Basic Information | |
---|---|
Family ID | F013337 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 272 |
Average Sequence Length | 42 residues |
Representative Sequence | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLP |
Number of Associated Samples | 193 |
Number of Associated Scaffolds | 267 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 87.55 % |
% of genes near scaffold ends (potentially truncated) | 15.07 % |
% of genes from short scaffolds (< 2000 bps) | 83.46 % |
Associated GOLD sequencing projects | 178 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.279 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.177 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.985 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.029 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.98% β-sheet: 0.00% Coil/Unstructured: 73.02% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 267 Family Scaffolds |
---|---|---|
PF01242 | PTPS | 37.45 |
PF00330 | Aconitase | 28.84 |
PF01497 | Peripla_BP_2 | 4.87 |
PF13414 | TPR_11 | 2.62 |
PF00694 | Aconitase_C | 2.25 |
PF03703 | bPH_2 | 0.75 |
PF13181 | TPR_8 | 0.75 |
PF00515 | TPR_1 | 0.37 |
PF12867 | DinB_2 | 0.37 |
PF01103 | Omp85 | 0.37 |
PF00883 | Peptidase_M17 | 0.37 |
PF13431 | TPR_17 | 0.37 |
PF09369 | MZB | 0.37 |
PF13180 | PDZ_2 | 0.37 |
PF01738 | DLH | 0.37 |
PF13298 | LigD_N | 0.37 |
PF01546 | Peptidase_M20 | 0.37 |
PF13432 | TPR_16 | 0.37 |
PF01436 | NHL | 0.37 |
PF00206 | Lyase_1 | 0.37 |
PF02511 | Thy1 | 0.37 |
COG ID | Name | Functional Category | % Frequency in 267 Family Scaffolds |
---|---|---|---|
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 37.45 |
COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.87 |
COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.87 |
COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.87 |
COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.87 |
COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.87 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.75 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.75 |
COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 0.37 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.37 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.01 % |
Unclassified | root | N/A | 31.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459019|G14TP7Y01CEBMQ | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 580 | Open in IMG/M |
2170459021|G14TP7Y02IIC2P | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_12406837 | Not Available | 545 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101826155 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300000550|F24TB_11415437 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300000789|JGI1027J11758_12957760 | Not Available | 998 | Open in IMG/M |
3300001661|JGI12053J15887_10318331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300002908|JGI25382J43887_10001983 | All Organisms → cellular organisms → Bacteria | 8731 | Open in IMG/M |
3300003267|soilL1_10059828 | All Organisms → cellular organisms → Bacteria | 4403 | Open in IMG/M |
3300003319|soilL2_10011529 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
3300003321|soilH1_10197193 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300004101|Ga0058896_1398433 | Not Available | 636 | Open in IMG/M |
3300004139|Ga0058897_10017860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300004157|Ga0062590_101451593 | Not Available | 685 | Open in IMG/M |
3300004463|Ga0063356_100932716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
3300005166|Ga0066674_10041262 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
3300005166|Ga0066674_10076469 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300005171|Ga0066677_10122897 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300005172|Ga0066683_10051907 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
3300005174|Ga0066680_10307602 | Not Available | 1011 | Open in IMG/M |
3300005174|Ga0066680_10871317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300005176|Ga0066679_10677816 | Not Available | 670 | Open in IMG/M |
3300005177|Ga0066690_10517707 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300005178|Ga0066688_10697040 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300005180|Ga0066685_10286186 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300005180|Ga0066685_10402251 | Not Available | 951 | Open in IMG/M |
3300005186|Ga0066676_10175038 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300005187|Ga0066675_10652374 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300005332|Ga0066388_101183530 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300005332|Ga0066388_101980944 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300005332|Ga0066388_104308042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 725 | Open in IMG/M |
3300005446|Ga0066686_10407158 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300005446|Ga0066686_10408304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
3300005446|Ga0066686_10482575 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005446|Ga0066686_10482575 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005450|Ga0066682_10153543 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
3300005450|Ga0066682_10399430 | Not Available | 881 | Open in IMG/M |
3300005451|Ga0066681_10076502 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300005458|Ga0070681_11054198 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300005468|Ga0070707_100020057 | All Organisms → cellular organisms → Bacteria | 6303 | Open in IMG/M |
3300005532|Ga0070739_10377519 | Not Available | 663 | Open in IMG/M |
3300005538|Ga0070731_10037453 | All Organisms → cellular organisms → Bacteria | 3260 | Open in IMG/M |
3300005540|Ga0066697_10559794 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005553|Ga0066695_10233966 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300005556|Ga0066707_10203231 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300005558|Ga0066698_10058606 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
3300005558|Ga0066698_10115597 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
3300005558|Ga0066698_10339888 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300005559|Ga0066700_10023574 | All Organisms → cellular organisms → Bacteria | 3487 | Open in IMG/M |
3300005586|Ga0066691_10422245 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300005598|Ga0066706_10712968 | Not Available | 797 | Open in IMG/M |
3300005646|Ga0075040_1749819 | Not Available | 633 | Open in IMG/M |
3300005713|Ga0066905_100031547 | All Organisms → cellular organisms → Bacteria | 3014 | Open in IMG/M |
3300005713|Ga0066905_100047809 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
3300005713|Ga0066905_101302919 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300005764|Ga0066903_105292437 | Not Available | 682 | Open in IMG/M |
3300005937|Ga0081455_10651545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
3300006173|Ga0070716_101200959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300006423|Ga0075039_1450252 | Not Available | 538 | Open in IMG/M |
3300006797|Ga0066659_10003703 | All Organisms → cellular organisms → Bacteria | 7323 | Open in IMG/M |
3300006800|Ga0066660_10745862 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006845|Ga0075421_100006920 | All Organisms → cellular organisms → Bacteria | 13860 | Open in IMG/M |
3300006845|Ga0075421_101868905 | Not Available | 644 | Open in IMG/M |
3300006852|Ga0075433_10123939 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
3300006954|Ga0079219_11368446 | Not Available | 629 | Open in IMG/M |
3300007004|Ga0079218_12036765 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300007265|Ga0099794_10804117 | Not Available | 503 | Open in IMG/M |
3300009012|Ga0066710_100013198 | All Organisms → cellular organisms → Bacteria | 8586 | Open in IMG/M |
3300009012|Ga0066710_100023149 | All Organisms → cellular organisms → Bacteria | 6974 | Open in IMG/M |
3300009012|Ga0066710_100143072 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
3300009012|Ga0066710_100143072 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
3300009012|Ga0066710_100229934 | Not Available | 2667 | Open in IMG/M |
3300009012|Ga0066710_100502497 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
3300009012|Ga0066710_101361015 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300009012|Ga0066710_101535165 | Not Available | 1025 | Open in IMG/M |
3300009038|Ga0099829_11659737 | Not Available | 526 | Open in IMG/M |
3300009089|Ga0099828_11273962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300009094|Ga0111539_10429381 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300009137|Ga0066709_100132167 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
3300009137|Ga0066709_100132167 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
3300009137|Ga0066709_100664435 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300009137|Ga0066709_101137540 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300009137|Ga0066709_101249033 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300009137|Ga0066709_103477981 | Not Available | 571 | Open in IMG/M |
3300009137|Ga0066709_103886774 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300009143|Ga0099792_10728921 | Not Available | 644 | Open in IMG/M |
3300009147|Ga0114129_10556640 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300009147|Ga0114129_11389490 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300009156|Ga0111538_13836481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300009162|Ga0075423_11072363 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300009162|Ga0075423_11500670 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300009176|Ga0105242_11247764 | Not Available | 765 | Open in IMG/M |
3300009444|Ga0114945_10228916 | Not Available | 1084 | Open in IMG/M |
3300009444|Ga0114945_10278140 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300009444|Ga0114945_10278140 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300009553|Ga0105249_11434051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300009777|Ga0105164_10172918 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300009792|Ga0126374_10271668 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300009803|Ga0105065_1059247 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300010046|Ga0126384_10499181 | Not Available | 1049 | Open in IMG/M |
3300010046|Ga0126384_12107711 | Not Available | 541 | Open in IMG/M |
3300010047|Ga0126382_12350370 | Not Available | 516 | Open in IMG/M |
3300010086|Ga0127496_1016106 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300010133|Ga0127459_1112759 | Not Available | 500 | Open in IMG/M |
3300010140|Ga0127456_1237995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300010154|Ga0127503_10596363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300010301|Ga0134070_10315187 | Not Available | 599 | Open in IMG/M |
3300010304|Ga0134088_10164110 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300010323|Ga0134086_10238976 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300010329|Ga0134111_10193571 | Not Available | 820 | Open in IMG/M |
3300010336|Ga0134071_10474128 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300010358|Ga0126370_11361897 | Not Available | 668 | Open in IMG/M |
3300010358|Ga0126370_12180601 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300010359|Ga0126376_10754753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
3300010361|Ga0126378_12683895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300010362|Ga0126377_10435949 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300010362|Ga0126377_11206707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300010366|Ga0126379_11486268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300010366|Ga0126379_13114618 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300010398|Ga0126383_10306389 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
3300010398|Ga0126383_10609129 | Not Available | 1164 | Open in IMG/M |
3300010398|Ga0126383_11998531 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300010398|Ga0126383_12054266 | Not Available | 659 | Open in IMG/M |
3300010398|Ga0126383_12507177 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300010399|Ga0134127_13321820 | Not Available | 526 | Open in IMG/M |
3300010400|Ga0134122_10229369 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300010400|Ga0134122_11175312 | Not Available | 766 | Open in IMG/M |
3300011120|Ga0150983_11121110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300011120|Ga0150983_12971478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300011120|Ga0150983_13069217 | Not Available | 723 | Open in IMG/M |
3300011120|Ga0150983_13079678 | Not Available | 1065 | Open in IMG/M |
3300011120|Ga0150983_16713397 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300011271|Ga0137393_10996833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300012096|Ga0137389_10361383 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300012189|Ga0137388_10630471 | Not Available | 996 | Open in IMG/M |
3300012199|Ga0137383_10183957 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300012201|Ga0137365_10035838 | All Organisms → cellular organisms → Bacteria | 3798 | Open in IMG/M |
3300012201|Ga0137365_10235529 | Not Available | 1364 | Open in IMG/M |
3300012202|Ga0137363_10332885 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300012205|Ga0137362_10933525 | Not Available | 740 | Open in IMG/M |
3300012206|Ga0137380_10470291 | Not Available | 1110 | Open in IMG/M |
3300012209|Ga0137379_10197850 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
3300012210|Ga0137378_10004677 | All Organisms → cellular organisms → Bacteria | 11807 | Open in IMG/M |
3300012211|Ga0137377_10613585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
3300012212|Ga0150985_100667890 | Not Available | 532 | Open in IMG/M |
3300012212|Ga0150985_102871312 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300012212|Ga0150985_113222182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
3300012212|Ga0150985_119215978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300012349|Ga0137387_10160655 | Not Available | 1604 | Open in IMG/M |
3300012351|Ga0137386_10180000 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
3300012359|Ga0137385_11282263 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300012390|Ga0134054_1204279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300012390|Ga0134054_1247549 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012405|Ga0134041_1276396 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012469|Ga0150984_100020869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300012469|Ga0150984_101282970 | Not Available | 729 | Open in IMG/M |
3300012469|Ga0150984_119868420 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300012685|Ga0137397_10000048 | All Organisms → cellular organisms → Bacteria | 71173 | Open in IMG/M |
3300012922|Ga0137394_10038830 | All Organisms → cellular organisms → Bacteria | 3898 | Open in IMG/M |
3300012922|Ga0137394_11294248 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012923|Ga0137359_11402315 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300012925|Ga0137419_10987979 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300012948|Ga0126375_10790913 | Not Available | 750 | Open in IMG/M |
3300012948|Ga0126375_11690956 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012961|Ga0164302_11621212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300012971|Ga0126369_12699461 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300012972|Ga0134077_10148763 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300014150|Ga0134081_10027282 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300014157|Ga0134078_10019057 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300014326|Ga0157380_11382076 | Not Available | 754 | Open in IMG/M |
3300014501|Ga0182024_10213349 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
3300014501|Ga0182024_11668979 | Not Available | 719 | Open in IMG/M |
3300015371|Ga0132258_10058616 | All Organisms → cellular organisms → Bacteria | 8856 | Open in IMG/M |
3300015371|Ga0132258_10695063 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
3300015371|Ga0132258_10990009 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
3300015371|Ga0132258_13351976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1101 | Open in IMG/M |
3300015371|Ga0132258_13773094 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300015371|Ga0132258_13926198 | Not Available | 1010 | Open in IMG/M |
3300015374|Ga0132255_100558649 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300016357|Ga0182032_10551109 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300017656|Ga0134112_10067756 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300017656|Ga0134112_10157337 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300017659|Ga0134083_10270778 | Not Available | 715 | Open in IMG/M |
3300017970|Ga0187783_10368001 | Not Available | 1046 | Open in IMG/M |
3300017975|Ga0187782_10739442 | Not Available | 759 | Open in IMG/M |
3300017994|Ga0187822_10158391 | Not Available | 732 | Open in IMG/M |
3300018063|Ga0184637_10119529 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300018071|Ga0184618_10491691 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300018072|Ga0184635_10225584 | Not Available | 745 | Open in IMG/M |
3300018082|Ga0184639_10224803 | Not Available | 994 | Open in IMG/M |
3300018083|Ga0184628_10073434 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
3300018431|Ga0066655_10044011 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
3300018431|Ga0066655_10307437 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300018433|Ga0066667_10304304 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300018433|Ga0066667_11411240 | Not Available | 612 | Open in IMG/M |
3300018468|Ga0066662_10052232 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
3300018468|Ga0066662_10554056 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300018468|Ga0066662_10757356 | Not Available | 936 | Open in IMG/M |
3300018482|Ga0066669_10108131 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
3300018482|Ga0066669_10270768 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300018482|Ga0066669_11044949 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300019248|Ga0180117_1137040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300019258|Ga0181504_1140076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300019360|Ga0187894_10115934 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
3300019458|Ga0187892_10046618 | All Organisms → cellular organisms → Bacteria | 3073 | Open in IMG/M |
3300020067|Ga0180109_1499844 | Not Available | 506 | Open in IMG/M |
3300020067|Ga0180109_1499844 | Not Available | 506 | Open in IMG/M |
3300020170|Ga0179594_10251089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300020579|Ga0210407_10350893 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300021168|Ga0210406_10676246 | Not Available | 798 | Open in IMG/M |
3300021951|Ga0222624_1131734 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300022195|Ga0222625_1472679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300022510|Ga0242652_1025451 | Not Available | 657 | Open in IMG/M |
3300022525|Ga0242656_1057202 | Not Available | 689 | Open in IMG/M |
3300022531|Ga0242660_1060682 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300022531|Ga0242660_1085873 | Not Available | 749 | Open in IMG/M |
3300022533|Ga0242662_10105943 | Not Available | 807 | Open in IMG/M |
3300022533|Ga0242662_10114036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300022563|Ga0212128_10861281 | Not Available | 536 | Open in IMG/M |
3300022724|Ga0242665_10230849 | Not Available | 622 | Open in IMG/M |
3300022726|Ga0242654_10155310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
3300022726|Ga0242654_10386627 | Not Available | 534 | Open in IMG/M |
3300025174|Ga0209324_10804663 | Not Available | 520 | Open in IMG/M |
3300025311|Ga0209343_10362934 | Not Available | 968 | Open in IMG/M |
3300025311|Ga0209343_10566712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300025912|Ga0207707_10492982 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300025922|Ga0207646_10010039 | All Organisms → cellular organisms → Bacteria | 9290 | Open in IMG/M |
3300025922|Ga0207646_10386040 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300025961|Ga0207712_11691437 | Not Available | 567 | Open in IMG/M |
3300026296|Ga0209235_1078663 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300026324|Ga0209470_1002592 | All Organisms → cellular organisms → Bacteria | 12748 | Open in IMG/M |
3300026327|Ga0209266_1090549 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300026327|Ga0209266_1100436 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
3300026343|Ga0209159_1180023 | Not Available | 747 | Open in IMG/M |
3300026528|Ga0209378_1009974 | All Organisms → cellular organisms → Bacteria | 5799 | Open in IMG/M |
3300026529|Ga0209806_1310495 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300026537|Ga0209157_1005714 | All Organisms → cellular organisms → Bacteria | 9058 | Open in IMG/M |
3300026537|Ga0209157_1163911 | Not Available | 984 | Open in IMG/M |
3300026538|Ga0209056_10685010 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300026547|Ga0209156_10272367 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300027669|Ga0208981_1155256 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300027869|Ga0209579_10115744 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
3300027874|Ga0209465_10028126 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
3300027903|Ga0209488_10203544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
3300027903|Ga0209488_10819169 | Not Available | 658 | Open in IMG/M |
3300027909|Ga0209382_11431478 | Not Available | 693 | Open in IMG/M |
3300028380|Ga0268265_12523455 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300030990|Ga0308178_1156331 | Not Available | 528 | Open in IMG/M |
3300031057|Ga0170834_100738921 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300031446|Ga0170820_13710017 | Not Available | 708 | Open in IMG/M |
3300031716|Ga0310813_11957183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300031740|Ga0307468_102207132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300031820|Ga0307473_10321716 | All Organisms → cellular organisms → Archaea | 983 | Open in IMG/M |
3300031854|Ga0310904_11315469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300031890|Ga0306925_11617525 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300031947|Ga0310909_10935173 | Not Available | 711 | Open in IMG/M |
3300031954|Ga0306926_11075358 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300031965|Ga0326597_10876389 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300032180|Ga0307471_100220193 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300032180|Ga0307471_104049677 | Not Available | 518 | Open in IMG/M |
3300032261|Ga0306920_101141725 | Not Available | 1128 | Open in IMG/M |
3300033433|Ga0326726_10902209 | Not Available | 857 | Open in IMG/M |
3300034661|Ga0314782_051585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
3300034663|Ga0314784_140963 | Not Available | 538 | Open in IMG/M |
3300034665|Ga0314787_101563 | Not Available | 535 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.18% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.40% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.35% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.41% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.57% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.84% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.84% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.47% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.10% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.10% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.10% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.10% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.74% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.74% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.74% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.37% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.37% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.37% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.37% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.37% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.37% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.37% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.37% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.37% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006423 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4MG_01834260 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MEPMNKEGLELEITIEELESKIAPDGGETVLPLPIPKGKKH |
4NP_00187750 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MKDPLTTKEGLELEIQIEELEAKIAPDGGETVLPLGGGHHR |
ICChiseqgaiiFebDRAFT_124068371 | 3300000363 | Soil | MNPINKQEAFELEIQIEELEPKIAPDGGETVLPLPIPHGKGKGH* |
INPhiseqgaiiFebDRAFT_1018261552 | 3300000364 | Soil | MEPMNKEGLELEITIEELESKIAPDGGETVLPLPIPKGKKH* |
F24TB_114154372 | 3300000550 | Soil | MSPMTNKEGFEFEIQIEELEPKVAADGGETVLPL* |
JGI1027J11758_129577603 | 3300000789 | Soil | MEPMNKEGLELEITSEELESKIAPDGGETVLPLPIPKGKKH* |
JGI12053J15887_103183312 | 3300001661 | Forest Soil | MNPLTKKEGFELALQIEELEAKIAPGGGETVLPLPLDFTKKR* |
JGI25382J43887_100019832 | 3300002908 | Grasslands Soil | MTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR* |
soilL1_100598282 | 3300003267 | Sugarcane Root And Bulk Soil | MNPILQEGLELEIQIEELESKIAPDGGETVLPLKLWFGQH* |
soilL2_100115294 | 3300003319 | Sugarcane Root And Bulk Soil | MNPITKEGFELEIQIEELEAKVAPDGGETVLPLPLQGKKH* |
soilH1_101971932 | 3300003321 | Sugarcane Root And Bulk Soil | MNPMTKNEGLELEIQIEELESKIAPDGGETVLPLIGNPGKGHHH* |
Ga0058896_13984332 | 3300004101 | Forest Soil | MNKTTTKEMILEIQIEELEAKVAPDGGETVLPLPVHGKH* |
Ga0058897_100178601 | 3300004139 | Forest Soil | RHEVNRMDPIKLKEGFELELELIEELEAKIAPDGGETVLPLPGPRGHH* |
Ga0062590_1014515931 | 3300004157 | Soil | MEPMNTEGLELEISIEELELKIAPDGGETVLPLPCGKGKGKH* |
Ga0063356_1009327164 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNPVTREGFELEIQIEELESKVAPDGGETVLPLGGGGKGKH* |
Ga0066674_100412625 | 3300005166 | Soil | MIPVTEKEGIELEIQIEELEAKIAPDGGETVLPLPLDNHHHKH* |
Ga0066674_100764693 | 3300005166 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQGHGHR* |
Ga0066677_101228971 | 3300005171 | Soil | MDPMTKKEGFELEINIEELEAKIAPDGGETVLPLPIPCGKKH* |
Ga0066683_100519075 | 3300005172 | Soil | MIPVTEKEGIELEIQIEELEAKIAPDGGETVLPLPLGNHHHKH* |
Ga0066680_103076022 | 3300005174 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR* |
Ga0066680_108713172 | 3300005174 | Soil | MKPTTKKEGVEVEIQIEELEAKVAPDGGETVLPLPLGGLIRR* |
Ga0066679_106778162 | 3300005176 | Soil | MNPMTKIEGFELEIQIEELEAKIAPMMDGGETVLPLPWPGIKH* |
Ga0066690_105177071 | 3300005177 | Soil | MDPMTKKEGLELEIAIEELEAKIAPDGGETVLPLPIPCGKKH* |
Ga0066688_106970402 | 3300005178 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLALPCHGHGHR* |
Ga0066685_102861863 | 3300005180 | Soil | MDPMNKEGIELEITIEELESKIAPDGGETVLPLPIPHGKKH* |
Ga0066685_104022511 | 3300005180 | Soil | MIPVNEKEGLELEIQIEELEAKIAPDGGECVIPLPLPPRKH* |
Ga0066676_101750382 | 3300005186 | Soil | MTPVNEKEGFELEIQIEELEAKIAPDGGETVLPLPLPHPRKH* |
Ga0066675_106523741 | 3300005187 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLALPCQGHGHR* |
Ga0066388_1011835303 | 3300005332 | Tropical Forest Soil | MDPMIKKEGVEVEIKIEELESKIAPGETVLPLPKSHGHR* |
Ga0066388_1019809442 | 3300005332 | Tropical Forest Soil | MEPIKKEGIELEISIEELESKIAPDGGETVLPLAHGKKH* |
Ga0066388_1043080422 | 3300005332 | Tropical Forest Soil | YRMEPITEKEDFNLNLQNIEELEAKIAPDGGETVLPLPWGGGRH* |
Ga0066686_104071582 | 3300005446 | Soil | MNPMTKKEGIELEIQIEELEAKIAPDGGETVLPLPFFSIRKH* |
Ga0066686_104083042 | 3300005446 | Soil | MHPMNIKEGFELEIQIEELEAKVAPDGGETVLPLPKVHGKG* |
Ga0066686_104825752 | 3300005446 | Soil | MNPTKNNEGVELEILIEELEAKIAPDGGETVLPLTPGGLGA* |
Ga0066686_104825753 | 3300005446 | Soil | MNPMTTQEGLELEIQIEELEPKIAPDGGETVLPLTHPPGHKH* |
Ga0066682_101535432 | 3300005450 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQHGHGHH* |
Ga0066682_103994303 | 3300005450 | Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLSMPHGHH* |
Ga0066681_100765022 | 3300005451 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGHR* |
Ga0070681_110541981 | 3300005458 | Corn Rhizosphere | MTPMTKREGFELEISIEELEPKVAPDGGETVLPLPTGHGHNK* |
Ga0070707_1000200572 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPMTKKEGFELEINIEELEAKIAPDGGETVLPLPISSGKKH* |
Ga0070739_103775193 | 3300005532 | Surface Soil | MKPMTTKEGIEIEIQIEELEAKIAPDGGETVLPLGGGHGKK* |
Ga0070731_100374532 | 3300005538 | Surface Soil | MKPIASKEGIELEILIEELEAKIAPDGGETVLPLGGGHGKK* |
Ga0066697_105597942 | 3300005540 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPC |
Ga0066695_102339661 | 3300005553 | Soil | MIPVNEKEGLELEIQIEELEAKIAPDGGECVIPLPLPPR |
Ga0066707_102032312 | 3300005556 | Soil | MNPMTKIEGFELEIQIEELEPKIAPLLDGGETVLPLPFGGIRH* |
Ga0066698_100586064 | 3300005558 | Soil | MNPMTTKEGLELEIQIEELEAKIAPDGGETVLPLPLFGIRKR* |
Ga0066698_101155973 | 3300005558 | Soil | MNPAKSNEGVELEILIEELEAKIAPDGGETVLPLTPGGLGA* |
Ga0066698_103398882 | 3300005558 | Soil | MIPVNEKEGLELEIQIEELEAKIAPDGGETVLPLPLPHPRKH* |
Ga0066700_100235744 | 3300005559 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPRHGHH* |
Ga0066691_104222451 | 3300005586 | Soil | MNPMTTKEGIELEIQIEELEAKVAPDGGETVLPLPLC |
Ga0066706_107129682 | 3300005598 | Soil | MEPMNKEGIELEITIEELESKIAPDGGETVLPLPTAHGKKH* |
Ga0075040_17498192 | 3300005646 | Permafrost Soil | MKPFNTKKTFELDIQIEELEPKVAPDGGETVLPLPTGHHR* |
Ga0066905_1000315475 | 3300005713 | Tropical Forest Soil | MSPMTNKEGFELEIEIEELEPKVAADGGETVLPL* |
Ga0066905_1000478094 | 3300005713 | Tropical Forest Soil | MSPMTNKEGFELEIQIEELEPKVAADGGETVLPL* |
Ga0066905_1013029191 | 3300005713 | Tropical Forest Soil | MSPMTNKEGFELDIQIEELEPKVAADGGETVLPL* |
Ga0066903_1052924371 | 3300005764 | Tropical Forest Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPLDGHGHGHH* |
Ga0081455_106515452 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNPVKKEGFELEIQIEELESKVAPDGGETVLPLPYPGPRR* |
Ga0070716_1012009592 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPMMIKEGFELEIQIEELEAKIAPDGGETVLPLGGHGHRHH* |
Ga0075039_14502522 | 3300006423 | Permafrost Soil | SLKIKEGIELDLQIEELESKIAPDGGETVLPLSLPIGTGHGHHRP* |
Ga0066665_108816052 | 3300006796 | Soil | SAARSTFHKNSFGGKRMNPMTTKEGIELEIQIEELEAKIAPDGGETVLALPCHGHGHR* |
Ga0066659_100037037 | 3300006797 | Soil | MNPMTTKEGIELEIQIEELEAKVAPDGGETVLPLPLCGIRKH* |
Ga0066660_107458622 | 3300006800 | Soil | MNPMTKNEGFELDIQIEELEPKIAPLMDGGETVLPLPWGGIRH* |
Ga0075421_10000692014 | 3300006845 | Populus Rhizosphere | MNPSNEGFELEINIEELESKIAPDGGETVLPLGPVRPGH* |
Ga0075421_1018689051 | 3300006845 | Populus Rhizosphere | MNAINKQEALELEIQIEELEPKIAPDGGETVLPLPIPHGKGKGH* |
Ga0075433_101239392 | 3300006852 | Populus Rhizosphere | MEPMIKEGIELEITIEELESKIAPDGGETVLPLPIPKGKKH* |
Ga0079219_113684462 | 3300006954 | Agricultural Soil | MRPTTGKEGIELEIHIEELEAKVAPDGGETVLPLPSHHHKH* |
Ga0079218_120367653 | 3300007004 | Agricultural Soil | MIPMTKKEGFELEIQIEELEAKIAADGGETVLPLHFLRPGTEL* |
Ga0099794_108041171 | 3300007265 | Vadose Zone Soil | MNPLTKKEGFELALQIEELEAKIAPGGGETVLPLPLDCTKKR* |
Ga0066710_1000131985 | 3300009012 | Grasslands Soil | MIPVNEKEGLELEIQIEELEAKIAPDGGETVLPLPLPHPRKH |
Ga0066710_1000231494 | 3300009012 | Grasslands Soil | MDPMNKEGIELEITIEELESKIAPDGGETVLPLPIPHGKKH |
Ga0066710_1001430723 | 3300009012 | Grasslands Soil | MNPTKHNEGLELEILIEELEAKIAPDGGETVLPLTPGGLGA |
Ga0066710_1001430724 | 3300009012 | Grasslands Soil | MNPMTTQEGLELEIQIEELEPKIAPDGGETVLPLTHAPGHKH |
Ga0066710_1002299342 | 3300009012 | Grasslands Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLSMPHGHH |
Ga0066710_1005024973 | 3300009012 | Grasslands Soil | MEPMNTEGIELEINIEELESKIAPDGGETVLPLVPHGHHKH |
Ga0066710_1013610152 | 3300009012 | Grasslands Soil | MIPVTEKEGIELEIQIEELEAKIAPDGGETVLALPIPGHQKKH |
Ga0066710_1015351652 | 3300009012 | Grasslands Soil | MDPKTTKEGIELEIQIEELEAKIVPDGGETVLPLPLHGIRKR |
Ga0099829_116597372 | 3300009038 | Vadose Zone Soil | MKPTTSKEGIELEIQIEELEAKVAPDGGETVLPLPGGHGKH* |
Ga0099828_112739622 | 3300009089 | Vadose Zone Soil | MKPMTSKEGIELEIQIEELESKVAPDGGETVLPLGGGHGKH* |
Ga0111539_104293812 | 3300009094 | Populus Rhizosphere | MNPVTREGFELEIQIEELESKVAPDGGETVLPLGPIKGKH* |
Ga0066709_1001321673 | 3300009137 | Grasslands Soil | MNPMTTQEGLELEIQIEELEPKIAPDGGETVLPLTHAPGHKH* |
Ga0066709_1001321674 | 3300009137 | Grasslands Soil | MNPTKHNEGLELEILIEELEAKIAPDGGETVLPLTPGGLGA* |
Ga0066709_1006644353 | 3300009137 | Grasslands Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLS |
Ga0066709_1011375402 | 3300009137 | Grasslands Soil | MNPMTDKEGFDLEIQIEELEAKIAPDGGETVLPLPIPTGKKH* |
Ga0066709_1012490331 | 3300009137 | Grasslands Soil | MEPMNKEGIELEINIEELESKIAPDGGETVLPLVPHGKKG* |
Ga0066709_1034779811 | 3300009137 | Grasslands Soil | KKEGIDLEIQVEELEAKIAPDGGETVLPLPLPIRKR* |
Ga0066709_1038867743 | 3300009137 | Grasslands Soil | MDPKTTKEGIELEIQIEELEAKIAPDGGETVLPLPLHGIR |
Ga0099792_107289211 | 3300009143 | Vadose Zone Soil | KEGFELALQIEELEAKIAPGGGETVLPLPLDFTKKR* |
Ga0114129_105566402 | 3300009147 | Populus Rhizosphere | MDTTKNEGFELDIQIEELEQKIAPDGGETVLPLSLPKHGKH* |
Ga0114129_113894902 | 3300009147 | Populus Rhizosphere | MNPMTKKEGVELEIRIEELEAKIAPCEELLVALPLPPIRKH* |
Ga0111538_138364812 | 3300009156 | Populus Rhizosphere | MNPVTREGFELEIQIEELESKVAPDGGETVLPLGPVKGKH* |
Ga0075423_110723632 | 3300009162 | Populus Rhizosphere | MNPTNKEGFELEIQIEELEAKVAPDGGETVLPLPLPGKKH* |
Ga0075423_115006703 | 3300009162 | Populus Rhizosphere | MDPMTKKEGFELEINIEELEAKIAPDGGETVLPLPIPSGKRH* |
Ga0105242_112477641 | 3300009176 | Miscanthus Rhizosphere | MEPFKKEGIELEISIEELESKIAPDGGETVLPLVPKGKKH* |
Ga0114945_102289162 | 3300009444 | Thermal Springs | MDSKLKSETLTLEIEVEELEAKIAPDGGETVLPLPKPPRGGR* |
Ga0114945_102781401 | 3300009444 | Thermal Springs | MDPMIKKEGTELEIQIEELEARLAPDGGETVLPLSAGGPSGGPRPRPGRP* |
Ga0114945_102781402 | 3300009444 | Thermal Springs | MDPMIKNEGFELEIQIEELEAKIAPDGGETVLPLPKPGGGRGGR* |
Ga0105249_114340511 | 3300009553 | Switchgrass Rhizosphere | TEGLELEISIEELELKIAPDGGETVLPLPCGKGKGKH* |
Ga0105164_101729182 | 3300009777 | Wastewater | MEPITKKEGLELENSIEELESKIAPDGGETVLGLGHLPKKPGH* |
Ga0126374_102716683 | 3300009792 | Tropical Forest Soil | MNPVKKEGFELEIQIEELESKVAPDGGETVLPLPGPPPRR* |
Ga0105065_10592472 | 3300009803 | Groundwater Sand | MNHVKSEGFEFEIQIEELESKVAPDGGETVLPLPLPGPRR* |
Ga0126384_104991811 | 3300010046 | Tropical Forest Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPLNGHCHGHH* |
Ga0126384_121077111 | 3300010046 | Tropical Forest Soil | HKEGYQMSPMTNKEGFELEIQIEELEPKVAADGGETVLPL* |
Ga0126382_123503702 | 3300010047 | Tropical Forest Soil | MNPITTKEGIELEIQIEELEAKVAPDGGETVLPLPFSGNRR* |
Ga0127496_10161062 | 3300010086 | Grasslands Soil | MNPMTQKEGIELEIQIEELEAKIAPDGGETVLPLPFFSIRKH* |
Ga0127459_11127591 | 3300010133 | Grasslands Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCNGHGHGNH* |
Ga0127456_12379952 | 3300010140 | Grasslands Soil | MNPMTKKEGFELALQIEELEAKIAPGGGETVLPLPLDLTRKR* |
Ga0127503_105963632 | 3300010154 | Soil | MNPMINKEGFELEIQIEELEAKIAPDGGETVLPLAHGHGHH* |
Ga0134070_103151872 | 3300010301 | Grasslands Soil | PVTEKEGIELEIQIEELEAKIAPDGGETVLPLPLGNHHHKH* |
Ga0134088_101641101 | 3300010304 | Grasslands Soil | SFGGKRMNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR* |
Ga0134086_102389761 | 3300010323 | Grasslands Soil | MIPVTEKEGIELEIQIEELEAKIAPDGGETVLPLP |
Ga0134111_101935712 | 3300010329 | Grasslands Soil | MIPVTEKEGIELEIQIEELEAKIAPDGGETVLPLPLGNNHHKH* |
Ga0134071_104237932 | 3300010336 | Grasslands Soil | SAARSTFHKNSFGGKRMNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR* |
Ga0134071_104741282 | 3300010336 | Grasslands Soil | MIPVNEKEGFELEIQIEELEAKIAPDGGETVLPLPLPHPRKH |
Ga0126370_113618971 | 3300010358 | Tropical Forest Soil | MNPMMNKEGLEKSIELEIQIEELEAKVAPDGGETVLPLPTGNGHGHGHGHG* |
Ga0126370_121806012 | 3300010358 | Tropical Forest Soil | MTPTTNKEGIELEIQIEELEAKLAPSQGESVLALGFGHYSR* |
Ga0126376_107547533 | 3300010359 | Tropical Forest Soil | MINQEGFELEIQIEELEAKIAPDGGETVLPLGSGHGHK* |
Ga0126378_126838951 | 3300010361 | Tropical Forest Soil | MHPMMKNEGFELEIQIEELEAKVAPDGGETVLPLPLSFTRPHHR* |
Ga0126377_104359492 | 3300010362 | Tropical Forest Soil | MNPMTNKEGFELEIQIEELEPKVAADGGETVLPL* |
Ga0126377_112067072 | 3300010362 | Tropical Forest Soil | MDPMTKKEGVEVESKIEELESKIAPGETVLPLPSSHGGHGHCH* |
Ga0126379_114862682 | 3300010366 | Tropical Forest Soil | MNPMTSKEGFELEIQIEELEAKVAPDGGETVLPLGHGKGHGH* |
Ga0126379_131146182 | 3300010366 | Tropical Forest Soil | MNPVTNNEGFELEIQIEELEPKVAADGGETVLPL* |
Ga0126383_103063892 | 3300010398 | Tropical Forest Soil | MINQEGFELEIQIEELEAKTAPDGGETVLPLSAVNGHHIKL* |
Ga0126383_106091293 | 3300010398 | Tropical Forest Soil | MNPMTSKEGFELEIQIEELEAKIAPDGGETVLPLGKGHGHH* |
Ga0126383_119985311 | 3300010398 | Tropical Forest Soil | MDPNSIKEGFEQELLQIEELEAKIAPDGGETVLPIGSGSGSGSSTGHGHH* |
Ga0126383_120542662 | 3300010398 | Tropical Forest Soil | MNPMTNKEGLELEIQIEELEAKVAPDGGETVLPLPLTGKHGHKG* |
Ga0126383_125071772 | 3300010398 | Tropical Forest Soil | MNPNVHTTEGFDLEIQIEELEAKIAPDGGETVLPLSTGHGGHRPK* |
Ga0134127_133218201 | 3300010399 | Terrestrial Soil | NPMTIKEGFELEIAIEELEAKVAPDGGETVLPLPLKHHKKH* |
Ga0134122_102293692 | 3300010400 | Terrestrial Soil | MMNPVNHKEGFDLEISIEELEAKIAPDGGETVLPLQLTHGKK* |
Ga0134122_111753121 | 3300010400 | Terrestrial Soil | MNPMTDKDGFELEIQIEELEAKIAPDGGETVLPLPIPTGKKH* |
Ga0150983_111211103 | 3300011120 | Forest Soil | RVTRMDSLKIKEGIELDLQIEELEAKIAPDGGETVLPLSLPIGHGHHPRP* |
Ga0150983_129714782 | 3300011120 | Forest Soil | MDPKTYLTNFDLEIQIEELEAKIAPDGGETVLPLPTGGHHH* |
Ga0150983_130692172 | 3300011120 | Forest Soil | MNPIKVKEGFETELQLIEELEAKIAPDGGETVLPLPFSGSHR* |
Ga0150983_130796781 | 3300011120 | Forest Soil | MKPINTKETFELEIQIEELERKVAPDGGETVLPLPTGHHR* |
Ga0150983_167133972 | 3300011120 | Forest Soil | MKPMTNNEGIELEIQIEELEAKIAPDGGETVLPLPTGHHKR* |
Ga0137393_109968333 | 3300011271 | Vadose Zone Soil | MNPMTKIEGFELEIEIEELEAKNAPDGGETTLPLPLGGFHR* |
Ga0137389_103613832 | 3300012096 | Vadose Zone Soil | MKPTTSKEGIELEIQIEELEAKIAPDGGETTLPLPTGFHHH* |
Ga0137388_106304713 | 3300012189 | Vadose Zone Soil | MKPATSKEGIELEIQIEELEAKVAPDGGETVLPLPKTHGKG* |
Ga0137383_101839573 | 3300012199 | Vadose Zone Soil | MTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQGHGHR* |
Ga0137365_100358382 | 3300012201 | Vadose Zone Soil | MTTKEGIELEIQIEELEAKIAPDGGETVLALPCHGHGHR* |
Ga0137365_102355292 | 3300012201 | Vadose Zone Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLSMPHGHQI* |
Ga0137363_103328852 | 3300012202 | Vadose Zone Soil | MNPITKNEGFELEIQIEELEAKIAPLLDGGETVLPLPWGGIRH* |
Ga0137362_109335251 | 3300012205 | Vadose Zone Soil | RMNPITKNEGFELEIQIEELEAKIAPLLDGGETVLPLPWGGIRH* |
Ga0137380_104357181 | 3300012206 | Vadose Zone Soil | HKNSFGGKRMNPMTTKEGIELEIQIEELEAKIAPDGGETVLALPCHGHGHR* |
Ga0137380_104702911 | 3300012206 | Vadose Zone Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLSMPHGHQR* |
Ga0137379_101978504 | 3300012209 | Vadose Zone Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLSMPHGHQV* |
Ga0137378_100046776 | 3300012210 | Vadose Zone Soil | MIPVTEKEGIELEIQIEELEAKIAPDGGETVLPLPLGNHNHKH* |
Ga0137377_106135852 | 3300012211 | Vadose Zone Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLSTPHGHH* |
Ga0137377_114089631 | 3300012211 | Vadose Zone Soil | HKNSFGGKRMNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQGHGHR* |
Ga0150985_1006678902 | 3300012212 | Avena Fatua Rhizosphere | MDPKMNKEGFELDIQIEELESKIAPDGETVLPLPKLHGHCK* |
Ga0150985_1028713122 | 3300012212 | Avena Fatua Rhizosphere | MEPMNKEGLELEISIEELESKIAPDGGETVLPLPIPKGKKH* |
Ga0150985_1132221821 | 3300012212 | Avena Fatua Rhizosphere | MNPMTDKEGFELEIQIEELEAKIAPDGGETVLPLPVVGKHGHHK* |
Ga0150985_1192159782 | 3300012212 | Avena Fatua Rhizosphere | MNPKMNKEGFEELEIQIEELEAKIAPDGGETVLPLPTGHGKHH* |
Ga0137387_101606553 | 3300012349 | Vadose Zone Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLQMPHGHHG* |
Ga0137386_101800002 | 3300012351 | Vadose Zone Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPFCGNNGKHHH* |
Ga0137385_112822631 | 3300012359 | Vadose Zone Soil | MNPMTTKEGLELDIQIEELEAKIAPDGGETVLPLSIPHGHQR* |
Ga0137360_108323351 | 3300012361 | Vadose Zone Soil | VLQGGTRMNPMTKNEGFELEIQIEELEAKIAPLMDGGETVLPLPWGGIRH* |
Ga0134054_12042792 | 3300012390 | Grasslands Soil | MNPLTKKEGFELALQIEELEAKIAPGGGETVLPLPLDLTRKR* |
Ga0134054_12475492 | 3300012390 | Grasslands Soil | MTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQGHGHAMPRAS* |
Ga0134041_12763963 | 3300012405 | Grasslands Soil | MDPMTKKEGFEIEINIEELEAKIAPDGGETVLPLPIPSGKKH* |
Ga0150984_1000208692 | 3300012469 | Avena Fatua Rhizosphere | MDPKMNKEGFELDIQIEELEAKIAPDGETVLPLPRIKGH* |
Ga0150984_1012829703 | 3300012469 | Avena Fatua Rhizosphere | KKEELKNMISKEGFELEIQIEELEQKVAPDGGETVLPLPLPTGRGH* |
Ga0150984_1198684201 | 3300012469 | Avena Fatua Rhizosphere | MNPKMNKEGFEELEIHIEELEAKIAPDGGETVLPLPTGHGKHH* |
Ga0137358_104149891 | 3300012582 | Vadose Zone Soil | RIATPRTLVGILQGGTRMNPMTKNEGFELEIQIEELEAKNAPNMDGGETVLPLPWGGIRH |
Ga0137397_1000004857 | 3300012685 | Vadose Zone Soil | MNPLTKKEGFELALQIEELEAKIAPSGGETVLPLPLDFTKKR* |
Ga0137394_100388304 | 3300012922 | Vadose Zone Soil | MNPMTKIEGFELEIQIEELEAKIAPMMDGGETVLPLPWGAIRH* |
Ga0137394_112942481 | 3300012922 | Vadose Zone Soil | MNPMTKNEGFELEIQIEELEAKIAPLMDGGETVLPLPWGGIRH* |
Ga0137359_114023151 | 3300012923 | Vadose Zone Soil | MKPMTSKEGLELEIQIEELEAKIAPDGGETVLPLPTGHGKH* |
Ga0137419_109879791 | 3300012925 | Vadose Zone Soil | MNPMTKNEGFELEIQIEELEAKNAPNMDGGETVLPLPWGGIRH* |
Ga0126375_107909131 | 3300012948 | Tropical Forest Soil | MNAKNQQEALELEIQIEELEPKVAPDGGETVLPLPFSGNRR* |
Ga0126375_116909562 | 3300012948 | Tropical Forest Soil | MDANANTEGLELEIQIEELEPKIAPDGGETVLPL* |
Ga0164302_116212122 | 3300012961 | Soil | MNPMMSKEGLELEIQIEELEAKIAPDGGETVLPLSTGHGHKH* |
Ga0126369_126994612 | 3300012971 | Tropical Forest Soil | MNPNSNTEGFHLEIQIEELEAKIAPDGGETVLPLTVPKGHGGHR* |
Ga0134077_101487632 | 3300012972 | Grasslands Soil | MTPVNEKEGFELEIQIEELEAKIAPDGGETVLPLPLPPNPRKCH* |
Ga0134081_100272821 | 3300014150 | Grasslands Soil | MTTKEGIELEIQIEELEAKIAPDGGETVLALPCQGHGHG* |
Ga0134075_101337831 | 3300014154 | Grasslands Soil | HKNSFGGKRMNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR* |
Ga0134078_100190574 | 3300014157 | Grasslands Soil | MTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGHR* |
Ga0157380_113820761 | 3300014326 | Switchgrass Rhizosphere | SMDAMTKTNEGLELEIQIEELEPKIAPDGGETVLPL* |
Ga0182024_102133493 | 3300014501 | Permafrost | MDPKTLTNLDLEIQIEELEAKIAPDGGENVLPLSIGVTPHHHHG* |
Ga0182024_116689791 | 3300014501 | Permafrost | MDPKTYQANLELEIQIEELEAKIAPDGGENVLPLPVKPHHH* |
Ga0132258_100586167 | 3300015371 | Arabidopsis Rhizosphere | MNPTISKEGIELEIHIEELEAKIAPDGGETVLPLGGRGGSTR* |
Ga0132258_106950634 | 3300015371 | Arabidopsis Rhizosphere | MEPIIKEGLELEITIEELESKIAPDGGETVLPLPIPKGKKH* |
Ga0132258_109900092 | 3300015371 | Arabidopsis Rhizosphere | MYPLTNKEGIELEIQIEELESKIAPDGGETVLPLPTGHGHKH* |
Ga0132258_133519762 | 3300015371 | Arabidopsis Rhizosphere | MNPMINPEGFDLEIQIEELEPKVAPDGGETVLPLSTGHGHKH* |
Ga0132258_137730942 | 3300015371 | Arabidopsis Rhizosphere | MNPTTKEGFELEIQIEELEAKVAPDGGETVLPLPLPGKKH* |
Ga0132258_139261983 | 3300015371 | Arabidopsis Rhizosphere | MDPITNKEGLELDIQIEELEAKIAPDGGETVLPLPLPKGKKH* |
Ga0132255_1005586492 | 3300015374 | Arabidopsis Rhizosphere | MYPLTNKEGIELEIQIEELESKIAPDGGETVLPLPTGHGHH* |
Ga0182032_105511093 | 3300016357 | Soil | MNPMTNKEGFELEIQIEELEPKVAPDGGETVLPLGDGGHHHGHH |
Ga0134112_100677562 | 3300017656 | Grasslands Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQGHGHGPR |
Ga0134112_101573372 | 3300017656 | Grasslands Soil | MTPVNEKEGFELEIQIEELEAKIAPDGGETVLPLPLPPNPRKCH |
Ga0134083_102707781 | 3300017659 | Grasslands Soil | TKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR |
Ga0187783_103680012 | 3300017970 | Tropical Peatland | MKPNVTKHAFELEIQIEELEAKVAPDGGETVLSLPIPIVHHR |
Ga0187782_107394422 | 3300017975 | Tropical Peatland | MKPSVTKHAFELEIQIEELEAKVAPDGGETVLSLPIPIVHHR |
Ga0187822_101583911 | 3300017994 | Freshwater Sediment | MNPMINKEGFELEIQIEELEAKIAPDGGETVLPLGTGHGHGHK |
Ga0184637_101195291 | 3300018063 | Groundwater Sediment | MEPITKKEGLELEISIEELESKIAPDGGETVLPLPLPKKGKH |
Ga0184618_104916911 | 3300018071 | Groundwater Sediment | MNPMTDKEGFELEIQIEELEAKIAPDGGETVLPLPIPTGKKH |
Ga0184635_102255841 | 3300018072 | Groundwater Sediment | MNPLTIAVIVELEIQIEELVVKVAPDGGETVLPLT |
Ga0184639_102248033 | 3300018082 | Groundwater Sediment | MEPITKKEGFELEISIEELESKIAPDGGETVLPLPLPKKGKH |
Ga0184628_100734342 | 3300018083 | Groundwater Sediment | MEPMNKEGIALEISIEELESKIAPDGGETVLPLPLAKGKKH |
Ga0066655_100440112 | 3300018431 | Grasslands Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQHGHGHH |
Ga0066655_103074372 | 3300018431 | Grasslands Soil | MIPVTEKEGIELEIQIEELEAKIAPDGGETVLPLPLGNHHHKH |
Ga0066667_103043041 | 3300018433 | Grasslands Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGHR |
Ga0066667_114112401 | 3300018433 | Grasslands Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPRHGHH |
Ga0066662_100522322 | 3300018468 | Grasslands Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR |
Ga0066662_105540562 | 3300018468 | Grasslands Soil | MNPLTKKEGFELALQIEELEAKIAPGGGETVLPLPLDLTKKR |
Ga0066662_107573561 | 3300018468 | Grasslands Soil | MNPMTKIEGFELEIQIEELEPKIAPLLDGGETVLPLPFGGIRH |
Ga0066669_101081314 | 3300018482 | Grasslands Soil | TKEGIELEIQIEELEAKIAPDGGETVLPLPCQGHGHR |
Ga0066669_102707681 | 3300018482 | Grasslands Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQGHGHR |
Ga0066669_110449491 | 3300018482 | Grasslands Soil | MNIPSKEGLELEIQIEELEAKVAPDGGETVLPLPLPAPKKH |
Ga0180117_11370402 | 3300019248 | Groundwater Sediment | MNPVKKEGFELEIQIEELEPKVAPDGGETVLPLPAPRPGR |
Ga0181504_11400761 | 3300019258 | Peatland | MDPKTFETNLDLEIQIEELEAKIAPDGGENVLPLGCGGGHHHG |
Ga0187894_101159342 | 3300019360 | Microbial Mat On Rocks | MEPKLKQDAVELEIQIEELEAKVAPDGGETVLPLPIRLKLHR |
Ga0187892_100466184 | 3300019458 | Bio-Ooze | MEPMLKNEGFELEIQIEELEAKIAPDGGETVLPLPIPNPRGGRG |
Ga0180109_14998441 | 3300020067 | Groundwater Sediment | QDCNAQRMEGMTPLTEKEGLELQVQIEELEAKVAPDGGETVLPLHGRPAGR |
Ga0180109_14998442 | 3300020067 | Groundwater Sediment | MTPMMEKEGFELQIQVEELEAKVAPDGGETVLPLHYRPSDRG |
Ga0179594_102510892 | 3300020170 | Vadose Zone Soil | MNPLTKKEGFELALQIEELEAKIAPGGGETVLPLPLDFTKKR |
Ga0210407_103508932 | 3300020579 | Soil | MNPMMKTEGFELEIQIEELEAKNAPNMDGGETVLPLPFPGIRH |
Ga0210406_106762461 | 3300021168 | Soil | RMNPMINKEGFELEIQIEELEAKIAPDGGETVLPLGTGHGHH |
Ga0222624_11317341 | 3300021951 | Groundwater Sediment | MMNPVTSIEGFELEISIEELEAKIAPDGGETVLPLWLPHGKKYH |
Ga0222625_14726791 | 3300022195 | Groundwater Sediment | MMNPVTNIEGFELEISIEELEAKIAPDGGETVLPLWLPHGKKHH |
Ga0242652_10254511 | 3300022510 | Soil | QMNKTTTKEMILEIQIEELEAKVAPDGGETVLPLPVHGKH |
Ga0242656_10572022 | 3300022525 | Soil | MKPINTKETFELEIQIEELERKVAPDGGETVLPLPTGHHR |
Ga0242660_10606822 | 3300022531 | Soil | MDPMTKKEGFELEINIEELEAKIAPDGGETVLPLPIPCGKKH |
Ga0242660_10858731 | 3300022531 | Soil | KQMNKTTTNEMILEIQIEELEAKVAPDGGETVLPLPVHGKH |
Ga0242662_101059431 | 3300022533 | Soil | KTTTNEMILEIQIEELEAKVAPDGGETVLPLPVHGKH |
Ga0242662_101140361 | 3300022533 | Soil | MNPMSNKEGFELEIQIEELEAKIAPDGGETVLPLGNGHGHHK |
Ga0212128_108612811 | 3300022563 | Thermal Springs | MDPMIKNEGFELEIQIEELEAKIAPDGGETVLPLPKPGGGRGGR |
Ga0242665_102308491 | 3300022724 | Soil | QMNKTTTNEMILEIQIEELEAKVAPDGGETVLPLPVHGKH |
Ga0242654_101553102 | 3300022726 | Soil | MNPMSNKEGFELEIQIEELEAKIAPDGGETVLPLGTGHGHH |
Ga0242654_103866272 | 3300022726 | Soil | MNPMINDEGFELEIQIEELEAKIAPDGGETVLPLPVVGKHGHH |
Ga0209324_108046632 | 3300025174 | Soil | MTPMTKKEGFELEIQIEELEAKIAPDGGETVLPLPLPKGKKK |
Ga0209343_103629343 | 3300025311 | Groundwater | MEPITKKEGLELEINIEELEAKIAPDGGETVVGLPLPKKPRGR |
Ga0209343_105667122 | 3300025311 | Groundwater | MDPITNKEGLELEIEELEAKVAPDGGETVLPMPKGGGRGR |
Ga0207707_104929821 | 3300025912 | Corn Rhizosphere | MNPMINKEGFELEIQIEELEAKIAPDGGETVLPLGHGHGHHK |
Ga0207646_100100394 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPMTKKEGFELEINIEELEAKIAPDGGETVLPLPISSGKKH |
Ga0207646_103860403 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDPMTKKEGFELEIHIEELEAKIAPDGGETVLPLPIPSGKKH |
Ga0207712_116914371 | 3300025961 | Switchgrass Rhizosphere | MEPMNTEGLELEISIEELELKIAPDGGETVLPLPCGKGKGKH |
Ga0209235_10786633 | 3300026296 | Grasslands Soil | MNPLTKKEGFELALQIEELEAKIAPGGGETVLPLPLDLTRKR |
Ga0209470_100259213 | 3300026324 | Soil | MTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQHGHGHH |
Ga0209266_10905491 | 3300026327 | Soil | SFGGKRMNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR |
Ga0209266_11004362 | 3300026327 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLP |
Ga0209159_11800232 | 3300026343 | Soil | SFGGKRMNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCQGHGHR |
Ga0209378_10099744 | 3300026528 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPRHGQPLVE |
Ga0209806_13104952 | 3300026529 | Soil | MNPMTTKEGIELEIQIEELEAKVAPDGGETVLPLPLCGIRK |
Ga0209157_10057149 | 3300026537 | Soil | MTTKEGIELEIQIEELEAKIAPDGGETVLPLPCHGHGCR |
Ga0209157_11639112 | 3300026537 | Soil | MNPMTKKEGIELEIQIEELEAKIAPDGGETVLPLPFFSIRKH |
Ga0209056_106850101 | 3300026538 | Soil | MNPTKNNEGVELEILIEELEAKIAPDGGETVLPLTPGGLGA |
Ga0209156_102723671 | 3300026547 | Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLALPCQGHGHR |
Ga0208981_11552561 | 3300027669 | Forest Soil | MNPLTKKEGFELALQIEELEAKIAPGGGETVLPLPLDF |
Ga0209579_101157441 | 3300027869 | Surface Soil | MKPIASKEGIELEILIEELEAKIAPDGGETVLPLGGGHGKK |
Ga0209465_100281265 | 3300027874 | Tropical Forest Soil | IHKEGYQMSPMTNKEGFELEIQIEELEPKVAADGGETVLPL |
Ga0209488_102035442 | 3300027903 | Vadose Zone Soil | MDSKTTREMMILEIQIEELEAKIAPDGGETVLPLPLAHGKH |
Ga0209488_108191691 | 3300027903 | Vadose Zone Soil | LTKKEGIELALQIEELEAKIAPGGGETVLPLPLDFTKKR |
Ga0209382_114314781 | 3300027909 | Populus Rhizosphere | MNAINKQEALELEIQIEELEPKIAPDGGETVLPLPIPHGKGKGH |
Ga0268265_125234551 | 3300028380 | Switchgrass Rhizosphere | MNPVTREGFELEIQIEELESKVAPDGGETVLPLGPIKGKH |
Ga0308178_11563312 | 3300030990 | Soil | NPMTDKEGFELEIQIEELEAKIAPDGGETVLPLPIPTGKKH |
Ga0170834_1007389212 | 3300031057 | Forest Soil | MNPMINDEGFELEIQIEELEAKIAPDGGETVLPLTVVKHGHK |
Ga0170820_137100172 | 3300031446 | Forest Soil | MNPMSNKEGFELEIQIEELEAKIAPDGGETVLPLGHSHGHH |
Ga0310813_119571832 | 3300031716 | Soil | MEPFKKEGIELEISIEELESKIAPDGGETVLPLVPKGKKH |
Ga0307468_1022071322 | 3300031740 | Hardwood Forest Soil | MNPTTKEGFELEIQIEELEAKVAPDGGETVLPLPLPGKKH |
Ga0307473_103217163 | 3300031820 | Hardwood Forest Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPSNGCHGHSHH |
Ga0310904_113154691 | 3300031854 | Soil | MNPVTREGFELEIQIEELESKVAPDGGETVLPLGPVHGKH |
Ga0306925_116175251 | 3300031890 | Soil | MNPATEKEGIELEINSIEELEAKIAPDGGETVLPLPGGHKH |
Ga0310909_109351732 | 3300031947 | Soil | MNPMTSKEGFELEIQIEELEPKIAPDGGETVLPLGKGHGHH |
Ga0306926_110753583 | 3300031954 | Soil | MNPIAEKEGIELEISIEELEAKIAPDGGETVLPLPGGHKH |
Ga0326597_108763891 | 3300031965 | Soil | MDPKINKEGFELDIQIEELEAKIAPDGGETVLPLPWLRR |
Ga0307471_1002201931 | 3300032180 | Hardwood Forest Soil | MNPMTTKEGIELEIQIEELEAKIAPDGGETVLPLPCNGNGHGHH |
Ga0307471_1040496772 | 3300032180 | Hardwood Forest Soil | MEPMIKEGIELEITIEELESKIAPDGGETVLPLPIPKGKKH |
Ga0306920_1011417253 | 3300032261 | Soil | MNPITEKEGIELEISIEELEAKIAPDGGETVLPLPGGHKH |
Ga0326726_109022092 | 3300033433 | Peat Soil | MDPITNKEGLELDIQIEELESKIAPDGGETVLPLPLPKGKKH |
Ga0314782_051585_3_140 | 3300034661 | Soil | RRVKDMNPVTREGFELEIQIEELESKVAPDGGETVLPLGPVHGKH |
Ga0314784_140963_10_135 | 3300034663 | Soil | MNPVTREGFELEIQIEELESKVAPDGGETVLPLGGGGKGKH |
Ga0314787_101563_400_522 | 3300034665 | Soil | MNPVTTEGFELEIQIEELESKVAPDGGETVLPLGPVKGKH |
⦗Top⦘ |