAVQRATPLAPA
Ga0335397_109416601	3300032420	Freshwater	MPNPSLKRSTNGVAHWPSSAGPSAHFALAVQHAPP
Ga0335395_100871801	3300032431	Freshwater	VRPNPSLKRSANGMSRWPSSAGPAAHFALAVQRATP
Ga0335395_101354241	3300032431	Freshwater	MQKIGKAGTRTLMPNPSLKRSANGMARWPSSAGASPHFALDGQRAMPSSP
Ga0335395_102173552	3300032431	Freshwater	MRMKPNPALTRSANGMSRLPSSAGPAADFALAAQRAMPPSPAYLER
Ga0335395_102511521	3300032431	Freshwater	MPNPSLKRSANGMAHWPSSAGPAAHFALAVQCAMPL
Ga0335395_103309311	3300032431	Freshwater	MVSNQAIRLRAVKPNPSLKRSANGMARWPSSAGPAAHFALAVQRA
Ga0335395_103508133	3300032431	Freshwater	LSLSPKVTPNPSLKRSANGMSHWPSSAGPAAHFALAAQRATPSSPA
Ga0335395_106356751	3300032431	Freshwater	MPNPSLKRSANGRPRWPSSAGASPHFALAVQRVLP
Ga0335395_107123371	3300032431	Freshwater	MTPNPSLKRSANGMSHWPSSAGPAAHFALAVQRAL
Ga0335395_108930292	3300032431	Freshwater	MTAAAERPNPSLKRSANGIAHWPSSAGPAAHFALAVQRAMP
Ga0335394_102497273	3300032456	Freshwater	NPSLKRSANGMSRWPSSAGPAAHFALAVQRALPLSPA
Ga0335394_103359672	3300032456	Freshwater	MQKIGKAGTRTLMPNPSLKRSANGMARWPSSAGASPHFALDGQRAMPSSPA
Ga0335394_103373202	3300032456	Freshwater	MIRKLMPNPSLKRSANGMSRWPSSAGPAAHFALAVQRALPSPPA
Ga0335394_104700451	3300032456	Freshwater	RAVGPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPSSPA
Ga0335394_104710581	3300032456	Freshwater	MPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMPL
Ga0335394_104832491	3300032456	Freshwater	MSCTSSAALRPNPSLKRSANGRPRRSSSAGPSAHFALAVQRVLPS
Ga0335394_106181731	3300032456	Freshwater	NPSLKRSANGMSRWPSSAGPAAHFALAVQRATPSSPA
Ga0335394_107203283	3300032456	Freshwater	MVTAEVTPNPSLKRSANGMSRWPSSAGPAAHFALAVQRAMP
Ga0335394_108728581	3300032456	Freshwater	MKPNHSLKRSRNGLAHWPSSAGPAAHFALAVQRATPSV