NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F013158

Metagenome Family F013158

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013158
Family Type Metagenome
Number of Sequences 273
Average Sequence Length 67 residues
Representative Sequence MELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFSFDWKVFSVDQLF
Number of Associated Samples 27
Number of Associated Scaffolds 273

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 7.69 %
% of genes from short scaffolds (< 2000 bps) 35.90 %
Associated GOLD sequencing projects 27
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.747 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(53.480 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(87.546 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.34%    β-sheet: 0.00%    Coil/Unstructured: 65.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 273 Family Scaffolds
PF08718GLTP 0.73
PF01423LSM 0.73
PF00561Abhydrolase_1 0.37
PF07732Cu-oxidase_3 0.37
PF00804Syntaxin 0.37
PF14223Retrotran_gag_2 0.37
PF01103Omp85 0.37
PF00069Pkinase 0.37
PF00458WHEP-TRS 0.37
PF00692dUTPase 0.37
PF03732Retrotrans_gag 0.37
PF02364Glucan_synthase 0.37
PF13456RVT_3 0.37
PF03141Methyltransf_29 0.37
PF00067p450 0.37
PF02182SAD_SRA 0.37
PF00071Ras 0.37
PF03110SBP 0.37
PF13963Transpos_assoc 0.37
PF00155Aminotran_1_2 0.37
PF03188Cytochrom_B561 0.37
PF11523DUF3223 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 273 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.47
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.37
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 0.37
COG2124Cytochrome P450Defense mechanisms [V] 0.37
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.80 %
UnclassifiedrootN/A2.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028786|Ga0307517_10004066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales22587Open in IMG/M
3300028786|Ga0307517_10010423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13005Open in IMG/M
3300028786|Ga0307517_10012718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus11510Open in IMG/M
3300028786|Ga0307517_10015322All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida10202Open in IMG/M
3300028786|Ga0307517_10018758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus8923Open in IMG/M
3300028786|Ga0307517_10041371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4978Open in IMG/M
3300028786|Ga0307517_10047830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4420Open in IMG/M
3300028786|Ga0307517_10054863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3927Open in IMG/M
3300028786|Ga0307517_10055943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3860Open in IMG/M
3300028786|Ga0307517_10062935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3479Open in IMG/M
3300028786|Ga0307517_10080635All Organisms → cellular organisms → Bacteria2784Open in IMG/M
3300028786|Ga0307517_10113835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2039Open in IMG/M
3300028786|Ga0307517_10151110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1592Open in IMG/M
3300028786|Ga0307517_10189372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1309Open in IMG/M
3300028786|Ga0307517_10281608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa947Open in IMG/M
3300028786|Ga0307517_10288406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus929Open in IMG/M
3300028786|Ga0307517_10338839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus822Open in IMG/M
3300028786|Ga0307517_10350752All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300028786|Ga0307517_10359192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa787Open in IMG/M
3300028786|Ga0307517_10406830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa718Open in IMG/M
3300028794|Ga0307515_10006160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida24108Open in IMG/M
3300028794|Ga0307515_10060518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa5397Open in IMG/M
3300028794|Ga0307515_10068945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4846Open in IMG/M
3300028794|Ga0307515_10071805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4684Open in IMG/M
3300028794|Ga0307515_10087444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3955Open in IMG/M
3300028794|Ga0307515_10101805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3462Open in IMG/M
3300028794|Ga0307515_10105478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3354Open in IMG/M
3300028794|Ga0307515_10139649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2607Open in IMG/M
3300028794|Ga0307515_10149956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2443Open in IMG/M
3300028794|Ga0307515_10161362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2284Open in IMG/M
3300028794|Ga0307515_10165595All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2230Open in IMG/M
3300028794|Ga0307515_10277303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1388Open in IMG/M
3300028794|Ga0307515_10517033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa803Open in IMG/M
3300028794|Ga0307515_10647672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa669Open in IMG/M
3300030521|Ga0307511_10051092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3319Open in IMG/M
3300030521|Ga0307511_10141201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1414Open in IMG/M
3300030522|Ga0307512_10062246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2865Open in IMG/M
3300030522|Ga0307512_10104527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1899Open in IMG/M
3300030522|Ga0307512_10128384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1600Open in IMG/M
3300030522|Ga0307512_10297382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus755Open in IMG/M
3300031456|Ga0307513_10013612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix dunnii9974Open in IMG/M
3300031456|Ga0307513_10034171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa5709Open in IMG/M
3300031456|Ga0307513_10034861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5639Open in IMG/M
3300031456|Ga0307513_10051252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4454Open in IMG/M
3300031456|Ga0307513_10051532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4439Open in IMG/M
3300031456|Ga0307513_10052963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4365Open in IMG/M
3300031456|Ga0307513_10056037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4212Open in IMG/M
3300031456|Ga0307513_10060840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4001Open in IMG/M
3300031456|Ga0307513_10073387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3562Open in IMG/M
3300031456|Ga0307513_10082586All Organisms → cellular organisms → Bacteria3307Open in IMG/M
3300031456|Ga0307513_10083412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3286Open in IMG/M
3300031456|Ga0307513_10095318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides3017Open in IMG/M
3300031456|Ga0307513_10098334Not Available2958Open in IMG/M
3300031456|Ga0307513_10100934All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2909Open in IMG/M
3300031456|Ga0307513_10119967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2600Open in IMG/M
3300031456|Ga0307513_10126003All Organisms → cellular organisms → Bacteria2516Open in IMG/M
3300031456|Ga0307513_10130715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2457Open in IMG/M
3300031456|Ga0307513_10142888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2316Open in IMG/M
3300031456|Ga0307513_10162786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2120Open in IMG/M
3300031456|Ga0307513_10163467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2114Open in IMG/M
3300031456|Ga0307513_10194435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1876Open in IMG/M
3300031456|Ga0307513_10227666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1679Open in IMG/M
3300031456|Ga0307513_10244450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1596Open in IMG/M
3300031456|Ga0307513_10249506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1572Open in IMG/M
3300031456|Ga0307513_10275181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1464Open in IMG/M
3300031456|Ga0307513_10290029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1408Open in IMG/M
3300031456|Ga0307513_10326228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1291Open in IMG/M
3300031456|Ga0307513_10383427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1144Open in IMG/M
3300031456|Ga0307513_10425111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1058Open in IMG/M
3300031456|Ga0307513_10427926All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1052Open in IMG/M
3300031507|Ga0307509_10023980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6839Open in IMG/M
3300031507|Ga0307509_10029703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa6062Open in IMG/M
3300031507|Ga0307509_10042375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales4932Open in IMG/M
3300031507|Ga0307509_10043410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4865Open in IMG/M
3300031507|Ga0307509_10056155All Organisms → cellular organisms → Bacteria4180Open in IMG/M
3300031507|Ga0307509_10087593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3198Open in IMG/M
3300031507|Ga0307509_10105490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2839Open in IMG/M
3300031507|Ga0307509_10116300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales2664Open in IMG/M
3300031507|Ga0307509_10129154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2486Open in IMG/M
3300031507|Ga0307509_10190553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1902Open in IMG/M
3300031507|Ga0307509_10210321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1770Open in IMG/M
3300031507|Ga0307509_10241119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1600Open in IMG/M
3300031507|Ga0307509_10254167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1538Open in IMG/M
3300031507|Ga0307509_10359828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1175Open in IMG/M
3300031507|Ga0307509_10418896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1040Open in IMG/M
3300031507|Ga0307509_10447435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa986Open in IMG/M
3300031507|Ga0307509_10544222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus839Open in IMG/M
3300031616|Ga0307508_10059009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3394Open in IMG/M
3300031616|Ga0307508_10067812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3137Open in IMG/M
3300031616|Ga0307508_10085428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2738Open in IMG/M
3300031616|Ga0307508_10098780All Organisms → cellular organisms → Bacteria2513Open in IMG/M
3300031616|Ga0307508_10149730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1938Open in IMG/M
3300031616|Ga0307508_10262800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1320Open in IMG/M
3300031616|Ga0307508_10633267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus673Open in IMG/M
3300031616|Ga0307508_10796902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa561Open in IMG/M
3300031616|Ga0307508_10847650All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus535Open in IMG/M
3300031616|Ga0307508_10920669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa502Open in IMG/M
3300031649|Ga0307514_10039282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3738Open in IMG/M
3300031649|Ga0307514_10041738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3610Open in IMG/M
3300031649|Ga0307514_10055561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3042Open in IMG/M
3300031649|Ga0307514_10093088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2190Open in IMG/M
3300031649|Ga0307514_10235583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1103Open in IMG/M
3300031649|Ga0307514_10246701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1062Open in IMG/M
3300031649|Ga0307514_10473790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus606Open in IMG/M
3300031649|Ga0307514_10483334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa595Open in IMG/M
3300031730|Ga0307516_10025715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae5990Open in IMG/M
3300031730|Ga0307516_10068294All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3423Open in IMG/M
3300031730|Ga0307516_10096231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2781Open in IMG/M
3300031730|Ga0307516_10130779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2289Open in IMG/M
3300031730|Ga0307516_10133132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2263Open in IMG/M
3300031730|Ga0307516_10146393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2127Open in IMG/M
3300031730|Ga0307516_10155491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2042Open in IMG/M
3300031730|Ga0307516_10257629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1436Open in IMG/M
3300031730|Ga0307516_10370446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1095Open in IMG/M
3300031730|Ga0307516_10523525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa839Open in IMG/M
3300031730|Ga0307516_10577981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa777Open in IMG/M
3300031730|Ga0307516_10657292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa703Open in IMG/M
3300031730|Ga0307516_10658504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa702Open in IMG/M
3300031730|Ga0307516_10695454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa673Open in IMG/M
3300031730|Ga0307516_10972594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa519Open in IMG/M
3300031838|Ga0307518_10008491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7337Open in IMG/M
3300031838|Ga0307518_10052524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2961Open in IMG/M
3300031838|Ga0307518_10052786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2953Open in IMG/M
3300031838|Ga0307518_10077709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2398Open in IMG/M
3300031838|Ga0307518_10147842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1629Open in IMG/M
3300031838|Ga0307518_10222216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1231Open in IMG/M
3300031838|Ga0307518_10281272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1029Open in IMG/M
3300031838|Ga0307518_10366686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa827Open in IMG/M
3300031838|Ga0307518_10570659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa552Open in IMG/M
3300031838|Ga0307518_10630765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa501Open in IMG/M
3300032354|Ga0325403_1001286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa20540Open in IMG/M
3300032354|Ga0325403_1002841All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae15523Open in IMG/M
3300032354|Ga0325403_1004547All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus12915Open in IMG/M
3300032354|Ga0325403_1008464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa9835Open in IMG/M
3300032354|Ga0325403_1008930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9569Open in IMG/M
3300032354|Ga0325403_1012961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7866Open in IMG/M
3300032354|Ga0325403_1017125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa6703Open in IMG/M
3300032354|Ga0325403_1018463All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6400Open in IMG/M
3300032354|Ga0325403_1019123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa6265Open in IMG/M
3300032354|Ga0325403_1019712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6136Open in IMG/M
3300032354|Ga0325403_1021928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa5727Open in IMG/M
3300032354|Ga0325403_1021960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa5723Open in IMG/M
3300032354|Ga0325403_1023080All Organisms → cellular organisms → Bacteria5528Open in IMG/M
3300032354|Ga0325403_1023827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5409Open in IMG/M
3300032354|Ga0325403_1027573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4865Open in IMG/M
3300032354|Ga0325403_1028004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4811Open in IMG/M
3300032354|Ga0325403_1028653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4732Open in IMG/M
3300032354|Ga0325403_1028752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4721Open in IMG/M
3300032354|Ga0325403_1030415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4531Open in IMG/M
3300032354|Ga0325403_1032022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4354Open in IMG/M
3300032354|Ga0325403_1032378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4316Open in IMG/M
3300032354|Ga0325403_1033556Not Available4196Open in IMG/M
3300032354|Ga0325403_1040871All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3551Open in IMG/M
3300032354|Ga0325403_1044195All Organisms → cellular organisms → Bacteria3306Open in IMG/M
3300032354|Ga0325403_1045806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3197Open in IMG/M
3300032354|Ga0325403_1046158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3176Open in IMG/M
3300032354|Ga0325403_1053964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2703Open in IMG/M
3300032354|Ga0325403_1054964All Organisms → cellular organisms → Eukaryota → Viridiplantae2648Open in IMG/M
3300032354|Ga0325403_1056754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2560Open in IMG/M
3300032354|Ga0325403_1060066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2400Open in IMG/M
3300032354|Ga0325403_1062837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2280Open in IMG/M
3300032354|Ga0325403_1066813All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2116Open in IMG/M
3300032354|Ga0325403_1086344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1490Open in IMG/M
3300032354|Ga0325403_1088826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1427Open in IMG/M
3300032354|Ga0325403_1089055All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1422Open in IMG/M
3300032354|Ga0325403_1092324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1347Open in IMG/M
3300032354|Ga0325403_1106087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1078Open in IMG/M
3300032354|Ga0325403_1111850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa992Open in IMG/M
3300032354|Ga0325403_1112613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa981Open in IMG/M
3300032354|Ga0325403_1121569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa875Open in IMG/M
3300032354|Ga0325403_1125371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus837Open in IMG/M
3300032354|Ga0325403_1125446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa836Open in IMG/M
3300032355|Ga0325401_1004590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides13037Open in IMG/M
3300032355|Ga0325401_1013711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7763Open in IMG/M
3300032355|Ga0325401_1034788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4294Open in IMG/M
3300032355|Ga0325401_1037347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4066Open in IMG/M
3300032355|Ga0325401_1047685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3336Open in IMG/M
3300032355|Ga0325401_1050763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3168Open in IMG/M
3300032355|Ga0325401_1063335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2582Open in IMG/M
3300032355|Ga0325401_1071351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2291Open in IMG/M
3300032355|Ga0325401_1074019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2206Open in IMG/M
3300032355|Ga0325401_1085327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1893Open in IMG/M
3300032355|Ga0325401_1103098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1511Open in IMG/M
3300032374|Ga0325400_1040510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4025Open in IMG/M
3300032374|Ga0325400_1057977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3070Open in IMG/M
3300032374|Ga0325400_1075866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2443Open in IMG/M
3300032374|Ga0325400_1134554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1386Open in IMG/M
3300032374|Ga0325400_1175147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1037Open in IMG/M
3300032374|Ga0325400_1241371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus732Open in IMG/M
3300032389|Ga0325405_1001296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida25256Open in IMG/M
3300032389|Ga0325405_1001505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida23664Open in IMG/M
3300032389|Ga0325405_1012423Not Available8109Open in IMG/M
3300032389|Ga0325405_1014296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7405Open in IMG/M
3300032389|Ga0325405_1023355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa5224Open in IMG/M
3300032389|Ga0325405_1023747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa5160Open in IMG/M
3300032389|Ga0325405_1024294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa5071Open in IMG/M
3300032389|Ga0325405_1024995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4946Open in IMG/M
3300032389|Ga0325405_1028572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4420Open in IMG/M
3300032389|Ga0325405_1033581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3830Open in IMG/M
3300032389|Ga0325405_1036109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3574Open in IMG/M
3300032389|Ga0325405_1037536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3442Open in IMG/M
3300032389|Ga0325405_1047875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2658Open in IMG/M
3300032389|Ga0325405_1051173All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis2455Open in IMG/M
3300032389|Ga0325405_1051176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2455Open in IMG/M
3300032389|Ga0325405_1051804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2417Open in IMG/M
3300032389|Ga0325405_1056097All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2188Open in IMG/M
3300032389|Ga0325405_1078091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1308Open in IMG/M
3300032389|Ga0325405_1090913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa997Open in IMG/M
3300032389|Ga0325405_1093856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa945Open in IMG/M
3300032389|Ga0325405_1100979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa839Open in IMG/M
3300032389|Ga0325405_1105016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus790Open in IMG/M
3300032390|Ga0325404_1007846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta11082Open in IMG/M
3300032390|Ga0325404_1016243All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6973Open in IMG/M
3300032390|Ga0325404_1053250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2271Open in IMG/M
3300032390|Ga0325404_1059195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1956Open in IMG/M
3300032390|Ga0325404_1059218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1955Open in IMG/M
3300032390|Ga0325404_1061801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1832Open in IMG/M
3300032390|Ga0325404_1083861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1068Open in IMG/M
3300032390|Ga0325404_1107421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa689Open in IMG/M
3300032735|Ga0325410_1014615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa7884Open in IMG/M
3300032735|Ga0325410_1047574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2646Open in IMG/M
3300032740|Ga0325411_1030081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4347Open in IMG/M
3300032740|Ga0325411_1053514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2182Open in IMG/M
3300032740|Ga0325411_1057826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1932Open in IMG/M
3300032741|Ga0325414_1010677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9594Open in IMG/M
3300033160|Ga0325402_1026679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4946Open in IMG/M
3300033160|Ga0325402_1036505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3868Open in IMG/M
3300033160|Ga0325402_1046308Not Available3125Open in IMG/M
3300033160|Ga0325402_1059338All Organisms → cellular organisms → Bacteria2399Open in IMG/M
3300033160|Ga0325402_1088882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1390Open in IMG/M
3300033179|Ga0307507_10046557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4249Open in IMG/M
3300033179|Ga0307507_10180995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1507Open in IMG/M
3300033179|Ga0307507_10195377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1412Open in IMG/M
3300033179|Ga0307507_10268233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1081Open in IMG/M
3300033179|Ga0307507_10279193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1046Open in IMG/M
3300033179|Ga0307507_10563215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa597Open in IMG/M
3300033180|Ga0307510_10011982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa10282Open in IMG/M
3300033180|Ga0307510_10020958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae7626Open in IMG/M
3300033180|Ga0307510_10032990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa5825Open in IMG/M
3300033180|Ga0307510_10040118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5144Open in IMG/M
3300033180|Ga0307510_10143914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2021Open in IMG/M
3300033180|Ga0307510_10153419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1916Open in IMG/M
3300033180|Ga0307510_10178729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1688Open in IMG/M
3300033180|Ga0307510_10225671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1380Open in IMG/M
3300033180|Ga0307510_10426311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa768Open in IMG/M
3300034389|Ga0325419_016815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus6973Open in IMG/M
3300034389|Ga0325419_025843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4946Open in IMG/M
3300034389|Ga0325419_028056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4588Open in IMG/M
3300034389|Ga0325419_029260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4420Open in IMG/M
3300034389|Ga0325419_036218All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3574Open in IMG/M
3300034389|Ga0325419_037348All Organisms → cellular organisms → Bacteria3458Open in IMG/M
3300034389|Ga0325419_037516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3442Open in IMG/M
3300034389|Ga0325419_046482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2680Open in IMG/M
3300034389|Ga0325419_046811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2658Open in IMG/M
3300034389|Ga0325419_049712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis2455Open in IMG/M
3300034389|Ga0325419_058483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1956Open in IMG/M
3300034389|Ga0325419_058499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1955Open in IMG/M
3300034389|Ga0325419_061061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1832Open in IMG/M
3300034389|Ga0325419_099420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa839Open in IMG/M
3300034688|Ga0325420_000487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta36902Open in IMG/M
3300034688|Ga0325420_029963Not Available4112Open in IMG/M
3300034688|Ga0325420_031077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3989Open in IMG/M
3300034688|Ga0325420_038436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3322Open in IMG/M
3300034688|Ga0325420_053213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2417Open in IMG/M
3300034688|Ga0325420_055648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2307Open in IMG/M
3300034689|Ga0325421_007359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida10695Open in IMG/M
3300034689|Ga0325421_039805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa3093Open in IMG/M
3300034689|Ga0325421_052454All Organisms → cellular organisms → Bacteria2307Open in IMG/M
3300034689|Ga0325421_091167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1064Open in IMG/M
3300034778|Ga0325423_028273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa4345Open in IMG/M
3300034899|Ga0325407_023796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5191Open in IMG/M
3300034901|Ga0325409_015170All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7405Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza53.48%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem37.00%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf9.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034778Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R4Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M
3300034901Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307517_10004066163300028786EctomycorrhizaMELKNKYSKQIIYSNQKFDDQIXYNQQIMTFLNFSQLPESVFRLNFPGKHFPENQANFSFDWKVFSVDQLF
Ga0307517_1001042323300028786EctomycorrhizaMKLKSKYSKQIIYRNQKFEDQIXYNQQIMIFLNFSQLPESVFRPNFTGKHFPENQAKFSFDWKVFSVDQLF
Ga0307517_1001271813300028786EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQFLESVFGPNFLGKHFTQNQANFSFDWKVFSVDQFF
Ga0307517_1001532293300028786EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQKLTFLNFSQLPESVFRLNFSGKHFSGNQAKFFFDWKVFSVDQLF
Ga0307517_1001875813300028786EctomycorrhizaMKLKNKYSKQIIYRNQKFEDQIXYNQQIMTFLNFSQLPESVFCPNFPEKHFPENQAKFSFDWKVFFVDQLF
Ga0307517_1004137113300028786EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLSESVFRPNFPGKHFPE
Ga0307517_1004783013300028786EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLLESVFRPNFSGKHFPENQAKFSFDWKVFSVDQLF
Ga0307517_1005486313300028786EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0307517_1005594313300028786EctomycorrhizaMKLKYKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLSKNVFHLNFSEKHFPENQAKFFFDWKVFFIDQLF
Ga0307517_1006293523300028786EctomycorrhizaMKLKNKYTKQIIYSNQKFEDQIXYNQPIMTFLNFSQLPESVFRPNFSGKHFPENQAKFSFDWKVFSVDQLF
Ga0307517_1008063543300028786EctomycorrhizaMKLKNKYTKQIIYSNQKFEDQIXDNQQIMTFLNFSQLPESVFRPNFPGKHFSENQAKFFFDWKVFSVDQLF
Ga0307517_1011383513300028786EctomycorrhizaMELKNKCTKQIIYSNQKFEDQIXYNQQIMTFLIFSQLPESVFRLNFSGKHFPENQAKFSFDRKVFSVDQLF
Ga0307517_1015111013300028786EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIIIFSQLPESVFHSNFPGKHFPGNQAKFFFDWKVFSVDQLS
Ga0307517_1018937213300028786EctomycorrhizaMKLKNKYSKQIIYSNQKFENQIXYNQQIMTFLNFSQLPESVFHLNFPGKHFPENQAKIFFDWKVFSVDQLF
Ga0307517_1028160823300028786EctomycorrhizaMELKNKYTKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFSLDXKVFSVDQLF
Ga0307517_1028840613300028786EctomycorrhizaMELKNKYLKQIIYNNQKFEDQIXYNKQIMIFLNFSQLPESVFRLNFPGKHFPENQAKFFFDWKVFSVDQLF
Ga0307517_1033883913300028786EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLLESVFLPNFSEKHFSENQAKFSFDWKVFFVDQLS
Ga0307517_1035075213300028786EctomycorrhizaMRLKNKYSKQNIYNNQKFDDQIXYNQQIITFLNFSQLPESVFRPNFSGKHFPKNQAKFSFDKKVFSVDQLF
Ga0307517_1035919213300028786EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFCPNFPEKHFSENQAKFSFDWKVFSVDQFS
Ga0307517_1040683013300028786EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFHLNFPGKHFPENQAKFSFDWKVFFVDQLF
Ga0307515_10006160123300028794EctomycorrhizaMKLKNKYSKQIIYRNQKFEDQIXYNQQIMIFLNFSQLPESVFRPNFTGKHFPENQAKFSFDWKVFSVDQLF
Ga0307515_1006051833300028794EctomycorrhizaMKLKNKYSKQKIYNNQKLGDQIXYNQQIMTFLNFSQLPESVFRSNFPGKHFPENQAKFSFNXKVFSVNQLF
Ga0307515_1006894543300028794EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLSESVFCPNFPGKHFSKNQAKFFFDWKVFSVYQLF
Ga0307515_1007180543300028794EctomycorrhizaMELKNKYTKQIIYSNQKFDDQIXYNQQIMTFLNFSQLLESVFRPNFPGKHFPENQAKFSFDWKVFSIDQLF
Ga0307515_1008744413300028794EctomycorrhizaMKLKYKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLSKNVFHLNFSGKHFPENQAKFFFDWKVFFIDQLF
Ga0307515_1010180553300028794EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIIIFSQLPESVFRSNFPGKHFLGNQAKFSFDXKVFSVDQLS
Ga0307515_1010547853300028794EctomycorrhizaMELKNKYSKQIIYNNQKFEDQIXHNQQIMTFLNFSQFPESVFRPNFPEKHFPENQAKFSFDWKVFFVDQLF
Ga0307515_1013964933300028794EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFLQLPESVFRPNFLGKHFPENQAKFSFDWKVFSVDQLF
Ga0307515_1014995643300028794EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLIFSQLLESVFRSNFLEKHFPENQAKFSFNWKVFSVDQLF
Ga0307515_1016136213300028794EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLLESVFLPNFPEKHFSENQAKFSF
Ga0307515_1016559523300028794EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFHPNFPGKHFPENQAKFFFDXKVFFVDPLF
Ga0307515_1027730313300028794EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFHLNFPGKHFPENQAKFFFDCKVFSVDQLF
Ga0307515_1051703313300028794EctomycorrhizaMELKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFRPDFPGKHFPENQAKFSFDWKVFSVD
Ga0307515_1064767213300028794EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIWYNQQIMIFLNFSQLPESVFRPNFPGKHFPKNQAKFFLLESVFC
Ga0307511_1005109213300030521EctomycorrhizaMKLKNKYSKQIIYSNHKFDDQIXYNQQIMTFLIFSQLPKSVFRSNFPGKHFPENQAKFSFDWKVFSVNQLF
Ga0307511_1014120113300030521EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNKQIIIFLNFSQLSESVFHSNFSEKHFPENQAKFSFDWKVFSVDQLS
Ga0307512_1006224613300030522EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIIIFLIFLQLPKSVFRPNFSGKHFPENQAKLSFDWKVFSVD
Ga0307512_1010452713300030522EctomycorrhizaLKDKYSKQNIYNNQKFEDQIXYNQQIMTFLNFSQLSESVFCPNFSGKHFPENQAKFFFDXKVFSVYQLS
Ga0307512_1012838423300030522EctomycorrhizaMELKNKYTKQIIYSNQKFEDQIXYNQQIMTFLNFSQLSQGVFRPNFSGKHFHENQAKFSFDWKVFSVDQLF
Ga0307512_1029738213300030522EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNKQIIIFLNFSQLSESVFHSNFSEKHFPENQAKFSFDWKVFSVDQLS
Ga0307513_1001361213300031456EctomycorrhizaMELKNKYTKQIIYSNQKFEDQIXYNQQIMTFLNFPQLPESVFRPNFPGKHFPENQVKFFFDWKVFSVDQLF
Ga0307513_1003417123300031456EctomycorrhizaMKLKYKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPKSVFCPNFSGKHFPENQAKFFFDWKVFFIDQLF
Ga0307513_1003486143300031456EctomycorrhizaMELKNKYSKQIIYSNQKFEDQILYNQQIMIFLNFSQLPESVFRPNFLGKHFSENQAKFFFDRKVFSVDQLL
Ga0307513_1005125213300031456EctomycorrhizaMELKNKYSKQIIYSNQKFVDQVXYNEQIMTFLNFSQLPESVSRPNFPGKHFPENQSKFFFDXKVFSVDQLF
Ga0307513_1005153213300031456EctomycorrhizaMELKNKYTKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFCPNFSGKHFPENQAKFFFDWKVFSVDQLF
Ga0307513_1005296333300031456EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFSFDXKVFSVDQLF
Ga0307513_1005603713300031456EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFHPNFPGKHFPENQAKFSFDQLS
Ga0307513_1006084033300031456EctomycorrhizaMKLKNKYSKQNIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFLENQAKFFFDWKVFTVDQLF
Ga0307513_1007338743300031456EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLIFSQLLESVFRSNFLGKHFPENQAKFFFNWKVFSVDQLF
Ga0307513_1008258613300031456EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFIGKHFLRNQAKFFFDWKVFSVDQLS
Ga0307513_1008341243300031456EctomycorrhizaMKLKNKYTKQIIYSNQKFEDQIXNNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0307513_1009531833300031456EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVLSPNFSEKHFRENQAKFYFDWKVFFVDQLF
Ga0307513_1009833433300031456EctomycorrhizaMKLKNKYSKQIRYSNQKFDDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFFFDWKVFSVDQLF
Ga0307513_1010093433300031456EctomycorrhizaMKLKNKYSKQIIYSNQKFDDQIXYNQQIMTFLNFSQLPKSVFRSNFPGKHFPENQAKFSFDWKVFSVNQLF
Ga0307513_1011996713300031456EctomycorrhizaMELENKYTKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQANFSFDWKVFSVD
Ga0307513_1012600323300031456EctomycorrhizaMKLKNKYPKQIIYSNQKFENQIXYNQQIMTFLNFSQFPESVFRPNFTGKHFPENQAKFSFDWKVFSIDQLF
Ga0307513_1013071513300031456EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMIFLNFSQLPESVFRPDFPGKHFPGNQAKFFFDWKVFSVDQFF
Ga0307513_1014288833300031456EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFQNFSQLPESVFRLNFSGKHFPENQAKFSFNWKVFSVDQLF
Ga0307513_1016278623300031456EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0307513_1016346723300031456EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFSENQAKFSFDWKVFSVDQLF
Ga0307513_1019443513300031456EctomycorrhizaMKLKNKYSKQNICSNQKFKDQIXYNQQIMTFLNFSQLPKSVFRPNFPGKHFPENQAKFFFDWKVFSVD
Ga0307513_1022766613300031456EctomycorrhizaMELKNKYTKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQ
Ga0307513_1024445013300031456EctomycorrhizaMELKNKYTKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPQGVFRPNFSGKHFHENQAKFSFDWKVFSVDQLF
Ga0307513_1024950633300031456EctomycorrhizaMELKNKYTKQIIYSNQKFEDQIXYNQQIMIFLNFSQLLESVFRPNFPGKHFPENQAKFSFDXKIFSVDQLF
Ga0307513_1027518123300031456EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLDFSQLLESVFLPNFSEKHFSENQAKFSFDWKVFFVDQLS
Ga0307513_1029002913300031456EctomycorrhizaMELKNKYSKQIIYSNRKFEDQIXYNQQIMTFLNFSQPPESVFHPNFPGKHFPENQGKFFFDWKVFSVDQLF
Ga0307513_1032622823300031456EctomycorrhizaMKLKNKYSKQIIYNNQEFDDQICYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQTKFFFNWKVFSVDQLF
Ga0307513_1038342713300031456EctomycorrhizaMELKNKYTKQIIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFSPDXKVFSVDQLF
Ga0307513_1042511113300031456EctomycorrhizaMELKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSLLPESVFRPNFSGKHFPENQAKFSF
Ga0307513_1042792613300031456EctomycorrhizaKYSKQIIYSNQKFEDQIXYNQQIMIFLNFSQLPESVFRPNFPGKHFPEN
Ga0307509_1002398053300031507EctomycorrhizaMKLKNKYSKQIIYINQKFEDQIXNNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKIFFDXKVFFVDQLF
Ga0307509_1002970313300031507EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPKSVFRPNFPGKHFPENQAKFSFDWEVFFVDQLS
Ga0307509_1004237523300031507EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNKQIIIFLNFSQLSESVFHSNFSEKHFPKNQAKFSFDWKVFSVDQLS
Ga0307509_1004341023300031507EctomycorrhizaMKLKYKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLSKNVFHLNFPEKHFPENQAKFFFDWKVFFIDQLF
Ga0307509_1005615523300031507EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFRLNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0307509_1008759313300031507EctomycorrhizaKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFHPNFPGKHFPENQAKFSFDQLS
Ga0307509_1010549013300031507EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPDFPGKHFLENQAKFFFDWKVFFVDQLF
Ga0307509_1011630013300031507EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRLNFPGKFFPENQAKFFFDWKVFSVDQLF
Ga0307509_1012915413300031507EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMIFLNFSQLPESVFRLNFPGKHFPENQAKFSFNWKVFSVDQLF
Ga0307509_1019055333300031507EctomycorrhizaLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSLLPESVFRPNFSGKHFPENQAKFSFDWKVFFVDQLF
Ga0307509_1021032113300031507EctomycorrhizaMELKNKYSKQIIYSNQKFEDQILYDQQIMTFLNFSQLSKSVFRSNFLGKHFPENQAKFSFDWKVFSVDQLF
Ga0307509_1024111923300031507EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLSESVFRSNFSGKHFPENQAKFFFDWNVFSVDQLF
Ga0307509_1025416713300031507EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFHPNFPGKHFPENQAKFFFDWKV
Ga0307509_1035982813300031507EctomycorrhizaKLKNKYSKQIIYSNQKFDDQIXYNQQIMTFLNFSQVPENVFHPNFPGKHFPENQAKFSFGWKVFSVDQLF
Ga0307509_1041889613300031507EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFRLNFLGKHFPENQAKFSFDCKVFSVDQLF
Ga0307509_1044743513300031507EctomycorrhizaMKLKNKYSKQIIYDNQKFEDQIXYNQQIMTFLDFSQLPESVFRPNFPGKHFPENQAKFSFDXKVFSVDQIF
Ga0307509_1054422213300031507EctomycorrhizaMELKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLSKSVFRPNFPGKHFPENQAKFFFDXKVFSVDQLF
Ga0307508_1005900913300031616EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFHPNFSGKHFPENQAKFSFDQLS
Ga0307508_1006781213300031616EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLSESVFRSNFPGKHFPENQAKFFFDWNVFFVDQLF
Ga0307508_1008542813300031616EctomycorrhizaMKLKNKYSKQIIYDNQKFEDQIXYNQQIMTFLDFSQLPESVFRPNFPEKHFPENQAKFSFDXKVFSVDQIF
Ga0307508_1009878023300031616EctomycorrhizaMKLKNKYSKQNICSNQKFKDQIXYNQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFFFDWKVFSVDQLS
Ga0307508_1014973013300031616EctomycorrhizaMKLKNKYSKQNIFSNQKFKDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFSFDXKVFFVDQLF
Ga0307508_1026280013300031616EctomycorrhizaMKLKNKYSKQIIYNNQEFEDQICYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQTKFSFNWKVFSVDQLF
Ga0307508_1063326713300031616EctomycorrhizaMELKNKYSKQIKYSNQKFEDQIXYNQQIMTFLNFSQLPESVFCPNFSGKHFPENQAKFSFNCKVFFVDQLF
Ga0307508_1079690213300031616EctomycorrhizaMKLKNKYSKQIIYSNQNFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0307508_1084765013300031616EctomycorrhizaMKLKNKYSKQNIYSNQKFENQIXYNQQIMTFLNFSQLPESVFHLNFSGKHFPENQAKFFFDWKVFSVDQLF
Ga0307508_1092066913300031616EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNHQIMTFLNFSQFPESVFRPNFSGKHFPENQAKFSFDWK
Ga0307514_1003928273300031649EctomycorrhizaMELKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFLGKHFSENQAKFSFDWKVFFIDQLF
Ga0307514_1004173813300031649EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFLGKHFPENQAKFFFDWKVFSVDQLF
Ga0307514_1005556143300031649EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLLESVFLPNFSENQAKFSFDWKVFFVDQLS
Ga0307514_1009308813300031649EctomycorrhizaMKLKNKYLKQIIYSNQKFEDQIXYNKQIMIFLNFSQLPKSVFHPNFPGKHFPENQAKFFFDWKVFFVNQLF
Ga0307514_1023558313300031649EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLSESVFRSNFPGKHFPENQAKFSFDXKVFSVDQLS
Ga0307514_1024670113300031649EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIITFLNFSQLPESVFRPNFPGKHFPENQAKFSFDXKVFSVDQLF
Ga0307514_1047379013300031649EctomycorrhizaMELKNKYSKQIIYSNQKFEDQICYNQQIMIFLNFSQLPENVFRPNFPGKHFPENQVKFSFDWKVFSVDQLF
Ga0307514_1048333413300031649EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFFFDXKVFSVDQLF
Ga0307516_1002571573300031730EctomycorrhizaMGLKNKYSKQIIYSNQNFEDQIXYNQQIMTFLNFSQLPESVFRLNFSGKHFPENQAKFSFDWKVFSVDQLC
Ga0307516_1006829413300031730EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQA
Ga0307516_1009623113300031730EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMIFLNFSQLPENVFRPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0307516_1013077923300031730EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQIKFSFDWKVFSVDQLF
Ga0307516_1013313213300031730EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRLNFPGKHFPENQAKFSFDWKVFSVD
Ga0307516_1014639313300031730EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMIFLNFSQLSESVFRPDFPGKHFLENQAKFSFDWKVFSVDQLF
Ga0307516_1015549113300031730EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMIFLNFSQLPESVFRPNFPRKHFPGNQAKFFFDXKVFSVDQLF
Ga0307516_1025762913300031730EctomycorrhizaMKLKYKYSKQNIYSNQKFDDQIXYNQQIMTFLNFSQLSKNVFHLNFPEKHFPENQAKFFFDWKVFFIDQLF
Ga0307516_1037044613300031730EctomycorrhizaMKLKNKYSIQNIYSNQKFEDQIXYNKLIMTFLNFSQLPESVFHPNFPGKHFPGNQAKFSFDXKVFSVDQLF
Ga0307516_1052352523300031730EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPGSVFRPNFRGKHFPENQAKFFFDXKVFSVDQLF
Ga0307516_1057798113300031730EctomycorrhizaMELKNKYSKQIIYSNQKFEDQILYNQQIMIFLNFSQLPESVFRLNFLGKHFPENQAKFFFDRKVFSVDQLL
Ga0307516_1065729213300031730EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFRLNFLGKNIGKFGK
Ga0307516_1065850413300031730EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQVMTFLNFSQLPESVFHPNFPEKHFPENQTKFSFDWKVFSVDQLF
Ga0307516_1069545413300031730EctomycorrhizaMKLKNKYSKQNIYSNQKFDDQILYNKQIMTFRNFSQLPESVFRPNFPGKHFPKNQAKFSFDWKVFSVDQLF
Ga0307516_1097259413300031730EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLIFSQLPESVFRPNFSGKHFPENQAKFSFDXK
Ga0307518_1000849113300031838EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFRLNFPGKHFPENQAKF
Ga0307518_1005252413300031838EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIITFLNFSQLPESVFRPNFSGKHFPENQAKFSFDWKVFSVDQLF
Ga0307518_1005278613300031838EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPENVFRPNFSGKHFPENQAKFFFDWKVFSVDQLF
Ga0307518_1007770913300031838EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQVKFFFDWKVFSVDQLF
Ga0307518_1014784223300031838EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIIXYFTNFSGKHFPGNQAKFFFDWKVFSVD
Ga0307518_1022221613300031838EctomycorrhizaQIIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFHPNFPGKHFPENQVKFSFD
Ga0307518_1028127213300031838EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIITFLNFSQLPESVFCPNFPGKHFPENQAKFSF
Ga0307518_1036668613300031838EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLSESVFRSNFPGKHFPENQAKFFFDXNVF
Ga0307518_1057065913300031838EctomycorrhizaMELKNKYSKQIIYSNQKFEDQICYNQQIMIFLNFSQLPESVFRPNFPRKHFPENQAKFSFDWKVFSVDQLF
Ga0307518_1063076513300031838EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMIFLNFSQLPESVFRLNFPGKHFPENQAKF
Ga0325403_1001286153300032354XylemMKLKNKYSKQIIYSNQKFEDQIWYNQQIITFLNFSQLPESIFLPNFLGKYFPENQAKFSFDWKVFSVD
Ga0325403_1002841133300032354XylemMKLKNKYSKQIIYNNQNFEDQIXYNQQIMTFLKFSQLPISLFRPNFPGKHFPENQAKFSFDWKVFSVNQLL
Ga0325403_100454763300032354XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLLESVFRTNFPRKHFPENQAKFFFNWKVFSVDQLF
Ga0325403_100846413300032354XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFCPNFSGKYFPENQAKFSFDXKVFSVDQLF
Ga0325403_100893013300032354XylemMKLKNKYLKQNIYSNQNFENQIXYNQQIMTFLIFSQLPESVFRPNFPGKHFPENQAKFFFDWKVFSIDQLF
Ga0325403_101296113300032354XylemMKLKNKYSKKYIYSNQKFEDQIXYNQQIKTFLIFSQFPENVFHPNFSGKYFLENQVKFFFDWKIFFVN
Ga0325403_101712543300032354XylemMKLKNKYSKQIIYSNQKFENQIXYNQQIMTFLNFSQLPENIFRPNFPGKHFPENQAKFFFDWKVFSVDQLF
Ga0325403_101846353300032354XylemMKLKNKYSKQIIYSNQKFEDQIXFNQQIMTFVNFLQLSQNVFRLNFPGKHFPENQAKFFFNWKVFSVNQLF
Ga0325403_101912313300032354XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFHSKFSRKHFPENQAKFFFDWKVFSVDQLF
Ga0325403_101971223300032354XylemMKLKNKYSKQIIYSNQKFNDQIXYNQQIMTFLNFSQLPESVFRLNFSGKHFPENQTKFFFNWKVFSVD
Ga0325403_102192823300032354XylemMKLKNKYSKQIIYSNQKFDDQIXYNQQIMTFLNFSQLPESVFRSNFSGKHFPENQIKFFFDXKVFSVD
Ga0325403_102196013300032354XylemMKLKNKCSKQNIYSNQKFEDQIXYNQQIMIFLKFSQLSESVFRLNFPGKHFPGNQTKFSFDWKVFSVDQLF
Ga0325403_102308013300032354XylemMKLKNKYLKENIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRSNFSGKHFLGNQAKFSFDXKVFSVDQLS
Ga0325403_102382713300032354XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMIFLNFSQLPESVFRSNFVGKHFPENQAKFSFDWKVFFVDQLF
Ga0325403_102757333300032354XylemMNLKNKYSKQIIYSNQKFEDQIXYNQQIITFLNFSQLPESVFRPNIPGKHFPENQAKFFFIWKVFSADQLF
Ga0325403_102800413300032354XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMIFLIFSQLPESIFRLNFPGKHFPENQAKFSFDWKVFSIDQLF
Ga0325403_102865333300032354XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFFFDWKVFSVDQIF
Ga0325403_102875223300032354XylemMKLKNKYSKQIIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFCLNFPGKYFPEN
Ga0325403_103041523300032354XylemMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLIFSQLSESVFCPNFPGKHFPENQAKFFFDXKVFSVDQFFL
Ga0325403_103202213300032354XylemMKLKNKYSKQNIYSNQKFEDQIXYNQQIMKFLNFSQLPESVFRPNFTGKHFPETQAKFFF
Ga0325403_103237823300032354XylemMKLKNKYSKQNIYSNQKFEDQIXYNQQMMTFLIFSQLSESVFCPNFPGKHFPENQAKFLFDXKVFSVDQLF
Ga0325403_103355643300032354XylemMKLKIKYSKQIIYSNQKFQDQICYNQQIMTFLSFLQLPKSVFRLNFSGKHFAENQAKFSF
Ga0325403_104087163300032354XylemMKLKNKYSKQNIYSNQKYQDQIXYNQQIITFLNFSQLPESVFHPNFSGKHFPEN
Ga0325403_104419533300032354XylemMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFCPDFSGKHFPENQAKFFFDWKVFSVDQLS
Ga0325403_104580613300032354XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLSESVFRPNFPGKHFLENQAKFFFDWKVFSVDQLF
Ga0325403_104615823300032354XylemMELKNKYSKQIIYSNQKFDDQIXYNQQIMTFLNFSQLPESVFRLNFPGKHFPENQAKFFFDWKVFSVD
Ga0325403_105396423300032354XylemMKLKNKYSKQNIHSNQKFEDQIXYNQQIMIFLNFSQLPESVFCPNFSGKHFPEN
Ga0325403_105496423300032354XylemMKLKNKYSKQIIYSNQKFEDQIMTFLNFSQLPESVFRPNFSGKHFPENQVKFSFDWKVFSVDQLF
Ga0325403_105675413300032354XylemMKLKNKYLKQIIYSNQKFEDQIXYNQQIMTFLNFSQLSESVFRPNFLGKYFPENEVKFSFDWKVFSVDQLF
Ga0325403_106006613300032354XylemMKLKNKYSKQKIYSNQKFEDQIXYNQQIMTFLIFSQLLESVFRPNFPGKHFPKNQAKFFFYWKVFFVDQFS
Ga0325403_106283713300032354XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPKNQAKFFFDXKVFSGDQLF
Ga0325403_106681323300032354XylemMELKNKYSKQIIYSNQKFEDQIXYNQQRMKFLNFSQLPESVFLENFPGKHFPENQAKFFF
Ga0325403_108634413300032354XylemMKLKNKYSKQIIYSNQKFDDQIXYNQQIMTFLNFSQLPESVFRLNFPGKHFPEN
Ga0325403_108882613300032354XylemMKLKNKYSKQIIYNNQKFEGQIXYNHQIMTFQKFSQFLESVFRPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0325403_108905523300032354XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPENVLNFSEKHFPEN
Ga0325403_109232423300032354XylemMKLKNKYSKQSIYSNQKFEDQIXYNQQIMIFLNFSQLLESVFRSNFLGKHFPENQAKFSFDWKVFSVDQIF
Ga0325403_110608713300032354XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIITFLNFSQLPESVFRSNFSGKYFPENQAKF
Ga0325403_111185013300032354XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFHPNFPGKYFPENQAKFSFDWKVFSVDQLF
Ga0325403_111261313300032354XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIITFLNFSQLPESVFHPNFSGKHFPENQAKFFFDWKVFSVDQLF
Ga0325403_112156913300032354XylemMELKNKYSKQIIYCNQKFEDQIXYNQQIMTFLNSSQLPESVFRLNFPGKHFPENQAKFFFDWKVFSVDQLF
Ga0325403_112537113300032354XylemMELKNKYTKQIIYNNQKFEDQILYNQQIMTFLNFSQFSKSVFRSNFSGKHFPENQAKFSFNWKVFSVDQLF
Ga0325403_112544613300032354XylemMKLKNKYSKQNINSNQKFEDQIXYNQQIMTFLIFSQLPESVFRLNFPGKHFPENQAKFSFDWKVFFVDQLF
Ga0325401_100459083300032355XylemMELKNKYSKQIIYSNQKFKDQIXYNQQIITFLNFSQLPESVFCPNFPGKHFPENQAKFFF
Ga0325401_101371123300032355XylemMKLKNKYSKQNIYSNQKFEDQIXYNQQIMKFLKFSQFSKSVFCPDFSGKHFLENQAKFFL
Ga0325401_103478813300032355XylemMKLKNKYSKQIIYSNKKFKYQIXYNQLIITFLNFSQFPESVFRPNFPGKHFPENQAKFSFYXKVFFVDQLF
Ga0325401_103734733300032355XylemMKFKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPEN
Ga0325401_104768523300032355XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLIFSQLPESIFRLNFPGKHFPENQVKFSFDWKVFSIDQLF
Ga0325401_105076313300032355XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFCLNFSGKHFPKNQAKFFFDRKMFSVDQLF
Ga0325401_106333513300032355XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMIFLNFSQLSESVFRPNFSGKYFPENQVKFSFDXKVFFVDQLF
Ga0325401_107135123300032355XylemMELKNKYSKQIIYSNKKFEDQIXYNQQIVIFLNFSQLPESVFRLNFPEKHFPENQAKCFSFD
Ga0325401_107401913300032355XylemMKLKNKYSKQIIYSNQKFENQIXYNQQIMTFLIFSQLSESVFRPNFSGKHFPENQAKFLIDXKVFSIDQLF
Ga0325401_108532713300032355XylemMKLKNKYSKQIIYSNQKFGDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFSFDWKVISVDQIF
Ga0325401_110309813300032355XylemMKLKNKYSKQIIYSIQKFEDQIXYNQQIMTFLNFSQLPESVFYLNFPGKHFPEN
Ga0325400_104051063300032374XylemMKLKNKYSKQNIYSNQKYQDQIXYNQQIMTFLNFSQLPESVFHPNFSGKHFPEN
Ga0325400_105797713300032374XylemMKLKNKYLKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFHPNFPGKHFLENQAKFFF
Ga0325400_107586613300032374XylemMKLKNKYLKQNIYSNQKFEDQIXYNQQIITFLNFSQLPESVFRPNFSGKHFPENQAKFFFDXKIFSVDQLF
Ga0325400_113455413300032374XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIITFLKFSQLPESVFRSNFQEKYFPENQAKFSFDWKVFSVDQLF
Ga0325400_117514713300032374XylemMKLKNKYTKQIIYNNQKFEDQIXNNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFSFDWKVFFVD
Ga0325400_124137113300032374XylemMKLKNKYSKQKKKNIYIYIYSNQKFEDQIXNNQQIMTFLNFSQLPESVFHPNFPEKHFPENQAKFSFDWKVFFIDQLS
Ga0325405_100129623300032389XylemMKLKNKYSKQIIHSNQKFEDQIXYNQQIMIFLNFSQLLESFFCPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0325405_1001505223300032389XylemMELKNKYSKQIIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFCPNFPGKHFPENQAKFFF
Ga0325405_101242323300032389XylemMKLKNKYSKQIIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFHSNFSAKHFPENQAKFFFDWKVFSVDQLF
Ga0325405_101429663300032389XylemMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQFSESVFRPNFLGKHFPENQAKFYFDWKVFSVDQLS
Ga0325405_102335523300032389XylemMELKNKYSKKIIYNNQNFDDQIXYNQQIMTFLNFSQLPKSVFRPNFSGKHFPEN
Ga0325405_102374713300032389XylemMKLKNKYSKQNIHSNQKFEDQIXYNQQIMTFLNFSQLPESVFCPNFSGKHFPEN
Ga0325405_102429413300032389XylemMKLKIKYSKQIIYSNKKFNDQIXYNQQIMTFLNFLQLSKSVFRLNFSGKHFAENQAKFSF
Ga0325405_102499523300032389XylemMKLKNKYSKQIIYSNQKSDDQIXYNQQIMTFLNFSQLPESVFRSNFSGKHFIENQTKFFFDXKVFSVD
Ga0325405_102857233300032389XylemMELKNKYSKQIIYSNQKFKDQIXYNQQIMTFLIFLQFLESVFRSNFPGKHFPENQVKFSFDWKVFSVDQIF
Ga0325405_103358123300032389XylemMKLKNKYSKQIIYSIQKFKDQIXYNQQIMTFLNFSELPESVFCLNFPGKYFPEN
Ga0325405_103610913300032389XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMKFLNFSQLPESVFLENFPGKHFPENQAKFFF
Ga0325405_103753623300032389XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLLESVFRLNFPGKHFPKNQTKFFFDWKEFFVEQLF
Ga0325405_104787523300032389XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIITFLNFSQLPESVFRLNFPGKHFPENQAKFSFNWKMFSVDQLF
Ga0325405_105117333300032389XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQFSESVFRSNFIGKHFPEDQVIFFFDXKVFSVDQLF
Ga0325405_105117623300032389XylemMKLKNKYSKQIIYRNQKFEDQIXYNQQIMTFLNFSQLPESVLNFSEKHFPEN
Ga0325405_105180433300032389XylemMKLKNKYSKQIIYSNQKFENQIXYNQQIMIFLNFSQLPESVFRSKFLGKHFPENQAKFFFNWKVFSVDQIF
Ga0325405_105609713300032389XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMIFLNFSQLSESVFHPNFPGKHFPENQTKFFF
Ga0325405_107809113300032389XylemMKLKNKYSKQIIYNNQKFEGQIXYNHQIMTFQNFSQFPESVFRPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0325405_109091313300032389XylemMELKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLPESVFLPNFSGKHFPENQAKFSFDWKEFSIDQLF
Ga0325405_109385613300032389XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNLSQLPENVFHPNFSGKHFPENQAKFFFDWKVFFVDQLF
Ga0325405_110097913300032389XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPENVFHLNISRKHFHKNQAKFSFNWKVFSIDQTFLMANRHRKV
Ga0325405_110501613300032389XylemMELKNKYTKKIIYNNQKFEDQILYNQQIMTFLNFSQFSESVFRSNFSGKHFPENQAKFSFNWKVFSVDQLF
Ga0325404_100784653300032390XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMIFLKFSQLSKSVFRPNFLGKHFPENQAKFFFNWKVFFVDQLF
Ga0325404_101624323300032390XylemMKLKNKYSKQNIHSNQKFKDQIXYNQQIMIFLNFSQLPESVFRPNFPGKHFYENQAKFFFNXKVFSVDQLS
Ga0325404_105325013300032390XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFFFDXKVFSGDQFF
Ga0325404_105919513300032390XylemMKLKNKYLKQIIYSNQKFEDQIXYNQQIMTFLNFSQFPESVFHPNFSGKHFPENQAKFSF
Ga0325404_105921813300032390XylemMKLKNKYLKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFHPNFPGKHFPENQAKFSF
Ga0325404_106180113300032390XylemMKLKNKYLKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQTKFFFDXKIFSVDQLF
Ga0325404_108386113300032390XylemMKLKNKYSKQIIYNNQKFEGQIXYNHQIMTFQKFSQFLESVLRPNFLGKHFPENQAKFSFDWKVFSVDQLF
Ga0325404_110742113300032390XylemMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFTGKHFPETQAKFFF
Ga0325410_101461523300032735XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFHSNFSAKHFPENQAKFFFDWKVFSVDQLF
Ga0325410_104757413300032735XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRSNFSGKHFPEN
Ga0325411_103008133300032740XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLSESVFCPNFSGKHFPEN
Ga0325411_105351413300032740XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLIFSQLPESIFRLNFPGKHFPENQAKFSFDWKVFSIDQLF
Ga0325411_105782613300032740XylemMELKNKYSKQIIYSNLKFEDQIXYNQQIMTFLNFSQLPESVFRPNFLGKHFLENQAKFSFDWKVFSVDQLF
Ga0325414_101067713300032741LeafMKLKNKYSKQNIYSNQNFEDQIXYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQAKFFFDWKVFFIDQLF
Ga0325402_102667943300033160XylemMKLKNKYSKQIIYSNQKFEDQIXYNQQIMIFLKFSQLSKSVFRPNFLGKHFPENQAKFFFDWKVFSVDQLF
Ga0325402_103650523300033160XylemMKLKNKYLKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFFFDXKIFSVDQLF
Ga0325402_104630813300033160XylemKLKIKYSKQIIYSNQKFQDQICYNQQIMTFLSFLQLPKSVFRLNFSGKHFAENQAKFSFD
Ga0325402_105933813300033160XylemMKLKNKYSKQIISSNQKFDDQIXYNQQIMTFLNFSQLSKNISRSNFSGKHFTENQAKFFFDWKVFSIDQLF
Ga0325402_108888213300033160XylemMELKNKYSKQIIYSNQKFEDQIXYNQQIITFLNFSQLPESVFHPNFSGKHFPENQAKFFFDW
Ga0307507_1004655713300033179EctomycorrhizaMELKNKYLKQIIYSNQKFGDQIXYNQQIMTFLNFSPLPESVFRPNFPGKYFPENQAKFFFDWKVFFVDQLF
Ga0307507_1018099513300033179EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLPESVFHPNFLGKHFPENQAKFSFDQLS
Ga0307507_1019537713300033179EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLLESVFCPNFPGKHFTQNQAKFSFDWKVFSVDQLF
Ga0307507_1026823313300033179EctomycorrhizaMELKNKYSKQIIYSNQKFIDQVXYNEQIMTFLNFSQLPESVSRPNFPGKHFPENQSKFSFDXKVFSVDQLF
Ga0307507_1027919323300033179EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQKLTFLNFSQLPESVFRLNFPGKHFPENQAKFFFDWKVFSVDQLF
Ga0307507_1056321523300033179EctomycorrhizaMKLKNKYSKQIIYNNQEFEDQICYNQQIMTFLNFSQLPESVFRPNFPGKHFPENQTKFFFNWKVFSVDQLF
Ga0307510_1001198233300033180EctomycorrhizaMKLKNKYSKQIIYNNQKFEDQIXYNQQIMTFLNFSQLSESVFRSNFPGKHFPENQAKFFFDWNVFSVDQLF
Ga0307510_10020958113300033180EctomycorrhizaMELKNKYSKQIIYSNQKFEDQIXYNQQIMTFLIFSQLPESVFRPNFLGKHFPENQAKFS
Ga0307510_1003299013300033180EctomycorrhizaMKLKNKYSKQIIYSNQKFEDQIXYNQQIMAFLIFSQLPKSVFRPNFPGKHFPENQAKFSFDWKVFSVDQLF
Ga0307510_1004011823300033180EctomycorrhizaMELKNKYSKQIIYNNQKFENQIXYNQQIMTFLNFSQLPESVFRPNFLGKHFPENQAKFSFDXKVFFIDQLF
Ga0307510_1012496613300033180EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQNXYNQQIMIFLNFSQLPESVFHPNFPGKHFPENQ
Ga0307510_1014391413300033180EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRLNFPGKHFPENQAKFSFDXKVFFVDQLF
Ga0307510_1015341913300033180EctomycorrhizaNKYSKQIIYSNQKFEDQIXYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFFFD
Ga0307510_1017872913300033180EctomycorrhizaMKLKNKYSKQNIFSNQKFKDQIXYNHQIMTFLNFSQLPESVFRPNFSGKHFPENQAKFSFDXKVFSVDQLF
Ga0307510_1022567113300033180EctomycorrhizaMKLKNKYSKQNIYSNQKFKDQIXYNQQIMTFLNFSQLLESVFFPNFSEKHFYENQAKFSFDWKVFFVDQLS
Ga0307510_1042631113300033180EctomycorrhizaMKLKNKYSKQNIYSNQKFEDQIXYNQQIMTFLNFSQLPGSVFRPNFRGKHFPENQAKFFLDXKVFSVDQLF
Ga0325419_016815_3369_35843300034389LeafMKLKNKYSKQNIHSNQKFKDQIWYNQQIMIFLNFSQLPESVFRPNFPGKHFYENQAKFFFNWKVFSVDQLS
Ga0325419_025843_2409_26153300034389LeafMKLKNKYSKQIIYSNQKSDDQIWYNQQIMTFLNFSQLPESVFRSNFSGKHFIENQTKFFFDWKVFSVD
Ga0325419_028056_1980_21953300034389LeafMKLKNKYSKQIIYSNQKFKDQIWYNQQIMTFLNFSQLPESVFHSNFSAKHFPENQAKFFFDWKVFSVDQLF
Ga0325419_029260_2265_24803300034389LeafMELKNKYSKQIIYSNQKFKDQIWYNQQIMTFLIFLQFLESVFRSNFPGKHFPENQVKFSFDWKVFSVDQIF
Ga0325419_036218_3206_33913300034389LeafMELKNKYSKQIIYSNQKFEDQIWYNQQIMKFLNFSQLPESVFLENFPGKHFPENQAKFFF
Ga0325419_037348_3137_33523300034389LeafMELKNKYSKQIIYSNQKFEDQIWYNQQIMTFLKFSQLPESIFRPNFPGKHFPENQVKFLFDWKVFFVDQIF
Ga0325419_037516_915_11303300034389LeafMKLKNKYSKQIIYSNQKFEDQIWYNQQIMTFLNFSQLLESVFRLNFPGKHFPKNQTKFFFDWKEFFVEQLF
Ga0325419_046482_755_9403300034389LeafMELKNKYSKQIIYSNQKFEDQIWYNQQIMIFLNFSQLSESVFHPNFPGKHFPENQTKFFF
Ga0325419_046811_685_9003300034389LeafMKLKNKYSKQIIYSNQKFEDQIWYNQQIITFLNFSQLPESVFRLNFPGKHFPENQAKFSFNWKMFSVDQLF
Ga0325419_049712_1628_18433300034389LeafMKLKNKYSKQIIYSNQKFEDQIWYNQQIMTFLNFSQFSESVFRSNFIGKHFPEDQVIFFFDWKVFSVDQLF
Ga0325419_058483_637_8223300034389LeafMKLKNKYLKQIIYSNQKFEDQIWYNQQIMTFLNFSQFPESVFHPNFSGKHFPENQAKFSF
Ga0325419_058499_640_8253300034389LeafMKLKNKYLKQIIYSNQKFEDQIWYNQQIMTFLNFSQLPESVFHPNFPGKHFPENQAKFSF
Ga0325419_061061_548_7633300034389LeafMKLKNKYLKQNIYSNQKFEDQIWYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQTKFFFDWKIFSVDQLF
Ga0325419_099420_526_7683300034389LeafMKLKNKYSKQIIYSNQKFEDQIWYNQQIMTFLNFSQLPENVFHLNISRKHFHKNQAKFSFNWKVFSIDQTFLMANRHRKV
Ga0325420_000487_35348_355123300034688LeafMKLKNKYSKQNIYSNQKYQDQIWYNQQIMTFLNFSQLPESVFHPNFSGKHFPEN
Ga0325420_029963_265_4803300034688LeafMELKNKYSKQIIYSNQKFEDQIWYNQQIITFLNFSQLPESVFHPNFSGKHFPENQAKFFFDWKVFSVDQLF
Ga0325420_031077_2695_29103300034688LeafMELKNKYSKQIIYSNQKFEDQIWYNQQIMTFLIFSQLPESIFRLNFPGKHFPENQAKFSFDWKVFSIDQLF
Ga0325420_038436_3030_32453300034688LeafMKLKNKYSKQIIYNNQKFEGQIWYNHQIMTFQKFSQFLESVLRPNFLGKHFPENQAKFSFDWKVFSVDQLF
Ga0325420_053213_2148_23633300034688LeafMKLKNKYSKQIIYSNQKFENQIWYNQQIMIFLNFSQLPESVFRSKFLGKHFPENQAKFFFNWKVFSVDQIF
Ga0325420_055648_1616_18313300034688LeafMKLKNKYLKKIIYSNQKFEEQIWYNQQIMTFLNFSKLPESVFRPNFLEKHFPKNQAKFSLDWKVFSVYQLF
Ga0325421_007359_4516_47313300034689LeafMKLKNKYSKQIIYSNQKFEDQIWYNQQIMIFLKFSQLSKSVFRPNFLGKHFPENQAKFFFNWKVFFVDQLF
Ga0325421_039805_461_6463300034689LeafMKLKNKYSKQNIYSNQKFEDQIWYNQQIMTFLNFSQLPESVFRPNFTGKHFPETQAKFFF
Ga0325421_052454_1616_18313300034689LeafMKLKNKYLKKIIYSNQKFEEQIWYNQQIMTFLNFSKLPESVFHPNFIEKHFPENQAKFSLDWKVFSVYQLF
Ga0325421_091167_897_10643300034689LeafMELKNKYSKQIIYNNQKFEDQIWYNQQIMTFLNFSQLPESVFRPNFSGKHFPENQA
Ga0325423_028273_3698_38623300034778LeafMELKNKYSKQIIYSNQKFEDQIWYNQQIMTFLNFSQLSESVFCPNFSGKHFPEN
Ga0325407_023796_3612_37763300034899XylemMKLKNKYSKQIIYSNQKFDDQIWYNQQIMTFLNFSQLPESVFRLNFPGKHFPEN
Ga0325409_015170_6209_64243300034901XylemMKLKNKYSKQNIYSNQKFEDQIWYNQQIMTFLNFSQFSESVFRPNFLGKHFPENQAKFYFDWKVFSVDQLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.