Metagenome / Metatranscriptome Family F013050

Basic Information
Family ID	F013050
Family Type	Metagenome / Metatranscriptome
Number of Sequences	275
Average Sequence Length	42 residues
Representative Sequence	MSKGKQPRTRVNKVPKLLLSEIKEVFILYDQEIGLEAAIF
Number of Associated Samples	232
Number of Associated Scaffolds	275

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	83.68 %
% of genes near scaffold ends (potentially truncated)	20.36 %
% of genes from short scaffolds (< 2000 bps)	63.27 %
Associated GOLD sequencing projects	221
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Unclassified (56.727 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (9.818 % of family members)
Environment Ontology (ENVO)	Unclassified (32.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (33.091 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 275 Family Scaffolds
PF00510	COX3	2.55
PF00499	Oxidored_q3	2.55
PF00961	LAGLIDADG_1	1.45
PF01541	GIY-YIG	1.09
PF00033	Cytochrome_B	0.73
PF07460	NUMOD3	0.73
PF00361	Proton_antipo_M	0.73
PF00119	ATP-synt_A	0.73
PF03161	LAGLIDADG_2	0.73
PF00032	Cytochrom_B_C	0.36
PF13631	Cytochrom_B_N_2	0.36
PF00115	COX1	0.36
PF06455	NADH5_C	0.36
PF00137	ATP-synt_C	0.36

COG ID	Name	Functional Category	% Frequency in 275 Family Scaffolds
COG0839	NADH:ubiquinone oxidoreductase subunit 6 (chain J)	Energy production and conversion [C]	2.55
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	2.55
COG1290	Cytochrome b subunit of the bc complex	Energy production and conversion [C]	1.09
COG0356	FoF1-type ATP synthase, membrane subunit a	Energy production and conversion [C]	0.73
COG1009	Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit	Energy production and conversion [C]	0.73
COG0636	FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K	Energy production and conversion [C]	0.36

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
All Organisms	root	All Organisms	43.27 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
cellular organisms	root	All Organisms → cellular organisms	43.27 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	42.91 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	24.00 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	15.64 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	15.64 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	14.91 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	15.64 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	14.18 %
Rickettsiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales	0.36 %
Fungi incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	15.64 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	12.73 %
unclassified Rickettsiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales	0.36 %
Mucoromycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	15.64 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	12.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Glomeromycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	15.64 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	12.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Glomeromycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	15.64 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	11.27 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Diversisporales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	15.64 %
sordariomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta	11.27 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Diversisporaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	15.64 %
Sordariomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes	11.27 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Diversispora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	15.64 %
Hypocreomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae	7.64 %
Sordariomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae	3.64 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	15.64 %
Hypocreales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales	7.64 %
Diaporthales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales	3.64 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	15.64 %
Ophiocordycipitaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae	5.09 %
Gnomoniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae	2.18 %
Cordycipitaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae	1.82 %
Nectriaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae	0.36 %
Cryphonectriaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae	0.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Juglanconidaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae	0.73 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	15.64 %
Ophiocordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps	5.09 %
Ophiognomonia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia	2.18 %
Beauveria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria	1.82 %
Fusarium	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium	0.36 %
Cryphonectria-Endothia species complex	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex	0.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Juglanconis	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis	0.73 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	15.64 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	3.64 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2.18 %
Beauveria bassiana	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana	1.82 %
Ophiocordyceps polyrhachis-furcata	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata	1.45 %
Chrysoporthe	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe	0.36 %
Fusarium sambucinum species complex	species group	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → Fusarium sambucinum species complex	0.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Juglanconis juglandina	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina	0.73 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	15.64 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	3.64 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2.18 %
Beauveria bassiana D1-5	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1.82 %
Ophiocordyceps polyrhachis-furcata BCC 54312	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312	1.45 %
Fusarium pseudograminearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → Fusarium sambucinum species complex → Fusarium pseudograminearum	0.36 %
Chrysoporthe deuterocubensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	0.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Juglanconis juglandina	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina	0.73 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Rhizophoraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae	15.64 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	3.64 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2.18 %
Beauveria bassiana D1-5	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1.82 %
Ophiocordyceps polyrhachis-furcata BCC 54312	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312	1.45 %
Fusarium pseudograminearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → Fusarium sambucinum species complex → Fusarium pseudograminearum	0.36 %
Chrysoporthe deuterocubensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	0.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Juglanconis juglandina	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina	0.73 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Rhizophora	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora	15.64 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	3.64 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2.18 %
Beauveria bassiana D1-5	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1.82 %
Ophiocordyceps polyrhachis-furcata BCC 54312	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312	1.45 %
Fusarium pseudograminearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → Fusarium sambucinum species complex → Fusarium pseudograminearum	0.36 %
Chrysoporthe deuterocubensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	0.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Juglanconis juglandina	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina	0.73 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.73 %
Rhizophora mucronata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	15.64 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	3.64 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2.18 %
Beauveria bassiana D1-5	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1.82 %
Ophiocordyceps polyrhachis-furcata BCC 54312	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312	1.45 %
Fusarium pseudograminearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → Fusarium sambucinum species complex → Fusarium pseudograminearum	0.36 %
Chrysoporthe deuterocubensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	0.36 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	0.36 %
Juglanconis juglandina	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina	0.73 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	0.73 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000305\|bgg_mtDRAFT_1018705	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	563	Open in IMG/M
3300000305\|bgg_mtDRAFT_1050411	Not Available	1312	Open in IMG/M
3300001078\|JGI12640J13246_100162	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1388	Open in IMG/M
3300001079\|JGI12696J13243_100027	Not Available	4998	Open in IMG/M
3300001417\|JGI20196J14858_1000890	Not Available	2505	Open in IMG/M
3300001661\|JGI12053J15887_10217212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	963	Open in IMG/M
3300001709\|JGI24509J20081_1000495	Not Available	9130	Open in IMG/M
3300001867\|JGI12627J18819_10000813	Not Available	10466	Open in IMG/M
3300001867\|JGI12627J18819_10010472	Not Available	3642	Open in IMG/M
3300002544\|JGI25319J35699_1000761	Not Available	16119	Open in IMG/M
3300002568\|C688J35102_120295057	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	974	Open in IMG/M
3300002568\|C688J35102_120758645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1502	Open in IMG/M
3300002568\|C688J35102_120946351	All Organisms → cellular organisms → Eukaryota	2786	Open in IMG/M
3300002677\|Ga0005475J37263_104644	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	911	Open in IMG/M
3300002915\|JGI25387J43893_1014862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1069	Open in IMG/M
3300004082\|Ga0062384_101449462	Not Available	507	Open in IMG/M
3300004213\|Ga0066648_10111314	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1509	Open in IMG/M
3300004466\|Ga0068982_1156361	Not Available	966	Open in IMG/M
3300004470\|Ga0068967_1028218	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2113	Open in IMG/M
3300004475\|Ga0068969_1487594	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	590	Open in IMG/M
3300004478\|Ga0068972_1546214	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312	1344	Open in IMG/M
3300004499\|Ga0068984_1112487	Not Available	628	Open in IMG/M
3300004506\|Ga0068973_1151852	Not Available	940	Open in IMG/M
3300004604\|Ga0068943_1288282	Not Available	622	Open in IMG/M
3300004794\|Ga0007751_11145751	Not Available	507	Open in IMG/M
3300004970\|Ga0072320_1030825	All Organisms → cellular organisms → Eukaryota	2837	Open in IMG/M
3300005347\|Ga0070668_100866848	Not Available	805	Open in IMG/M
3300005355\|Ga0070671_100467627	Not Available	1083	Open in IMG/M
3300005356\|Ga0070674_100245572	Not Available	1404	Open in IMG/M
3300005493\|Ga0068672_1104398	Not Available	660	Open in IMG/M
3300005556\|Ga0066707_10017006	Not Available	3768	Open in IMG/M
3300005562\|Ga0058697_10006375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	3792	Open in IMG/M
3300005562\|Ga0058697_10012974	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2799	Open in IMG/M
3300005562\|Ga0058697_10106211	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1171	Open in IMG/M
3300005572\|Ga0005500_1043217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1980	Open in IMG/M
3300005577\|Ga0068857_102454007	Not Available	512	Open in IMG/M
3300005661\|Ga0058698_10196650	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1156	Open in IMG/M
3300005661\|Ga0058698_10246397	Not Available	1045	Open in IMG/M
3300005661\|Ga0058698_10517812	Not Available	735	Open in IMG/M
3300005661\|Ga0058698_10922704	Not Available	549	Open in IMG/M
3300006020\|Ga0058704_10001242	Not Available	12013	Open in IMG/M
3300006020\|Ga0058704_10066240	Not Available	1859	Open in IMG/M
3300006402\|Ga0075511_1810008	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1314	Open in IMG/M
3300006425\|Ga0075486_1046472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	3351	Open in IMG/M
3300006426\|Ga0075037_1002171	Not Available	1379	Open in IMG/M
3300006644\|Ga0099767_1280245	Not Available	575	Open in IMG/M
3300006695\|Ga0031682_1164952	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312	645	Open in IMG/M
3300006969\|Ga0075419_11178583	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	564	Open in IMG/M
3300007304\|Ga0102689_1714314	Not Available	535	Open in IMG/M
3300008686\|Ga0104245_1002726	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	653	Open in IMG/M
3300009144\|Ga0058702_10117441	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1018	Open in IMG/M
3300009411\|Ga0115017_1046613	Not Available	732	Open in IMG/M
3300009448\|Ga0114940_10236694	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	800	Open in IMG/M
3300010043\|Ga0126380_10007064	Not Available	4844	Open in IMG/M
3300010057\|Ga0126365_10878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2004	Open in IMG/M
3300010076\|Ga0127430_117754	Not Available	1791	Open in IMG/M
3300010080\|Ga0127448_166465	Not Available	992	Open in IMG/M
3300010117\|Ga0127449_1133726	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1164	Open in IMG/M
3300010118\|Ga0127465_1023677	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	826	Open in IMG/M
3300010360\|Ga0126372_10002905	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	7683	Open in IMG/M
3300010855\|Ga0126355_1151488	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3685	Open in IMG/M
3300010856\|Ga0126358_1196816	All Organisms → cellular organisms → Eukaryota	2800	Open in IMG/M
3300010861\|Ga0126349_1287649	Not Available	974	Open in IMG/M
3300010862\|Ga0126348_1196727	All Organisms → cellular organisms → Eukaryota	4047	Open in IMG/M
3300010864\|Ga0126357_1031723	Not Available	640	Open in IMG/M
3300010864\|Ga0126357_1055171	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2870	Open in IMG/M
3300010864\|Ga0126357_1204719	All Organisms → cellular organisms → Eukaryota	2847	Open in IMG/M
3300010867\|Ga0126347_1033598	Not Available	1484	Open in IMG/M
3300010905\|Ga0138112_1080918	Not Available	631	Open in IMG/M
3300010980\|Ga0138321_10405382	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	544	Open in IMG/M
3300011120\|Ga0150983_13267219	All Organisms → cellular organisms → Eukaryota	3055	Open in IMG/M
3300011120\|Ga0150983_13697764	Not Available	795	Open in IMG/M
3300011340\|Ga0151652_13950386	Not Available	718	Open in IMG/M
3300011426\|Ga0151147_1147319	Not Available	1275	Open in IMG/M
3300011429\|Ga0137455_1027007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1580	Open in IMG/M
3300012212\|Ga0150985_117910366	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1523	Open in IMG/M
3300012212\|Ga0150985_121582371	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1003	Open in IMG/M
3300012375\|Ga0134034_1205316	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	810	Open in IMG/M
3300012381\|Ga0134026_1210372	Not Available	1633	Open in IMG/M
3300012385\|Ga0134023_1038172	Not Available	894	Open in IMG/M
3300012390\|Ga0134054_1109933	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	538	Open in IMG/M
3300012469\|Ga0150984_102729202	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1530	Open in IMG/M
3300012469\|Ga0150984_105353230	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1801	Open in IMG/M
3300012525\|Ga0129353_1587809	Not Available	1153	Open in IMG/M
3300012668\|Ga0157216_10003445	All Organisms → cellular organisms → Eukaryota → Opisthokonta	9566	Open in IMG/M
3300012763\|Ga0138289_1116653	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	545	Open in IMG/M
3300013024\|Ga0170682_1030837	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1097	Open in IMG/M
3300013308\|Ga0157375_10052519	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4007	Open in IMG/M
3300013861\|Ga0181449_105710	Not Available	791	Open in IMG/M
3300013865\|Ga0181471_102685	Not Available	2649	Open in IMG/M
3300014488\|Ga0182001_10155348	Not Available	786	Open in IMG/M
3300014501\|Ga0182024_11623536	Not Available	732	Open in IMG/M
3300015349\|Ga0182185_1000082	Not Available	6933	Open in IMG/M
3300017440\|Ga0182214_1069073	Not Available	726	Open in IMG/M
3300017928\|Ga0187806_1139768	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	794	Open in IMG/M
3300017972\|Ga0187781_10038528	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales	3295	Open in IMG/M
3300018044\|Ga0187890_10039216	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2853	Open in IMG/M
3300018414\|Ga0194135_10644929	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	691	Open in IMG/M
3300018414\|Ga0194135_10967885	Not Available	541	Open in IMG/M
3300018964\|Ga0193087_10129041	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312	820	Open in IMG/M
3300019090\|Ga0193578_100305	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3571	Open in IMG/M
3300019155\|Ga0184568_114719	Not Available	1445	Open in IMG/M
3300019192\|Ga0184603_135051	Not Available	546	Open in IMG/M
3300019203\|Ga0179955_1150172	Not Available	1237	Open in IMG/M
3300019227\|Ga0179956_1128424	Not Available	783	Open in IMG/M
3300019240\|Ga0181510_1324524	All Organisms → cellular organisms → Eukaryota	3145	Open in IMG/M
3300019241\|Ga0187793_1174986	Not Available	940	Open in IMG/M
3300019241\|Ga0187793_1299435	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1678	Open in IMG/M
3300019249\|Ga0184648_1315834	Not Available	2466	Open in IMG/M
3300019259\|Ga0184646_1246640	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	537	Open in IMG/M
3300019264\|Ga0187796_1369864	All Organisms → cellular organisms → Eukaryota	2749	Open in IMG/M
3300019270\|Ga0181512_1401400	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina	1925	Open in IMG/M
3300020016\|Ga0193696_1012302	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	2327	Open in IMG/M
3300020075\|Ga0206349_1451427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1303	Open in IMG/M
3300020081\|Ga0206354_11233021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	842	Open in IMG/M
3300020181\|Ga0196958_10407508	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	517	Open in IMG/M
3300020580\|Ga0210403_10189840	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1685	Open in IMG/M
3300020818\|Ga0214277_10251906	Not Available	2494	Open in IMG/M
3300021170\|Ga0210400_10018844	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5404	Open in IMG/M
3300021276\|Ga0210354_1007883	Not Available	800	Open in IMG/M
3300021291\|Ga0206694_1064822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2631	Open in IMG/M
3300021374\|Ga0213881_10200824	Not Available	881	Open in IMG/M
3300021384\|Ga0213876_10047080	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2280	Open in IMG/M
3300021560\|Ga0126371_11472671	Not Available	810	Open in IMG/M
3300021855\|Ga0213854_1121586	Not Available	659	Open in IMG/M
3300021857\|Ga0213849_1081991	Not Available	999	Open in IMG/M
3300021857\|Ga0213849_1152562	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	587	Open in IMG/M
3300021861\|Ga0213853_10500135	Not Available	845	Open in IMG/M
3300022161\|Ga0213931_1006514	Not Available	1315	Open in IMG/M
3300022523\|Ga0242663_1032823	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	846	Open in IMG/M
3300023058\|Ga0193714_1000005	Not Available	27606	Open in IMG/M
3300023063\|Ga0233335_1004430	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3028	Open in IMG/M
3300023063\|Ga0233335_1069176	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	635	Open in IMG/M
3300023259\|Ga0224551_1011571	Not Available	1475	Open in IMG/M
3300023260\|Ga0247798_1003807	Not Available	1768	Open in IMG/M
3300023291\|Ga0256703_10253936	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8856	Open in IMG/M
3300023533\|Ga0247537_101304	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	708	Open in IMG/M
3300023678\|Ga0247538_101738	Not Available	869	Open in IMG/M
3300024049\|Ga0233359_1033122	Not Available	597	Open in IMG/M
3300025711\|Ga0207696_1056255	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1114	Open in IMG/M
3300025875\|Ga0210040_10566830	Not Available	563	Open in IMG/M
3300026316\|Ga0209155_1061113	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1443	Open in IMG/M
3300026326\|Ga0209801_1068679	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	1574	Open in IMG/M
3300026528\|Ga0209378_1129713	Not Available	1063	Open in IMG/M
3300027002\|Ga0209110_1000004	Not Available	26275	Open in IMG/M
3300027058\|Ga0209111_1001045	Not Available	2029	Open in IMG/M
3300027257\|Ga0208996_1023420	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	850	Open in IMG/M
3300027530\|Ga0209216_1030654	Not Available	864	Open in IMG/M
3300027636\|Ga0214469_1118785	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	762	Open in IMG/M
3300027768\|Ga0209772_10039846	Not Available	1383	Open in IMG/M
3300027864\|Ga0209755_10651499	Not Available	900	Open in IMG/M
3300028142\|Ga0268347_1000010	Not Available	19561	Open in IMG/M
3300028573\|Ga0265334_10004604	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales	6100	Open in IMG/M
3300028586\|Ga0265798_10181427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1834	Open in IMG/M
3300028786\|Ga0307517_10181033	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1360	Open in IMG/M
3300028906\|Ga0308309_10768675	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	837	Open in IMG/M
3300029908\|Ga0311341_10033325	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4266	Open in IMG/M
3300030007\|Ga0311338_10296978	Not Available	1786	Open in IMG/M
3300030495\|Ga0268246_10000502	Not Available	16366	Open in IMG/M
3300030495\|Ga0268246_10070466	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1020	Open in IMG/M
3300030498\|Ga0268247_10006411	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3462	Open in IMG/M
3300030501\|Ga0268244_10004410	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	4641	Open in IMG/M
3300030501\|Ga0268244_10012696	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3000	Open in IMG/M
3300030501\|Ga0268244_10192785	Not Available	993	Open in IMG/M
3300030501\|Ga0268244_10843690	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	510	Open in IMG/M
3300030505\|Ga0268245_10006489	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	2164	Open in IMG/M
3300030521\|Ga0307511_10108612	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Nectriaceae → Fusarium → Fusarium sambucinum species complex → Fusarium pseudograminearum	1779	Open in IMG/M
3300030571\|Ga0247652_1021985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	879	Open in IMG/M
3300030574\|Ga0247648_1056436	Not Available	769	Open in IMG/M
3300030593\|Ga0210263_1084137	Not Available	687	Open in IMG/M
3300030692\|Ga0268250_10128708	Not Available	1116	Open in IMG/M
3300030754\|Ga0074008_10075164	Not Available	780	Open in IMG/M
3300030754\|Ga0074008_11003439	Not Available	890	Open in IMG/M
3300030758\|Ga0138305_1558065	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	540	Open in IMG/M
3300030768\|Ga0315877_125611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	615	Open in IMG/M
3300030785\|Ga0102757_10019853	Not Available	627	Open in IMG/M
3300030810\|Ga0265786_111284	Not Available	646	Open in IMG/M
3300030822\|Ga0315851_107789	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	756	Open in IMG/M
3300030840\|Ga0074020_10951409	Not Available	1006	Open in IMG/M
3300030890\|Ga0315875_108066	Not Available	1048	Open in IMG/M
3300030894\|Ga0315884_106321	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	1152	Open in IMG/M
3300030894\|Ga0315884_120360	Not Available	650	Open in IMG/M
3300030897\|Ga0315889_122076	Not Available	580	Open in IMG/M
3300030902\|Ga0308202_1008848	Not Available	1356	Open in IMG/M
3300030905\|Ga0308200_1088166	Not Available	643	Open in IMG/M
3300030915\|Ga0061011_11998245	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1334	Open in IMG/M
3300030960\|Ga0102745_1846002	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	738	Open in IMG/M
3300030962\|Ga0138297_1672352	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Juglanconidaceae → Juglanconis → Juglanconis juglandina	1172	Open in IMG/M
3300030988\|Ga0308183_1124832	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps polyrhachis-furcata → Ophiocordyceps polyrhachis-furcata BCC 54312	611	Open in IMG/M
3300030993\|Ga0308190_1100022	Not Available	635	Open in IMG/M
3300031012\|Ga0315887_101582	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1876	Open in IMG/M
3300031021\|Ga0102765_10121012	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	2446	Open in IMG/M
3300031021\|Ga0102765_11611428	Not Available	723	Open in IMG/M
3300031057\|Ga0170834_103589551	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1269	Open in IMG/M
3300031091\|Ga0308201_10128235	Not Available	769	Open in IMG/M
3300031231\|Ga0170824_121134334	Not Available	868	Open in IMG/M
3300031411\|Ga0102761_10166132	Not Available	797	Open in IMG/M
3300031422\|Ga0308186_1015132	Not Available	707	Open in IMG/M
3300031426\|Ga0315835_100073	All Organisms → cellular organisms → Eukaryota	3537	Open in IMG/M
3300031446\|Ga0170820_12822823	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1154	Open in IMG/M
3300031448\|Ga0272438_1000095	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	124066	Open in IMG/M
3300031449\|Ga0272429_1000627	Not Available	60460	Open in IMG/M
3300031449\|Ga0272429_1229085	Not Available	698	Open in IMG/M
3300031450\|Ga0272433_10001547	Not Available	40181	Open in IMG/M
3300031452\|Ga0272422_1040281	Not Available	2638	Open in IMG/M
3300031453\|Ga0272425_1003223	Not Available	24714	Open in IMG/M
3300031453\|Ga0272425_1004714	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	17793	Open in IMG/M
3300031453\|Ga0272425_1047536	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	2428	Open in IMG/M
3300031501\|Ga0265785_111032	Not Available	653	Open in IMG/M
3300031520\|Ga0272428_1044064	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	3695	Open in IMG/M
3300031520\|Ga0272428_1182707	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	1068	Open in IMG/M
3300031808\|Ga0316037_103797	Not Available	911	Open in IMG/M
3300032027\|Ga0247536_101741	Not Available	841	Open in IMG/M
3300032159\|Ga0268251_10059524	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1274	Open in IMG/M
3300032464\|Ga0214492_1088649	Not Available	583	Open in IMG/M
3300032465\|Ga0214493_1036482	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1132	Open in IMG/M
3300032467\|Ga0214488_1134623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	517	Open in IMG/M
3300032469\|Ga0214491_1134772	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	582	Open in IMG/M
3300032515\|Ga0348332_12648907	Not Available	691	Open in IMG/M
3300032625\|Ga0214501_1135798	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	785	Open in IMG/M
3300032758\|Ga0314746_1046972	Not Available	995	Open in IMG/M
3300032758\|Ga0314746_1072880	Not Available	798	Open in IMG/M
3300032760\|Ga0314754_1028941	Not Available	876	Open in IMG/M
3300032761\|Ga0314733_1103828	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	531	Open in IMG/M
3300032782\|Ga0335082_10018176	Not Available	7608	Open in IMG/M
3300032789\|Ga0314725_1001042	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	2317	Open in IMG/M
3300032812\|Ga0314745_1071087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	742	Open in IMG/M
3300032875\|Ga0314737_1089198	Not Available	512	Open in IMG/M
3300032915\|Ga0314749_1096996	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	634	Open in IMG/M
3300032954\|Ga0335083_11029372	Not Available	647	Open in IMG/M
3300032959\|Ga0314738_1042489	Not Available	828	Open in IMG/M
3300033158\|Ga0335077_10001850	Not Available	25181	Open in IMG/M
3300033181\|Ga0272431_10243068	Not Available	967	Open in IMG/M
3300033528\|Ga0316588_1040322	Not Available	1115	Open in IMG/M
3300033530\|Ga0314760_1004300	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2619	Open in IMG/M
3300033530\|Ga0314760_1052192	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1010	Open in IMG/M
3300033539\|Ga0314762_1111611	Not Available	504	Open in IMG/M
3300033540\|Ga0314764_1032033	Not Available	866	Open in IMG/M
3300033543\|Ga0314765_1033174	Not Available	1498	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.91%
Host-Associated	Host-Associated	26.55%
Engineered	Engineered	2.55%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	55.64%
Plants	Host-Associated → Plants	24.00%
Aquatic	Environmental → Aquatic	15.27%
Mammals	Host-Associated → Mammals	1.45%
Wastewater	Engineered → Wastewater	1.09%
Human	Host-Associated → Human	0.73%
Bioreactor	Engineered → Bioreactor	0.73%
Arthropoda	Host-Associated → Arthropoda	0.36%
Unclassified	Engineered → Unclassified	0.36%
Built Environment	Engineered → Built Environment	0.36%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	42.18%
Phyllosphere	Host-Associated → Plants → Phyllosphere	12.36%
Freshwater	Environmental → Aquatic → Freshwater	10.55%
Plant Litter	Environmental → Terrestrial → Plant Litter	6.55%
Phylloplane	Host-Associated → Plants → Phylloplane	5.45%
Rock-Dwelling (Endoliths)	Environmental → Terrestrial → Rock-Dwelling (Endoliths)	4.73%
Marine	Environmental → Aquatic → Marine	4.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.64%
Digestive System	Host-Associated → Mammals → Digestive System	1.45%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.45%
Peat	Environmental → Terrestrial → Peat	1.09%
Roots	Host-Associated → Plants → Roots	1.09%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.73%
Digestive System	Host-Associated → Human → Digestive System	0.73%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.73%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.36%
Sediment	Environmental → Aquatic → Sediment	0.36%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.36%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.36%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.36%
Unclassified	Engineered → Unclassified → Unclassified	0.36%
Anaerobic	Engineered → Bioreactor → Anaerobic	0.36%
Aerobic	Engineered → Bioreactor → Aerobic	0.36%
Unclassified	Engineered → Built Environment → Unclassified	0.36%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	32.00%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	10.18%
Loam	Environmental → Terrestrial → Soil → Loam	6.55%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	6.55%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	5.45%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified	4.73%
Sediment	Environmental → Aquatic → Freshwater → Sediment	4.36%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.27%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.91%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.18%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	2.18%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.45%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.45%
Coastal	Environmental → Aquatic → Marine → Coastal	1.09%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.09%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.09%
Foregut	Host-Associated → Mammals → Digestive System → Foregut	1.09%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.09%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.09%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.73%
Creek	Environmental → Aquatic → Freshwater → Creek	0.73%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.73%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.73%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.73%
Lake	Environmental → Aquatic → Freshwater → Lake	0.36%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.36%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.36%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.36%
Sand	Environmental → Terrestrial → Soil → Sand	0.36%
Clay	Environmental → Terrestrial → Deep Subsurface → Clay	0.36%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.36%
Large Intestine	Host-Associated → Mammals → Digestive System → Large Intestine	0.36%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.36%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.36%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified	0.36%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	0.36%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified	0.36%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	0.36%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.64%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	10.18%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.82%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	6.55%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	5.45%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.73%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified	4.73%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	4.36%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.55%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	2.18%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.18%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	2.18%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.45%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	1.45%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.45%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.09%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.09%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.09%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.09%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.09%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.73%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.73%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.73%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.73%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.73%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.73%
Unclassified	Host-Associated → Mammals → Digestive System → Foregut → Unclassified	0.73%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.73%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.36%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.36%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.36%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.36%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.36%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.36%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.36%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.36%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified	0.36%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.36%
Fecal	Host-Associated → Mammals → Digestive System → Large Intestine → Fecal	0.36%
Rumen	Host-Associated → Mammals → Digestive System → Foregut → Rumen	0.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.36%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.36%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified → Unclassified	0.36%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	0.36%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified → Unclassified	0.36%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified → Unclassified	0.36%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	9.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.27%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	5.45%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	5.45%
Rock	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock	4.73%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.36%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.64%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	3.27%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	3.27%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	2.91%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	2.18%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.82%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.82%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.45%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.09%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.09%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.09%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.09%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	1.09%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.09%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.73%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.73%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.73%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.73%
Deep Ocean	Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean	0.73%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	0.73%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.73%
Leaf Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter	0.73%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.73%
Fungi-Associated Bovine Rumen	Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen	0.73%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.73%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.73%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.73%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.36%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.36%
Wetland	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland	0.36%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.36%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	0.36%
Seawater	Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater	0.36%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.36%
Continental Margin Sediment	Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment	0.36%
Anoxygenic And Chlorotrophic Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat	0.36%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.36%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.36%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.36%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.36%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.36%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.36%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.36%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.36%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.36%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface	0.36%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.36%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.36%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.36%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.36%
Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock	0.36%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.36%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.36%
Elk Feces	Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces	0.36%
Rumen	Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen	0.36%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.36%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.36%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.36%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.36%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.36%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.36%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.36%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.36%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.36%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.36%
Clean Room	Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Clean Room	0.36%
Food Waste	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste	0.36%
Food Waste	Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste	0.36%
Clean Room	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room	0.36%
Fermented Vegetables	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Fermented Vegetables	0.36%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000305	Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly	Host-Associated	Open in IMG/M
3300001078	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2	Environmental	Open in IMG/M
3300001079	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1	Environmental	Open in IMG/M
3300001417	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300001709	Marine viral communities from the Pacific Ocean - LP-29	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300002544	Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/17	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300002677	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300002915	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm	Environmental	Open in IMG/M
3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300004082	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3	Environmental	Open in IMG/M
3300004213	Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA	Environmental	Open in IMG/M
3300004466	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 80 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004470	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004475	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004478	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004499	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004506	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 70 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004604	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004794	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004970	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005493	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP NP_0700 MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005572	Marine microbial communities from the Deep Atlantic Ocean - MP0139 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005661	Agave microbial communities from Guanajuato, Mexico - As.Sf.e	Host-Associated	Open in IMG/M
3300006020	Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e	Host-Associated	Open in IMG/M
3300006402	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006425	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006426	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006644	Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_A2_L (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006695	Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP324 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007304	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300008686	Food microbial communities from the fermentation process of Kimchi from South Korea - J7	Environmental	Open in IMG/M
3300009144	Agave microbial communities from Guanajuato, Mexico - Or.Sf.e	Host-Associated	Open in IMG/M
3300009411	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300009448	Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010057	Continental margin sediment microbial communities from China - WA_23_40 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010076	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010080	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010117	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010118	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010146	Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010855	Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010856	Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010861	Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010862	Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010864	Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010867	Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010905	Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010980	Metatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-1 corn stover (Eukaryote Community Metatranscriptome) (version 8)	Host-Associated	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011340	Combined Assembly of Wetland Metatranscriptomes	Environmental	Open in IMG/M
3300011426	Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Host-Associated	Open in IMG/M
3300011429	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012375	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012378	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012381	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012385	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012390	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012525	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012668	Arctic soils microbial communities. Combined Assembly of 23 SPs	Environmental	Open in IMG/M
3300012763	Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013024	Gypsum crust hypoendolithic microbial communities from the Atacama Desert, Chile - KM37, HE	Environmental	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013861	Clean room spacecraft assembly facility microbial communities from NASA Jet Propulsion Laboratory, California, USA - Floor swab, replicate A SPAdes reassembly	Engineered	Open in IMG/M
3300013865	Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In5p-11 gowning area SPAdes reassembly	Engineered	Open in IMG/M
3300014488	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017928	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018044	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10	Environmental	Open in IMG/M
3300018414	Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013	Environmental	Open in IMG/M
3300018964	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)	Environmental	Open in IMG/M
3300019090	Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-8	Environmental	Open in IMG/M
3300019155	Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019192	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019203	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR2_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019227	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR3_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019240	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019241	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019249	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019258	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019259	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019264	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019270	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental	Open in IMG/M
3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020181	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020818	Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2	Engineered	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021276	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.491 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021291	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021374	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08	Environmental	Open in IMG/M
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300021855	Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021857	Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021858	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021967	Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022161	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022523	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300023058	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1	Environmental	Open in IMG/M
3300023063	Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-222	Environmental	Open in IMG/M
3300023259	Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24	Environmental	Open in IMG/M
3300023260	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6	Environmental	Open in IMG/M
3300023291	Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119	Engineered	Open in IMG/M
3300023533	Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023678	Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023697	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024049	Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30	Environmental	Open in IMG/M
3300024486	Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 RNA GHGlow gp2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025875	Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA (SPAdes)	Environmental	Open in IMG/M
3300026316	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)	Environmental	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300027002	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027058	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027257	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes)	Environmental	Open in IMG/M
3300027530	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)	Environmental	Open in IMG/M
3300027636	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq	Environmental	Open in IMG/M
3300027718	Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)	Host-Associated	Open in IMG/M
3300027768	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)	Environmental	Open in IMG/M
3300027864	Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1 (SPAdes)	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Host-Associated	Open in IMG/M
3300028586	Plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T30	Environmental	Open in IMG/M
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300029908	II_Bog_E1 coassembly	Environmental	Open in IMG/M
3300030007	I_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300030495	Agave microbial communities from Guanajuato, Mexico - Or.Sf.e (v2)	Host-Associated	Open in IMG/M
3300030498	Agave microbial communities from Guanajuato, Mexico - Or.Ma.e (v2)	Host-Associated	Open in IMG/M
3300030501	Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)	Host-Associated	Open in IMG/M
3300030505	Agave microbial communities from Guanajuato, Mexico - Mg.Ma.e (v2)	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030571	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030574	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030593	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030634	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030692	Agave microbial communities from Guanajuato, Mexico - As.Sf.e (v2)	Host-Associated	Open in IMG/M
3300030754	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030758	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030768	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T30 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030785	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030810	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030822	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T21 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030827	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T28 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030837	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T27 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030840	Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030851	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030890	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T29 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030894	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T32 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030897	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T34 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030901	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T29 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030902	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030905	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030915	Coassembly of Cow X Corn Stover	Host-Associated	Open in IMG/M
3300030922	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030960	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030962	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030988	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030993	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031012	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T33 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031021	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031082	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031091	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031097	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_183 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031411	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031422	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031426	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T16 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031448	Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead nord	Environmental	Open in IMG/M
3300031449	Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sud	Environmental	Open in IMG/M
3300031450	Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud	Environmental	Open in IMG/M
3300031452	Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nord	Environmental	Open in IMG/M
3300031453	Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sud	Environmental	Open in IMG/M
3300031460	Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nord	Environmental	Open in IMG/M
3300031501	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031520	Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord	Environmental	Open in IMG/M
3300031808	Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300031816	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300032027	Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLE4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300032159	Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)	Host-Associated	Open in IMG/M
3300032464	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032757	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032760	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032789	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032875	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032889	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300032959	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental	Open in IMG/M
3300033181	Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud	Environmental	Open in IMG/M
3300033523	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033539	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033540	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033543	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F013050

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign