NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012678

Metagenome / Metatranscriptome Family F012678

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012678
Family Type Metagenome / Metatranscriptome
Number of Sequences 278
Average Sequence Length 61 residues
Representative Sequence MLNQHSLEEIADIHNLLEDIKKEYEEGIKPILVKNSPSRFRNPHTVPKLKKIQINRGLGL
Number of Associated Samples 222
Number of Associated Scaffolds 278

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 21.30 %
% of genes near scaffold ends (potentially truncated) 84.89 %
% of genes from short scaffolds (< 2000 bps) 83.09 %
Associated GOLD sequencing projects 205
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.705 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(25.180 % of family members)
Environment Ontology (ENVO) Unclassified
(38.489 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.223 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.91%    β-sheet: 0.00%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 278 Family Scaffolds
PF17136ribosomal_L24 33.09
PF00238Ribosomal_L14 32.01
PF00366Ribosomal_S17 8.63
PF00252Ribosomal_L16 5.76
PF00281Ribosomal_L5 3.96
PF00467KOW 2.88
PF00673Ribosomal_L5_C 2.52
PF00831Ribosomal_L29 2.52
PF07650KH_2 2.16
PF00237Ribosomal_L22 2.16
PF00410Ribosomal_S8 1.08
PF00189Ribosomal_S3_C 0.72
PF00347Ribosomal_L6 0.72
PF00012HSP70 0.36
PF00266Aminotran_5 0.36
PF00203Ribosomal_S19 0.36
PF01197Ribosomal_L31 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 278 Family Scaffolds
COG0093Ribosomal protein L14Translation, ribosomal structure and biogenesis [J] 32.01
COG0186Ribosomal protein S17Translation, ribosomal structure and biogenesis [J] 8.63
COG0094Ribosomal protein L5Translation, ribosomal structure and biogenesis [J] 6.47
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 5.76
COG0255Ribosomal protein L29Translation, ribosomal structure and biogenesis [J] 2.52
COG0091Ribosomal protein L22Translation, ribosomal structure and biogenesis [J] 2.16
COG0096Ribosomal protein S8Translation, ribosomal structure and biogenesis [J] 1.08
COG0092Ribosomal protein S3Translation, ribosomal structure and biogenesis [J] 0.72
COG0097Ribosomal protein L6P/L9ETranslation, ribosomal structure and biogenesis [J] 0.72
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 0.36
COG0254Ribosomal protein L31Translation, ribosomal structure and biogenesis [J] 0.36
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.77 %
UnclassifiedrootN/A12.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000119|KGI_S1_ANT01_95mDRAFT_c10161163All Organisms → cellular organisms → Eukaryota602Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10021477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1974Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10184627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria669Open in IMG/M
3300000132|KGI_S2_ANT05_2345mDRAFT_c1072210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales545Open in IMG/M
3300001265|BBAY84_10132892All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300003553|Ga0008454J51686_124297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria590Open in IMG/M
3300003997|Ga0055466_10168824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria633Open in IMG/M
3300004212|Ga0066631_10485952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria514Open in IMG/M
3300004463|Ga0063356_103732171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria656Open in IMG/M
3300005617|Ga0068859_102919425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria523Open in IMG/M
3300005824|Ga0074474_1060846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria717Open in IMG/M
3300005824|Ga0074474_1611432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria602Open in IMG/M
3300005827|Ga0074478_1174180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria902Open in IMG/M
3300005827|Ga0074478_1388592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales552Open in IMG/M
3300005961|Ga0075157_10395637All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005987|Ga0075158_10381960All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300006374|Ga0075512_1298777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria627Open in IMG/M
3300006379|Ga0075513_1020527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1819Open in IMG/M
3300006397|Ga0075488_1577806All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300007228|Ga0075175_1416222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1287Open in IMG/M
3300007321|Ga0102692_1620572Not Available1271Open in IMG/M
3300007552|Ga0102818_1027637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1120Open in IMG/M
3300007555|Ga0102817_1125542All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta569Open in IMG/M
3300007614|Ga0102946_1238143All Organisms → cellular organisms → Eukaryota → Sar656Open in IMG/M
3300007614|Ga0102946_1293140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria599Open in IMG/M
3300007649|Ga0102912_1192954All Organisms → cellular organisms → Eukaryota → Sar584Open in IMG/M
3300007661|Ga0102866_1096291Not Available735Open in IMG/M
3300007681|Ga0102824_1000263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria20390Open in IMG/M
3300007715|Ga0102827_1077609Not Available747Open in IMG/M
3300007716|Ga0102867_1175308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria585Open in IMG/M
3300007864|Ga0105749_1155061All Organisms → cellular organisms → Eukaryota → Sar540Open in IMG/M
3300007955|Ga0105740_1030259Not Available794Open in IMG/M
3300008052|Ga0102893_1125651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria754Open in IMG/M
3300008122|Ga0114359_1030723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2076Open in IMG/M
3300008929|Ga0103732_1001194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2503Open in IMG/M
3300008930|Ga0103733_1003776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1830Open in IMG/M
3300008930|Ga0103733_1055465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria628Open in IMG/M
3300008934|Ga0103737_1026559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria735Open in IMG/M
3300008936|Ga0103739_1050656All Organisms → cellular organisms → Eukaryota → Sar583Open in IMG/M
3300008961|Ga0102887_1277078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria504Open in IMG/M
3300009002|Ga0102810_1255016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria541Open in IMG/M
3300009024|Ga0102811_1285086All Organisms → cellular organisms → Eukaryota618Open in IMG/M
3300009026|Ga0102829_1266170All Organisms → cellular organisms → Eukaryota → Sar566Open in IMG/M
3300009058|Ga0102854_1056368Not Available1127Open in IMG/M
3300009080|Ga0102815_10404118Not Available759Open in IMG/M
3300009086|Ga0102812_10745494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria541Open in IMG/M
3300009221|Ga0103849_1004731All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300009225|Ga0103851_1003607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1974Open in IMG/M
3300009435|Ga0115546_1321464All Organisms → cellular organisms → Eukaryota → Sar527Open in IMG/M
3300009441|Ga0115007_10255620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1134Open in IMG/M
3300009467|Ga0115565_10240662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria829Open in IMG/M
3300009543|Ga0115099_10130973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria778Open in IMG/M
3300009543|Ga0115099_10289278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3074Open in IMG/M
3300009543|Ga0115099_10411804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15215Open in IMG/M
3300009544|Ga0115006_11249820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria665Open in IMG/M
3300009550|Ga0115013_10518211All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300009592|Ga0115101_1035361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4526Open in IMG/M
3300009592|Ga0115101_1202482Not Available744Open in IMG/M
3300009592|Ga0115101_1638874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria603Open in IMG/M
3300009592|Ga0115101_1790885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3371Open in IMG/M
3300009593|Ga0115011_11346933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria623Open in IMG/M
3300009599|Ga0115103_1062726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales717Open in IMG/M
3300009599|Ga0115103_1313185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5602Open in IMG/M
3300009599|Ga0115103_1410461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria16448Open in IMG/M
3300009599|Ga0115103_1524966All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300009599|Ga0115103_1802912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria15536Open in IMG/M
3300009608|Ga0115100_10598957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1729Open in IMG/M
3300009730|Ga0123359_193560All Organisms → cellular organisms → Eukaryota → Sar580Open in IMG/M
3300010152|Ga0126318_10662616All Organisms → cellular organisms → Eukaryota → Sar922Open in IMG/M
3300010309|Ga0102890_1029837Not Available1068Open in IMG/M
3300011308|Ga0138393_1106198Not Available1023Open in IMG/M
3300012413|Ga0138258_1357840All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta509Open in IMG/M
3300012414|Ga0138264_1363683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2688Open in IMG/M
3300012414|Ga0138264_1390066All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300012415|Ga0138263_1118711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4974Open in IMG/M
3300012416|Ga0138259_1885105All Organisms → cellular organisms → Eukaryota → Sar636Open in IMG/M
3300012417|Ga0138262_1265244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria519Open in IMG/M
3300012417|Ga0138262_1663073Not Available1208Open in IMG/M
3300012472|Ga0129328_1044429All Organisms → cellular organisms → Eukaryota → Sar517Open in IMG/M
3300012472|Ga0129328_1095356All Organisms → cellular organisms → Eukaryota → Sar609Open in IMG/M
3300012748|Ga0157553_1034490All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta616Open in IMG/M
3300012920|Ga0160423_10106513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1980Open in IMG/M
3300012935|Ga0138257_1340863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2163Open in IMG/M
3300012935|Ga0138257_1484026All Organisms → cellular organisms → Bacteria4748Open in IMG/M
3300012952|Ga0163180_11823087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria517Open in IMG/M
3300015360|Ga0163144_11347001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria640Open in IMG/M
3300017728|Ga0181419_1104306All Organisms → cellular organisms → Eukaryota696Open in IMG/M
3300017753|Ga0181407_1066188Not Available932Open in IMG/M
3300017779|Ga0181395_1042650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1513Open in IMG/M
3300017782|Ga0181380_1282450All Organisms → cellular organisms → Eukaryota → Sar546Open in IMG/M
3300017964|Ga0181589_10558898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales732Open in IMG/M
3300018426|Ga0181566_10970773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria573Open in IMG/M
3300018428|Ga0181568_10076736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2816Open in IMG/M
3300018603|Ga0192881_1000023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6369Open in IMG/M
3300018605|Ga0193339_1000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7120Open in IMG/M
3300018605|Ga0193339_1007897Not Available955Open in IMG/M
3300018605|Ga0193339_1008736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria919Open in IMG/M
3300018605|Ga0193339_1013734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria768Open in IMG/M
3300018636|Ga0193377_1001949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1359Open in IMG/M
3300018683|Ga0192952_1025886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria600Open in IMG/M
3300018684|Ga0192983_1003837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1495Open in IMG/M
3300018692|Ga0192944_1007940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1296Open in IMG/M
3300018692|Ga0192944_1030337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria782Open in IMG/M
3300018692|Ga0192944_1030582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales779Open in IMG/M
3300018713|Ga0192887_1027411Not Available744Open in IMG/M
3300018723|Ga0193038_1061952All Organisms → cellular organisms → Eukaryota575Open in IMG/M
3300018747|Ga0193147_1048203Not Available722Open in IMG/M
3300018763|Ga0192827_1022339All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300018791|Ga0192950_1000035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4931Open in IMG/M
3300018791|Ga0192950_1037285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales701Open in IMG/M
3300018791|Ga0192950_1059191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria573Open in IMG/M
3300018791|Ga0192950_1059828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria570Open in IMG/M
3300018844|Ga0193312_1036654All Organisms → cellular organisms → Eukaryota684Open in IMG/M
3300018860|Ga0193192_1021800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria772Open in IMG/M
3300018927|Ga0193083_10001378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1663Open in IMG/M
3300018927|Ga0193083_10020237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria854Open in IMG/M
3300018947|Ga0193066_10002248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2702Open in IMG/M
3300018947|Ga0193066_10127723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria743Open in IMG/M
3300018964|Ga0193087_10103124All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300018979|Ga0193540_10000468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales2806Open in IMG/M
3300018980|Ga0192961_10167414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria667Open in IMG/M
3300018981|Ga0192968_10003835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3340Open in IMG/M
3300018981|Ga0192968_10092751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria809Open in IMG/M
3300018982|Ga0192947_10001032All Organisms → cellular organisms → Bacteria3700Open in IMG/M
3300018989|Ga0193030_10001251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2390Open in IMG/M
3300019000|Ga0192953_10140568All Organisms → cellular organisms → Eukaryota → Sar603Open in IMG/M
3300019001|Ga0193034_10025024Not Available1052Open in IMG/M
3300019001|Ga0193034_10071458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria753Open in IMG/M
3300019007|Ga0193196_10302039All Organisms → cellular organisms → Eukaryota → Sar688Open in IMG/M
3300019009|Ga0192880_10000013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria13931Open in IMG/M
3300019009|Ga0192880_10000392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4423Open in IMG/M
3300019009|Ga0192880_10002076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2937Open in IMG/M
3300019021|Ga0192982_10000877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3391Open in IMG/M
3300019021|Ga0192982_10001855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2861Open in IMG/M
3300019022|Ga0192951_10035206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1301Open in IMG/M
3300019036|Ga0192945_10000126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6343Open in IMG/M
3300019036|Ga0192945_10121042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria834Open in IMG/M
3300019040|Ga0192857_10289946All Organisms → cellular organisms → Eukaryota → Sar556Open in IMG/M
3300019045|Ga0193336_10015160All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300019049|Ga0193082_10023395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1602Open in IMG/M
3300019049|Ga0193082_10064379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1301Open in IMG/M
3300019049|Ga0193082_10632043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya603Open in IMG/M
3300019050|Ga0192966_10054234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1263Open in IMG/M
3300019050|Ga0192966_10270515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria602Open in IMG/M
3300019053|Ga0193356_10008490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2007Open in IMG/M
3300019053|Ga0193356_10168495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria767Open in IMG/M
3300019103|Ga0192946_1006005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1549Open in IMG/M
3300019103|Ga0192946_1014774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1128Open in IMG/M
3300019123|Ga0192980_1000139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4830Open in IMG/M
3300019133|Ga0193089_1148921All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta517Open in IMG/M
3300019214|Ga0180037_1264954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria734Open in IMG/M
3300019696|Ga0194017_1032040All Organisms → cellular organisms → Eukaryota → Sar600Open in IMG/M
3300019701|Ga0194015_1008934All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300019702|Ga0193997_1035691All Organisms → cellular organisms → Eukaryota → Sar588Open in IMG/M
3300019704|Ga0193979_1025588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria666Open in IMG/M
3300019712|Ga0193969_1060320Not Available513Open in IMG/M
3300019718|Ga0193999_1059110All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300019725|Ga0193980_1025615Not Available709Open in IMG/M
3300019726|Ga0193974_1022225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria729Open in IMG/M
3300019732|Ga0194014_1000783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2856Open in IMG/M
3300019734|Ga0193970_1026835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales710Open in IMG/M
3300019739|Ga0194012_1008015Not Available1021Open in IMG/M
3300019739|Ga0194012_1016023All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300019744|Ga0193998_1014819All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300019748|Ga0194018_1000943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3186Open in IMG/M
3300019752|Ga0193958_1106146All Organisms → cellular organisms → Eukaryota → Sar586Open in IMG/M
3300019765|Ga0194024_1006857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae2349Open in IMG/M
3300019766|Ga0193959_1061109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1084Open in IMG/M
3300019935|Ga0193950_1005798Not Available1578Open in IMG/M
3300020190|Ga0194118_10153702Not Available1352Open in IMG/M
3300020198|Ga0194120_10311220Not Available785Open in IMG/M
3300021263|Ga0210343_159588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Aphanothecaceae589Open in IMG/M
3300021266|Ga0210348_103459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1679Open in IMG/M
3300021266|Ga0210348_109822Not Available1271Open in IMG/M
3300021276|Ga0210354_1066519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2276Open in IMG/M
3300021277|Ga0210352_165021All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300021283|Ga0210357_1058906All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta629Open in IMG/M
3300021293|Ga0210358_123820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria636Open in IMG/M
3300021297|Ga0210369_1007560All Organisms → cellular organisms → Eukaryota → Sar601Open in IMG/M
3300021299|Ga0210302_1024722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1097Open in IMG/M
3300021305|Ga0210296_1092083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1155Open in IMG/M
3300021309|Ga0210326_1224531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2873Open in IMG/M
3300021313|Ga0210333_1139550Not Available943Open in IMG/M
3300021313|Ga0210333_1257642All Organisms → cellular organisms → Bacteria4077Open in IMG/M
3300021323|Ga0210295_1013935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria677Open in IMG/M
3300021323|Ga0210295_1164125Not Available764Open in IMG/M
3300021350|Ga0206692_1047251All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300021350|Ga0206692_1590756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria535Open in IMG/M
3300021356|Ga0213858_10058596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1869Open in IMG/M
3300021365|Ga0206123_10040582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2500Open in IMG/M
3300021365|Ga0206123_10462260All Organisms → cellular organisms → Eukaryota → Sar513Open in IMG/M
3300021424|Ga0194117_10219734All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300021458|Ga0193946_1033579All Organisms → cellular organisms → Eukaryota → Sar571Open in IMG/M
3300021465|Ga0193947_1015843Not Available1169Open in IMG/M
3300021847|Ga0210305_1105150All Organisms → cellular organisms → Eukaryota571Open in IMG/M
3300021847|Ga0210305_1112327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1959Open in IMG/M
3300021858|Ga0213852_1133455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1126Open in IMG/M
3300021859|Ga0210334_10589872All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300022202|Ga0224498_10071314All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300022306|Ga0224509_10008343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae3280Open in IMG/M
3300022369|Ga0210310_1002312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1661Open in IMG/M
3300022369|Ga0210310_1002994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1498Open in IMG/M
3300022369|Ga0210310_1018846Not Available699Open in IMG/M
3300022372|Ga0210293_100566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae3112Open in IMG/M
3300022373|Ga0210319_1005146All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300022389|Ga0210318_1009893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1268Open in IMG/M
3300022549|Ga0212091_10188922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria826Open in IMG/M
3300022903|Ga0247774_1043585All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300024304|Ga0233391_1008002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria539Open in IMG/M
(restricted) 3300024340|Ga0255042_10331853All Organisms → cellular organisms → Eukaryota → Sar509Open in IMG/M
3300024343|Ga0244777_10439336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria808Open in IMG/M
3300024343|Ga0244777_10607280All Organisms → cellular organisms → Eukaryota → Sar662Open in IMG/M
3300024346|Ga0244775_11407516All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta536Open in IMG/M
3300024348|Ga0244776_10066668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae2759Open in IMG/M
3300024532|Ga0256352_1030352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia969Open in IMG/M
3300024573|Ga0256337_1015296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1877Open in IMG/M
3300025130|Ga0209594_1031408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1807Open in IMG/M
3300025573|Ga0210133_1016220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1588Open in IMG/M
3300025583|Ga0210085_1143215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria639Open in IMG/M
3300025821|Ga0209600_1201674All Organisms → cellular organisms → Eukaryota → Sar522Open in IMG/M
3300025832|Ga0209307_1092921All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300025841|Ga0210028_1091339All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300025892|Ga0209630_10172685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1076Open in IMG/M
3300025895|Ga0209567_10656277All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita509Open in IMG/M
3300026106|Ga0209927_1058458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria515Open in IMG/M
3300026123|Ga0209955_1017858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1655Open in IMG/M
3300026130|Ga0209961_1009491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2385Open in IMG/M
3300026130|Ga0209961_1033905All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300026837|Ga0209856_1003237Not Available773Open in IMG/M
3300027183|Ga0208798_1041701All Organisms → cellular organisms → Eukaryota526Open in IMG/M
3300027186|Ga0208797_1023872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria813Open in IMG/M
3300027216|Ga0208677_1049521All Organisms → cellular organisms → Eukaryota → Sar555Open in IMG/M
3300027228|Ga0208308_1045780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria589Open in IMG/M
3300027237|Ga0208930_1025915Not Available831Open in IMG/M
3300027237|Ga0208930_1038650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria659Open in IMG/M
3300027243|Ga0208174_1016918Not Available920Open in IMG/M
3300027246|Ga0208931_1007893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2359Open in IMG/M
3300027254|Ga0208177_1046296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria821Open in IMG/M
3300027308|Ga0208796_1079361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales696Open in IMG/M
3300027315|Ga0208949_1022820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1260Open in IMG/M
3300027416|Ga0207994_1003852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae3098Open in IMG/M
3300027525|Ga0208437_1003002All Organisms → cellular organisms → Bacteria4680Open in IMG/M
3300027673|Ga0209278_1088249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1043Open in IMG/M
3300027739|Ga0209575_10178030Not Available759Open in IMG/M
3300027757|Ga0208671_10337357All Organisms → cellular organisms → Eukaryota529Open in IMG/M
3300027781|Ga0209175_10456064All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta529Open in IMG/M
3300027833|Ga0209092_10443929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria672Open in IMG/M
(restricted) 3300027837|Ga0255041_10112604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria912Open in IMG/M
3300027859|Ga0209503_10431762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria651Open in IMG/M
3300027883|Ga0209713_10848706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria574Open in IMG/M
3300027917|Ga0209536_100328344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1914Open in IMG/M
3300028420|Ga0210366_10119695All Organisms → cellular organisms → Eukaryota → Sar939Open in IMG/M
(restricted) 3300028559|Ga0247831_1113907Not Available1146Open in IMG/M
3300028599|Ga0265309_10479336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria825Open in IMG/M
3300028599|Ga0265309_10777374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales653Open in IMG/M
3300028599|Ga0265309_11206110All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta526Open in IMG/M
3300028600|Ga0265303_11104106All Organisms → cellular organisms → Eukaryota → Sar658Open in IMG/M
3300028600|Ga0265303_11212306All Organisms → cellular organisms → Eukaryota → Sar628Open in IMG/M
3300028645|Ga0302158_1085397All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta503Open in IMG/M
3300028674|Ga0302161_10024567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1438Open in IMG/M
3300028674|Ga0302161_10122400All Organisms → cellular organisms → Eukaryota → Sar663Open in IMG/M
3300031175|Ga0308020_1149229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria685Open in IMG/M
3300031209|Ga0307955_1017616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales1526Open in IMG/M
3300031521|Ga0311364_11512965All Organisms → cellular organisms → Eukaryota → Sar663Open in IMG/M
3300031523|Ga0307492_10014088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2876Open in IMG/M
3300031602|Ga0307993_1028457Not Available1400Open in IMG/M
3300032050|Ga0315906_10644928All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300032073|Ga0315315_10176752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1993Open in IMG/M
3300032073|Ga0315315_10947436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales775Open in IMG/M
3300032073|Ga0315315_11517665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Aphanothecaceae580Open in IMG/M
3300032156|Ga0315295_11174327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria754Open in IMG/M
3300032258|Ga0316191_10866774All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300032260|Ga0316192_11057958All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta542Open in IMG/M
3300032272|Ga0316189_10935633All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300034096|Ga0335025_0505385All Organisms → cellular organisms → Eukaryota → Sar608Open in IMG/M
3300034105|Ga0335035_0310032Not Available928Open in IMG/M
3300034119|Ga0335054_0726721All Organisms → cellular organisms → Eukaryota530Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine25.18%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine20.86%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment5.76%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.24%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine3.24%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.16%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.80%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.80%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment1.80%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.80%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.80%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.44%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.44%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.44%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.44%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.08%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.08%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat1.08%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.08%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.08%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.08%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.08%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.08%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.08%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.72%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.72%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.72%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.72%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.72%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.72%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.72%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.36%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.36%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.36%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.36%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.36%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer0.36%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.36%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.36%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.36%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.36%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.36%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.36%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.36%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.36%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.36%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.36%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.36%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.36%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.36%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.36%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000119Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5mEnvironmentalOpen in IMG/M
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000132Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 05_23.45mEnvironmentalOpen in IMG/M
3300001265Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY84Host-AssociatedOpen in IMG/M
3300003553Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_18_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004212Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005824Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBCEnvironmentalOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005961Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNAEngineeredOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007228Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007321Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007614Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MGEnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008122Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTREnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009221Microbial communities of water from Amazon river, Brazil - RCM2EnvironmentalOpen in IMG/M
3300009225Microbial communities of water from Amazon river, Brazil - RCM4EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009730Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_177_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300011308Marine microbial communities from the Southern Atlantic ocean - KN S18 NT29 metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012748Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES045 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019696Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_3-4_MGEnvironmentalOpen in IMG/M
3300019701Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MGEnvironmentalOpen in IMG/M
3300019702Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_3-4_MGEnvironmentalOpen in IMG/M
3300019704Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_0-1_MGEnvironmentalOpen in IMG/M
3300019712Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_5-6_MGEnvironmentalOpen in IMG/M
3300019718Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MGEnvironmentalOpen in IMG/M
3300019725Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_1-2_MGEnvironmentalOpen in IMG/M
3300019726Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_10-11_MGEnvironmentalOpen in IMG/M
3300019732Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MGEnvironmentalOpen in IMG/M
3300019734Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_6-7_MGEnvironmentalOpen in IMG/M
3300019739Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MGEnvironmentalOpen in IMG/M
3300019744Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_4-5_MGEnvironmentalOpen in IMG/M
3300019748Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_4-5_MGEnvironmentalOpen in IMG/M
3300019752Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_1_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300019766Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_2_MGEnvironmentalOpen in IMG/M
3300019935Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - BB_1_MGEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300021263Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.433 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021266Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.458 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021276Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.491 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021277Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.487 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021283Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.587 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021293Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.589 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021297Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.669 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021299Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021309Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.266 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021313Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.304 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021458Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_1-2_MGEnvironmentalOpen in IMG/M
3300021465Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_0-1_MGEnvironmentalOpen in IMG/M
3300021847Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022372Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022373Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.180 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022389Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.24 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022549Cold Creek_combined assemblyEnvironmentalOpen in IMG/M
3300022903Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6EnvironmentalOpen in IMG/M
3300024304Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_10_July_PBEnvironmentalOpen in IMG/M
3300024340 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024532Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025130Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes)EnvironmentalOpen in IMG/M
3300025573Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025583Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025821Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025841Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025895Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)EnvironmentalOpen in IMG/M
3300026106Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D1_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026123Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026837Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027183Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 (SPAdes)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027216Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027228Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027237Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027246Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027315Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027673Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA (SPAdes)EngineeredOpen in IMG/M
3300027739Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028420Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028645Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_1EnvironmentalOpen in IMG/M
3300028674Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1EnvironmentalOpen in IMG/M
3300031175Marine microbial communities from water near the shore, Antarctic Ocean - #349EnvironmentalOpen in IMG/M
3300031209Saline water microbial communities from Organic Lake, Antarctica - #439EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
KGI_S1_ANT01_95mDRAFT_1016116333300000119MarineMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKIS
BS_KBA_SWE12_21mDRAFT_1002147773300000124MarineMRNPNSLEEVAEIHSLLTDIKKEYTEGIRGVLRKNDPELFRNVHTIPKLEKIQINRGLGLAAQNTN
SA_S2_NOR15_50mDRAFT_1018462713300000130MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILISNSPSRFRNPHTVPKLKKIQINRGLGLAAQNT
KGI_S2_ANT05_2345mDRAFT_107221013300000132MarineMLNQHSLEEIADIHNLLVDIKKEYEKGIKPILIKNNPKFFRNPHTVPKLKKIQINR
BBAY84_1013289223300001265Macroalgal SurfaceMLNQHSLEEIADIHNLLEDIKKEYNYGIKPILINHSPSRFKNPHTVPKLKKIQINRGLGLAAQSTNILKKNIP*
Ga0008454J51686_12429733300003553SeawaterMLNQHSLEEIGDIYNLLEDIQKEYEEGIKPILIKNSPSRFKNPHTVPKLKKIQINRGLGLAA
Ga0055466_1016882433300003997Natural And Restored WetlandsMLNQHSLEEIADIHNLLGDIKKEYEEGIKPILMKNSPSRFRNPHTVPKLKKIKINRGLGL
Ga0066631_1048595223300004212GroundwaterMLNQHSLEEIADIHNLLGDIKKEYNEGIKPILIKNSPKLFKNPHTVPKLKKIQINRGLGL
Ga0063356_10373217113300004463Arabidopsis Thaliana RhizosphereMLNQQSLEEIAEIHSLLSNLKKEYFEGIKPILIKNSPDLFRNPHTVPKLKKIQIN
Ga0068859_10291942533300005617Switchgrass RhizosphereMLNQHSLEEIADIYNLLGDIKKEYEEGIKPILVKNSPDRFRNPHSVPK
Ga0074474_106084613300005824Sediment (Intertidal)MLNQHSLEEIADIHRLLDDIKKEYEEGIKPVLLKNSPKLFKNPHTVPKVKKIQI
Ga0074474_161143233300005824Sediment (Intertidal)MLNQHSLEEIADIYNLLGDIKKEYEKGIKPILIKKSPEFFKNPHTVPKL
Ga0074478_117418023300005827Sediment (Intertidal)MLNQHSLQEIAEIHRLLEDIKKEYEEGIKPVLVKNSPDLFRNPHTVPKLKKIQINRGLGLAAQNTNILK*
Ga0074478_138859233300005827Sediment (Intertidal)MRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
Ga0075157_1039563713300005961Wastewater EffluentMLNQHSLEEIGDIYNLLEDIQNEYQEGIKRILIQNSPSRFKNPHMVPKLKKIQINR
Ga0075158_1038196013300005987Wastewater EffluentMLNQHSIEEISEIYSLLDDIKQEYEHGIKPIILKNSPDLFKNPHTVPKLKKIQINRGL
Ga0075512_129877733300006374AqueousMLNQHSFEEIAEIHNLLGNIKKEYEEGIKPILLKNSPILFRNTHTVPKLKKTQINRGLGLVAQNTNILKK
Ga0075513_102052763300006379AqueousMRNQHSLEEIAEIHRLLEDIKGEYEQGIRAVLQKNNPTLFGNPHTIPKLKKIQINRGL
Ga0075488_157780643300006397AqueousMRNQHSLEEIAEIYRLLEDIKGEYEEGIRAVLKKYAPTLLSNPHMIPK
Ga0075175_141622253300007228Wastewater EffluentMLNQHSIEEISEIYSLLDNIKEEYKNGIKPIILKNSPNLFKNPHTVPKLK
Ga0102692_162057243300007321Freshwater LakeMRSQHSLEESAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINR
Ga0102818_102763743300007552EstuarineMLNQHSLEEIAEIHRLLEDIKKEYEEGIKPILIKNSPKLFKNSHTVPKLRKIQLNRGLGLAAQNTNVL
Ga0102817_112554233300007555EstuarineMLNQHSIEEISEIYSLLDNIKEEYKNGIKPIILKNSPNLFKNTHTVPKLKK
Ga0102946_123814333300007614SoilMLNQHSLEEIADIHNLLRDIKEEYNEGIKPILIKNSPKLFKNPHTVPKLKKIQI
Ga0102946_129314013300007614SoilMLNQHSIEEIAEIHNLLGDIKKEYEHGIKPILINNSPKLFKNPHTVPKLKKIQV
Ga0102912_119295413300007649EstuarineMLNQHSLEEIADIHNLLGNIKKEYEEGIKPILIKNTPSRFRNPHTVPKLKKIQINRGLGLSA
Ga0102866_109629133300007661EstuarineMRSQQSLEEIAELYGLLENIKKEYQGGIHSVLRKSNPELFSNPHTIPKLKKISIN
Ga0102824_100026313300007681EstuarineMLNQHSLEEIAEIHRLLEDIKKEYEDGIKPILLENSPKLFNNAHTVPKL
Ga0102827_107760933300007715EstuarineMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNT
Ga0102867_117530833300007716EstuarineMRSQHSLEETAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
Ga0105749_115506113300007864Estuary WaterMLNQHSLEEIAEINNLLGDIKKEYEKGIKPILMKNSPKLFSNPHAVPKLKKIQINR
Ga0105740_103025913300007955Estuary WaterMLNQHSLEEIADIHNLLGNIKKEYEEGIKLILIKNTPSRFKNPHSVPKLKKIQINRGLGL
Ga0102893_112565113300008052EstuarineMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLG
Ga0114359_103072323300008122Freshwater, PlanktonMRSQHSLEETAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNSNI*
Ga0103732_100119473300008929Ice Edge, Mcmurdo Sound, AntarcticaMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPSRFKNPHTVPKLKKIIINRGLGLAYYEIYF*
Ga0103733_100377613300008930Ice Edge, Mcmurdo Sound, AntarcticaMLNQHSLEEIGDIHNLLEDIKKEYKNGIKPILMKNSPSRFKNPHMVPKLKKIQIIYF*
Ga0103733_105546533300008930Ice Edge, Mcmurdo Sound, AntarcticaMRNQQSLEEIAEIYGLLENIKKEYESGIRPVLQRTNPELFSNIHTIPKLKKIICLVKIPKQQILF
Ga0103737_102655913300008934Ice Edge, Mcmurdo Sound, AntarcticaMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPSRFNNPHTVHKLKKI
Ga0103739_105065623300008936Ice Edge, Mcmurdo Sound, AntarcticaMLNQYSLGDLEDIAEINCLLENIKKEYGKGIKPVLLQSNPELYSNLHKVPKLKKIQINRGLGLAAQNTSIL
Ga0102887_127707833300008961EstuarineMRSQHSVEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
Ga0102810_125501633300009002EstuarineMLNQHSLEEIAEIHRLLEDIKKEYEEGIKPTLLKNSHNLFQNSHTIPKLKK
Ga0102811_128508633300009024EstuarineMLNQHSLEEIADIHNLLGNIKKEYEEGIKPILIKNTPSRFRIPHTVPKLK
Ga0102829_126617033300009026EstuarineMRNPNSLEEVAEIHSLLEDIKKEYTQGIRGVLKKNDPNLFRNVHTIPKLQKIQINRGLGLAAQNT
Ga0102854_105636813300009058EstuarineMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKI
Ga0102815_1040411833300009080EstuarineMLNQNSIEEIAEIYSLLDDIKREYENGIKPVILKNSADLFKNPHTVPKLKKIQINRGLGLAAQ
Ga0102812_1074549413300009086EstuarineMLNQHSLEEIADIHNLLGNIKKEYEEGIKPILIKNTPSRFRNPHTVPKLKKIQINRG
Ga0103849_100473123300009221River WaterMLNQHSLEEIADIHNLLVDIKKEYEEGIKPILMKNTPSRFRNPHTVPKLKKFKLIVD*
Ga0103851_100360723300009225River WaterMLNQHSLEEIAEINSLVSDIKKEYEEGIKPILIKNSSNLFKNSHTIPKLKKNSN*
Ga0115546_132146433300009435Pelagic MarineMRSQQSLEETAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGL
Ga0115007_1025562043300009441MarineMLNQHSLEEIAEIHNLLGDIKKEYEEGIKPILIKNSPSRYRNPHTVPKLKKIIINRG
Ga0115565_1024066233300009467Pelagic MarineMRNQHSLEERAEIHRLLEDVKGEYETGIRAVLQKNNPALFGNPHTIPRLEKIQINRGLGLSAQNTNILK
Ga0115099_1013097333300009543MarineMLNQHSLEEIGDIYNLLEDIQKEYEEGIKPILIKNSPSRFKNPHTVPKLKK
Ga0115099_1028927893300009543MarineMLNQHSFEEIADIYNLLGDIKKEYEEGIKPILIKNSPSRYRNPHTVPKLKKIIINR*
Ga0115099_10411804143300009543MarineMRSQNSLEEIAEIHLLLEDIKKEYETGIRTILRKNNPTMFANPHTIPKLQKNSN*
Ga0115006_1124982033300009544MarineMRNQHSLEEIAEIHRLLEDVKGEYETGIRAVLQKNNPALFGNPHTIPRLEKIQINRGLGLSAQN
Ga0115013_1051821113300009550MarineMLNQHSIEEIAEIHNLLDNIKEEYKNGIRPTILKNSSNLYKNPHTLP
Ga0115101_103536173300009592MarineMLNQHSLEEIADIHNLLGDIKKEYEEGIKPILIKNSSSRYRNPHTVPKLKKLLSTVDLD*
Ga0115101_120248233300009592MarineMRSQHSLEETAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRG
Ga0115101_163887433300009592MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPSRFKNPHTVPKLKKFKLIAVLD*
Ga0115101_179088563300009592MarineMLNQHSLEEIGDIHNLLEDIKKEYNEGIKPILMQNSPSRFKNPHTVPKLKKFKSIVVLD*
Ga0115011_1134693313300009593MarineMLNQHSLEEIGDIHNLLEDIKKEYNEGIKPILMQNSPSRFKNPHTVPKLKK
Ga0115103_106272633300009599MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPSRFKNPHTVPKLKK
Ga0115103_131318593300009599MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILRNNSPSRFKNPHTIPKLKKFKSIVVLD*
Ga0115103_1410461153300009599MarineMLNQYSLEEIADIHNLLDDIKQEYKIGIKPILMKKSPNLFKNPHTVPKLKKIQVNRGLGVTAQNNNILKKKY*
Ga0115103_152496633300009599MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPVLIKNSPSRFKNPHTVPKLKKFKSIVVLD*
Ga0115103_1802912143300009599MarineMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNILKKKYY*
Ga0115100_1059895713300009608MarineMRNQHSLEEIAEIHRLLEDIKGEYEQGIRAVLQKNNPTLFGNPHTIPKLKKIQIN
Ga0123359_19356013300009730MarineMRSQNSLEEIAEIHLLLEDIKKEYETGIRTVLRKNNPTMFANPHTIPKLQKIQINRGLGL
Ga0126318_1066261623300010152SoilMLNQHSFEEIAEIYNLLGNLKKEYENGIKPALVKHSPKLFKNIHSVPKLKKNST*
Ga0102890_102983743300010309EstuarineMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISI
Ga0138393_110619813300011308MarineMLNQHSLGEIAEIHNLLGDIKKEYEEGIKPILIKSSPKLFKNPHTVPKLKKIQINRGLG
Ga0138258_135784013300012413Polar MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILISNSPSRFSNPHTVPKLKKIQINRGLGLSA
Ga0138264_136368383300012414Polar MarineMRNQHSLEEIAEIHRLLEDIKGEYEQGIRVVLQKNDPVLFGNPHMIPKLEKIQINRGLGL
Ga0138264_139006633300012414Polar MarineMLNQHSLEEIAEIHNLLENIKTEYEDGIKPILLKNSSTFFPNPHTVPK*
Ga0138263_1118711123300012415Polar MarineMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSILILSQNLKKLVLIED*
Ga0138259_188510533300012416Polar MarineMLNQHSLEEIAEIHNLLEDIKTEYEDGIKPILLKNSSTFFPNPHTVPKLKKI
Ga0138262_126524413300012417Polar MarineMLNQHSLEEIADIHNLLGDIKKEYEDGIKPILMKNSPKLFKNPHTVPKLKKIQINRG
Ga0138262_166307343300012417Polar MarineMRNQHSLEEIAEIHRLLEDIKGEYEQGIRVVLQKNDPVLFGNPHMIPKLEKIQINRGLGLSAQNTNI
Ga0129328_104442923300012472AqueousMLNQHSLEEIAEIHNLLIDLKKEYEEGIKPILIKNSSVIFRNLHTIPKLQKIQINRGLGL
Ga0129328_109535633300012472AqueousMRNQHSLEEIAEIYRLLEDIKGEYEEGIRAVLKKNAPTLFSNPHMIPKLQKIQINRGLGL
Ga0157553_103449023300012748FreshwaterMLNQHSLEEIAEIHRLLEDIKKEYEEGIKPILLKNSPNLFDNPHTVPKLKKFKLTEVLD*
Ga0160423_1010651373300012920Surface SeawaterMLNQHSLEEIGDIHNLLEDIKKEYNEGIKPILMQNSPSRFKNPHTVPKLKKIQIN*
Ga0138257_134086323300012935Polar MarineMLNQHSLEEIAEIHNLLENIKTEYEDGIKPILLKNSQHSFPIPILFRN*
Ga0138257_148402653300012935Polar MarineMPNQQSLQETTEMYRLLEDIKKEYNDGIRGVLQKNNPKLFKNPHTIPKLKKIQINRGLGLSAQNTKIKKKY*
Ga0163180_1182308733300012952SeawaterMLNQHSLEEIADIHNLLGDIKTEYEEGIKPILQKQTPSRFRNPHTIPKL
Ga0163144_1134700133300015360Freshwater Microbial MatMLNQHSLEEIADIHNLLEDIKKEYEEGIKAILMKNSPSRFRNPHTVPKLKKIQINRGLGLAAQNT
Ga0181419_110430613300017728SeawaterMRNPNSLEEVAEIHNLLTDIKKEYTEGIRGVLRKNDPELFRNVHTIPKLEKIQINGGLGLSAQNTNILKKSIQE
Ga0181407_106618843300017753SeawaterMRNQNSLEEIAEIHSLLEDIKKEYTQGIQGILKKNDPELFRNIHTIPKLEKIQINRGLGLAAQNTNTLKK
Ga0181395_104265063300017779SeawaterMLNQHSLEEIGDIHNLLEDIKKEYNEGIKPILMQNSPSRFKNPHTVPKLKKIQINRGLGLAAQNTSIL
Ga0181380_128245023300017782SeawaterMPNPNSLEEIAEIHSLLENIKQEYTQGIRGVLQKNDPDLFRNIHSIPKLEKIQINRGLGLSAQNTNILKKSIQ
Ga0181589_1055889833300017964Salt MarshMRSQHSLEEIAELYGLLENIKKEYATGIHSVLQKSNPELFSNPHTIPKLKKISINRGLGLSAQNTNILKKSVNEFTKIT
Ga0181566_1097077333300018426Salt MarshMRSQNSLEEIAELYGLLENIKKEYESGIHSVLRKSNPELFSNPHTIPKLKKISIKQDKKT
Ga0181568_1007673613300018428Salt MarshMRSQNSLEEIAELYGLLENIKKEYESGIHSVLRKSNPELFSNPHTIPKLKKIS
Ga0192881_100002313300018603MarineMLNQHSLEEIADIHNLLGDIKKEYEEGIKPILIKNSPSRFRNPHTVPK
Ga0193339_100000413300018605MarineMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTFPKLKKININRGLGLAAQNKNILKKKKS
Ga0193339_100789743300018605MarineMLNQHSIEEIAEIHNLLDNIKEEYKNGIRPTILKNSSNLYKNPHTLPKLQKIQINRGLGLAALNSNILKK
Ga0193339_100873613300018605MarineMLNKHSLEEIAEIHNLLGNIKKEYEEGIKPILMKNSLSRFRNPHTVPKLKKIQINRGLGL
Ga0193339_101373413300018605MarineMLNQYSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPTRFKNPHMIPKLKKIQINRGLGLAAQN
Ga0193377_100194913300018636MarineMLNQHSLEEIGDIHNLLEDIKKEYKEGIKPILIKNSPDRFKNPHTVPKLK
Ga0192952_102588613300018683MarineMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKININRGLGLAA
Ga0192983_100383713300018684MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPSRFKNPHTVPKLKKIQ
Ga0192944_100794053300018692MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILRNNSPSRFRNPHTIPKLKKIQINRGLGLAAQNTSILKKNIEE
Ga0192944_103033713300018692MarineMLNQHSLEEIGDIHNLLEDIKKEYKNGIKPILMKNSPSRFKNPHTVPKLKKIQI
Ga0192944_103058233300018692MarineMRNQNSIQEVAEIHSLLIDIKKEYNQGIRAVLQKNDPELFRNVHTVPKLEKIQINRGLGLAAQNTNILKK
Ga0192887_102741113300018713MarineMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTFPKLKKININRGLG
Ga0193038_106195213300018723MarineMRSQHSLEEIAEIHLLLEDIKKEYESGIRTVLRKNNPTMFANPHTIPKLQKIQINRGLGLAAQNTNILKKSIEEFT
Ga0193147_104820313300018747MarineMLNQHSLEEIADIHNLLCNIKKEYEEGIKPTLMKKSPKLFQNPHTVPKLKKIQINRGL
Ga0192827_102233923300018763MarineMLNQHSLEEISDIHNLLENIKQEYNEGIKPILINNSPSRFKNPHTVPKLKKIQINRSLGLAAQNTTILKKKY
Ga0192950_100003513300018791MarineMLNQHSLEEIGDIHNLLEDIKKEYNDGIKSILIKNSPSRFKNPHTVPKLKKIQINRG
Ga0192950_103728533300018791MarineMLNQHSLEEIGDIHNLLEDIKKEYNEGIKPILMQNSPSRFKNPHTVPKLKKIQINRGLG
Ga0192950_105919113300018791MarineMRNQNSIQEVAEIHSLLIDIKKEYNQGIRAVLQKNDPELFRNVHTVPKLEKIQINRGLGLAAQNTNILKKSI
Ga0192950_105982833300018791MarineMLNQHSLEEIAEIHNLLEDIKIEYENGIKPTLLKNSSTFFSNPHTVPKLKKIQINRGLGLEAQN
Ga0193312_103665433300018844MarineMRSQHSFEEIAELYGLLENIKKEYEDGIHSVLKRSNPELFSNPHTIPKLKKISINRGLGLAAQ
Ga0193192_102180033300018860MarineMLNQHSLEEIADIHNLLGDIKKEYEEGIKPILIKNSPSRFRNPHTVPKLKKIQINR
Ga0193083_1000137863300018927MarineMRNPHSREEKAEINRLLDNIKKEYEEGIRPVLRNNNPLMFANPNTIPRLKKIQINRGLGLAAQNTNVLKKSIEEFT
Ga0193083_1002023713300018927MarineMLNQHSFEEIAEIHNLLGNIKKEYEEGIKPILLKNSPILFRNPHTVPKLKKIQIN
Ga0193066_1000224813300018947MarineMLNQHSLEEISDIHNLLENIKKEYNEGIKPILITNSPSRFKNPHTVPKLKKIQINRSLGLAAQNTTILKKKSTLR
Ga0193066_1012772313300018947MarineMLNQHSLEEIGDIHNLLNDIKKEYKDGIKPILIKNSPSRFKNPHMIPKLKKIQINRGLG
Ga0193087_1010312413300018964MarineMLNQHSLEEIAEIHNLLEDIKIEYEDGIKPILLKNSSTFFSNPHTVPKLKK
Ga0193540_1000046883300018979MarineMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTFPKLKKININRGLGLAAQNKNILKKILLNLQKLQGKNLSLQ
Ga0192961_1016741413300018980MarineMRNQHSLEEIAEIHRLLEDVKGEYETGIRAVLQKNNPALFGNPHTIPR
Ga0192968_1000383563300018981MarineMLNQHSLEEIGDIHNLLEDIKKEYKNGIKPILMKNSPSRFKNPHTVPKLKKIQINRGLGLAAQNTTILKKKY
Ga0192968_1009275133300018981MarineMLSQHSLEEIAEIHNLIVDIKQEYEKGIKPILIKNSSKLFTNPHTVPKLKKIQINRGLGL
Ga0192947_1000103263300018982MarineMLNQHSLEEIAEIHNLLENIKTEYEDGIKPILLKNSSTFFSNPHTVPKLKKIQINRGLD
Ga0193030_1000125173300018989MarineMLNQHSLEEISDIHNLLENIKKEYNEGIKPILINNSPSRFKNPHTVPKLKKIQINRSLGL
Ga0192953_1014056823300019000MarineMRSQHSVEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNILK
Ga0193034_1002502413300019001MarineMRSQHSVEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNT
Ga0193034_1007145813300019001MarineMLNQHSFEEIAEIHNLLGNIKKEYEEGIKPILLKNSPILFRNPHTVPKLKKIQINRGLG
Ga0193196_1030203923300019007MarineMTNQNSFDEIVEVHSLLEDIKREYTYGIKQVLQKNDTDLFKNVHTIPKLKKIQINRGLGLAAQNKNILRK
Ga0192880_10000013223300019009MarineMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
Ga0192880_1000039263300019009MarineMLNQHSLEEIADIHNLLGDIKKEYEEGIKPILIKNSPSRFRNPHTVPKLKKIQINRGLGLAAQNTNILKKKYRRI
Ga0192880_1000207613300019009MarineMLNQHSIEELAELHNLLTDIKQEYKNGIKPILLKNSSNLFNNPHTVPKLKKIQINRGLGL
Ga0192982_1000087793300019021MarineMTNQSSFEEIVEIHSLLENIKQEYTDGIRHVLQKNDSDLFKNVHNIPKLEKIQINRGLGLAAQNKNIL
Ga0192982_1000185513300019021MarineMLNQHSIEEIADIHNLLGDIKKEYDQGIKPILMKNSPEFFKNPHTVPKLKKIQVNRGLGLAAQNS
Ga0192951_1003520653300019022MarineMLNQHSLEEIAEIHNLLENIKTEYEKGIKPILLKNSSKFFPNPHTVPKLKKIQINR
Ga0192945_1000012613300019036MarineMLNQHSLEEIAEIHNLLENIKTEYEDGIKPILLKNSSTFFSNPHTVPKLKKIQINRGLGLEAQKKKKKKK
Ga0192945_1012104213300019036MarineMLNQHSLEEIGDIHNLLEDIKKEYNDGIKSILIKNSPSRFKNPHTVPKLKKIQINRGLGLAAQNTTVLRKNIE
Ga0192857_1028994613300019040MarineMRNPNSIQEVAEIHSLLTDIKKEYTEGIRSILQKNDPELFQNVHTIPKLKKIQINRGLGLAAQNTNILKK
Ga0193336_1001516023300019045MarineMLNQHSLEEIGDIHNLLNDIKKEYKDGIKPILIKNSPSRFKNPHMIPKLKKFKLIEVLD
Ga0193082_1002339563300019049MarineMLNQHSLEEIAEINNLLVNIKKEYEEGIKLTLLKNSSTLFRNPHTVPRLKKIQINRGLGLSAQNS
Ga0193082_1006437913300019049MarineMLNQHSLEEIGDIHNLLEDIKKEYNEGIKPILMQNSPSRFKNPHTVPKLKKIQINRGLGLAAQNT
Ga0193082_1063204333300019049MarineMLNQHSIEEIAEIHNLLTDLKQEYKIGIKPIILKNNLNLFNNPHIVPKLKKIQ
Ga0192966_1005423453300019050MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPVLISNSPSRFRNPHTVPKLKKI
Ga0192966_1027051533300019050MarineMLNQHSLEEIAEIHNLLEDIKTEYEDGIKPILLKNSSTFFSNPHTVPKLKKIQINRGLGL
Ga0193356_1000849013300019053MarineMLNQHSLEEISDIHNLLENIKKEYNEGIKPILITNSPSRFKNPHTVPKLKKIQINR
Ga0193356_1016849533300019053MarineMLNQHSLEEIGDIHNLLNDIKKEYKDGIKPILIKNSPSRFKNPHMIPK
Ga0192946_100600513300019103MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPVLIKNSPSRFKNPHTIPKL
Ga0192946_101477443300019103MarineMLNQHSLEEIGDIHNLLEDIKKEYNDGIKSILIKNSPSRFKNPHTVPKLKKIQI
Ga0192980_1000139123300019123MarineMLNQHSLEEIGDIHNLLEDIKKEYKNGIKPILMKNSPSRFKNPHMVPKLKKIQINRGLGL
Ga0193089_114892113300019133MarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPSRFKNPHTVPKLKKIQINRGLGLSAQNTSILKKNIEEFE
Ga0180037_126495413300019214EstuarineMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAA
Ga0194017_103204013300019696SedimentMRNQHSLEEIAEIYRLLEDIKGEYEEGIRAVLKKNAPTLFSNPHMIPKLQKI
Ga0194015_100893443300019701SedimentMRSQHSLEEIAELYGLLEDIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQ
Ga0193997_103569133300019702SedimentMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISIN
Ga0193979_102558833300019704SedimentMRNQHSLEEIAEIHRLLENIKGEYEEGIRAVLQKNNPTLFGNPHMIPKLKKIQINRGLGLAAQNTNILKKSI
Ga0193969_106032023300019712SedimentMLNQHSLEEIAEIHNLLIDLKKEYEEGIKPILIKNSSVIFRNLHTIPKL
Ga0193999_105911013300019718SedimentMRSQNSLEEIAELYGLLENIKKEYECGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNILKKV
Ga0193980_102561533300019725SedimentMRNQHSLEEIAEIHRLLEDIKGEYEEGIRAVLKKNNPTMFGNPHMIPKLQKIQINR
Ga0193974_102222533300019726SedimentMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINR
Ga0194014_100078343300019732SedimentMLNQHSLEEIAEIHNLLIDLKKEYEEGIKPILIKNSSVIFRNLHTIPKLQKIQINRGLG
Ga0193970_102683513300019734SedimentMRSQHSLEETAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGL
Ga0194012_100801543300019739SedimentMRSQHSLEEIAEIHLLLEDIKKEYETGIRPVLRKNNPTMFANPHTIPKL
Ga0194012_101602313300019739SedimentMLNQHSLEEIAEIHNLLIDLKKEYEEGIKPILIKNSSVIFRNLHTIPK
Ga0193998_101481943300019744SedimentMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISINRG
Ga0194018_100094393300019748SedimentMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNILKKSI
Ga0193958_110614613300019752Freshwater Microbial MatMRSQHSLEEIAESYGLLEDIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
Ga0194024_100685773300019765FreshwaterMRNQHSLEEIAEIHRLLEDIKGEYEQGIRAVLQKNNPTLFGNPHTIPKLKKIQINRGLGLAAQNTNILKKSIAE
Ga0193959_106110933300019766Freshwater Microbial MatMLNQHSLEEIAEIHNLLIDLKKEYEEGIKPILIKNSSVIFRNLHTIPKLQKIQINR
Ga0193950_100579813300019935Freshwater Microbial MatMLNNHSLEEIATINNLLEDIKKEYYEGFQLTLRRMTPLRFKNPHTIPKI
Ga0194118_1015370213300020190Freshwater LakeMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHSIPKLKKISINRGLGLSA
Ga0194120_1031122033300020198Freshwater LakeMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHSIPKLKKISINRGLGLSAQNTNILKKSI
Ga0210343_15958833300021263EstuarineMLNQHSLEEIGDIHNLLEDIKKEYEEGLKPILIKNSPERFKNPHTVPKLKKIQINRCLGL
Ga0210348_10345913300021266EstuarineMLNQHSLEEIADIHNLLGDIKKEYNEGIKPILIKNSPKLFKNPHTVPKQTLNG
Ga0210348_10982213300021266EstuarineMLNQHSLEEIAEIYNFLGDIKKEYEKGIKPVLLKNSPKLFSNPHTVPKLKKIQINRGL
Ga0210354_106651933300021276EstuarineMLNQHSLEEIADIHNLLGDIKKEYNEGVKPILIKNSPKLFKNPHTVPKLKKFRLIEDLA
Ga0210352_16502143300021277EstuarineMLNQHSLEEIADIYNLLGDIKKEYEEGIKPILIKNSPKLFKNPHTVPKLKKIQIN
Ga0210357_105890613300021283EstuarineMLNQHSLEEIADIYNLLGDIKEEYEKGIKPILIKNSPKLFQNPHTVAKLKKVQINRGLGLAAQNTNILKKNIEEFEKL
Ga0210358_12382033300021293EstuarineMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKLVLIED
Ga0210369_100756013300021297EstuarineMLNQHSLEEIAEIHNLLGDIKKEYEKGIKPILIKNSPKLFKNPHTVPKLKKIQINRGLRLAAQNTNVLKKNIEEFEKIT
Ga0210302_102472243300021299EstuarineMLNQHSLEEIADIHNLLGNIKKEYEEGIKPILIKNTPSRFRNPHTVPKLKKIQINRGLGLSASNTNILKKNIE
Ga0210296_109208313300021305EstuarineMLNQHSLEEIAEIHRLLEDIKKEYEEGIKPILIKNSPKLFKNSHTVPKLRKIQLNRG
Ga0210326_122453113300021309EstuarineMLNQHSLEEIGDIHRLLDDIKKEYEEGIKPILVKNSPKLFKNPHSVPKLKKIQINRGLGLAAQN
Ga0210333_113955013300021313EstuarineMLNQHSLEEIADIYNLLGDIKKEYEEGIKPILIKNSPKLFKNPHTVPKLKKFKLIVDLD
Ga0210333_125764273300021313EstuarineMLNQHSLEEIAEIHNLLGDIKKEYKEGIKPILIKNSPKLFKNPHSVPKLKKYKSIGVLGLQLKIQIF
Ga0210295_101393513300021323EstuarineMRSQNSLEEIAELYGLLENIKKEYELGIHSALRKSNPELFSNPHTIPKLKKISINR
Ga0210295_116412513300021323EstuarineMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINR
Ga0206692_104725123300021350SeawaterMLNQHSLEEIGDIHNLLQDIKKEYEEGIKPILINNSPSRFKNPHTVPKLKKFKLIAVLA
Ga0206692_159075613300021350SeawaterMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPSRFKNPHTVPKLKKIQINRG
Ga0213858_1005859663300021356SeawaterMRNPNSLEEVAEIHNLLTDIKKEYTEGIRGVLRKNNPDLFRNVHTIPKLEKIQINRGLGLAAQNT
Ga0206123_1004058213300021365SeawaterMRNQHSLEEIAEIHSLLEDIKGEYEKGIRAVIKKNNPELFGNPHTIPKLQKIQINRGLGLAAQNTNILKKSINEFT
Ga0206123_1046226023300021365SeawaterMRSQHSVEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQN
Ga0194117_1021973443300021424Freshwater LakeMLNQHSLEEIADIHSLLGNIKKEYEEGIKPILIKNTPSRFRNPHTVPKLKKIQINRGLGL
Ga0193946_103357933300021458SedimentMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQN
Ga0193947_101584313300021465SedimentMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNT
Ga0210305_110515033300021847EstuarineMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLG
Ga0210305_111232713300021847EstuarineMLNQHSLEEIADIHNLLGNIKKEYEEGIKAILIKNTPSRFKNPHSVPKLKKIQINRGLGLSASNTNILKKNIEEFEN
Ga0213852_113345513300021858WatershedsMLNQHSLEEIAEINRLVSDIKKEYEEGIKPILIKNSPTLFKNPHTVPKLKKIQINRCLGL
Ga0210334_1058987233300021859EstuarineMLNQHSLEEIAEIHNLLGDIKTEYEKGIKPIILKNSSKLFSNPHTVPKLKKNSN
Ga0224498_1007131443300022202SedimentMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNILKKSITE
Ga0224509_1000834393300022306SedimentMRSQHSLEEIAELYGLLEDIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
Ga0210310_100231233300022369EstuarineMLNQHLLEEIAEIHNLLVNIQKEYEEGIKPILIKNSPKLFRNPHTVPKLKKIQINRGLGLAAQNTNILRKKY
Ga0210310_100299453300022369EstuarineMRSQHSLEETAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKIS
Ga0210310_101884633300022369EstuarineMLNQHSLEEIAEIHRLLEDIKKEYEDGIKPILLKNSPKLFKNTHTVPKLRKIQINRGLGLAA
Ga0210293_10056683300022372EstuarineMRSQHSLEETAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQ
Ga0210319_100514613300022373EstuarineMLNQHSLEEIADIHNLLCDIKQEYEKGIKPILVKKSPNLFKNPHTVPKLKKIEII
Ga0210318_100989313300022389EstuarineMLNQHSLEEIAEIHNLLGDIKKEYKEGIKPILIKNSPKLFKNPRTVPKLKKIQINR
Ga0212091_1018892213300022549GroundwaterMLNQHSLEEIAEIHRLLEDIKKEYREGIKPTLLKNSPNLFENPHTVPKLKKILVNRGLGL
Ga0247774_104358513300022903Plant LitterMLNQHSLEEIADIYSLLGDIKKEYEEGIKPILLTNSPDRFRNPQSLPKLKKIQINRGLGLAAQNT
Ga0233391_100800213300024304Deep Subsurface SedimentMLNQHSLEEIADIHRLLEDIKKEYEEGIKPVLVKNSPNLFRNPHTVPKLKKIQINRG
(restricted) Ga0255042_1033185313300024340SeawaterMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAS
Ga0244777_1043933613300024343EstuarineMLNQHSLEEIGDIHNLLEDIKKEYEEGIKPILINNSPSRFKNPHTVPKLKKIQINRGLGLAAQNTSILKKN
Ga0244777_1060728033300024343EstuarineMLNQHSLEEIADIYNLLGDIKKEYEKGIKPVLLKNSPTLFRNPHTVPKLKKIQINRGLGL
Ga0244775_1140751613300024346EstuarineMLNQHSLEEIADIHNLLGNIKKEYEEGIKPILIKNTPSRFRNPHTVPKLKKIQINRGLGLSASNTNILKKNIEE
Ga0244776_1006666813300024348EstuarineMLNQHSLEEIAEIHRLLEDIKKEYEEGIKPILLKNSPNLFDNPHTVPKLKKIQINRGLGLAAQNTN
Ga0256352_103035223300024532FreshwaterMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISIN
Ga0256337_101529633300024573FreshwaterMGLQFLRNETKIYEVYLLLEDIKKEYECGIHAVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNILKKKCK
Ga0209594_103140863300025130GroundwaterMLNQNSLEEIAEIHNLLGDLRKEYEEGIKPILLKNSPDLFSNPQSVPKL
Ga0210133_101622013300025573Natural And Restored WetlandsMRNQHSLEEIAEIHLLLEDIKGEYEEGIRAVIRKNDPILFSNPHMIPKLQKIHINRGLGL
Ga0210085_114321533300025583Natural And Restored WetlandsMLNQHSLEEIADIHRLLDDIKKEYEEGIKPVLLKNSPKLFQNPHTVPK
Ga0209600_120167423300025821Pelagic MarineMRSQHSLEEIAEIHLLLEDIKKEYESGIRTVLRKNNPTMFANPHTIPKLQKIQINRGLGLAAQNTNILKKSIEEFTRIT
Ga0209307_109292143300025832Pelagic MarineMRNQHSLEERAEIHRLLEDVKGEYETGIRAVLQKNNPALFGNPHTIPRLEKIQINRGLGL
Ga0210028_109133923300025841AquiferMLNQHSLEEIADIHNLLGDIKKEYEKGIKPVLIKNSPTLFKNPHTVPKLKKIQINRGLGAAAQNTNILKKINYLNGNNAITIGVKE
Ga0209630_1017268513300025892Pelagic MarineMRNQHSLEEIAEIHRLLEDIKGEYEQGIRAVLQKNNPTLFGNPHTIPKLKKIQINRGLG
Ga0209567_1065627713300025895Pelagic MarineMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
Ga0209927_105845833300026106SoilMLNQHSIEEIADIHNLLRDIKEEYNEGIKPILIKNSPKLFKNPHTVPK
Ga0209955_101785813300026123WaterMRSQHSLEEIAELYGLLENIKKEYEEGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAA
Ga0209961_100949113300026130WaterMLNQHSLEEIADIHNLLENIKEEYEQGIKPILIKNTPSRFRNPHTVPTLKKI
Ga0209961_103390543300026130WaterMLNQHSLEEIADIHNLLGDIKEEYNAGIKPILMKNSPKLFQNPHTVPKLKKIQINRGLGL
Ga0209856_100323733300026837SandMRSQHSLEEIAELYGLLENIKKEYQGGIHSVLRKSNPELFSNPHTIPKLKKISINRGL
Ga0208798_104170113300027183EstuarineMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKK
Ga0208797_102387213300027186EstuarineMLNQHSLEEIAEIHRLLEDIKKEYEEGIKPTLLKNSPNLFENPHTVPKLKKIQINRCLGLAAQNS
Ga0208677_104952113300027216EstuarineMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNILKKSITE
Ga0208308_104578013300027228EstuarineMLNQHSLEEIGDIYNLLEDIQKEYEEGIKPILIKNSPSRFKNPHTVPKLKKIQINRGLGL
Ga0208804_101481513300027235EstuarineMRSQQSLEEIAELYGLLENIKKEYQGGIHSVLRKSNPELFSNPHTIPK
Ga0208930_102591513300027237EstuarineMRSQHSLEEIAELYGLLENIKREYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQ
Ga0208930_103865013300027237EstuarineMRSQHSLEETAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLK
Ga0208174_101691813300027243EstuarineMPNPNSLEEIAEIHSLLENIKQEYTQGIRGVLQKNDPDLFRNIHSIPKLEKIQINRGLGLSAQNTNILKKSIQEFK
Ga0208931_100789373300027246EstuarineMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNIL
Ga0208177_104629613300027254EstuarineMLNQHSIEEIAEIYSLLDDIKKEYEHGIKPVILKNSPDLFKNPHTVPKLKKIQINRGLGLAAQNT
Ga0208796_107936113300027308EstuarineMRSQHSLEETAELYGLLENIKKEYANGIHSVLRKSNPELYSNPHTIPKLKKISINRGLGLAAQNTNILKKSITE
Ga0208949_102282053300027315MarineMLNQHSLEEIGDIHNLLEDIKKEYKNGIKPILIRNSPSRFKNPHTVPKLKKIQINR
Ga0207994_100385213300027416EstuarineMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISII
Ga0208437_100300213300027525EstuarineMLNQHSIEEIAEIYSLLDNIKKEYEHGIKPVILKNSPDLFKNPHTVPKLKKIQINRGLGLAAQNT
Ga0209278_108824943300027673Wastewater EffluentMLNQHSLEEIADIHNLLVDIKKEYEEGIKPILMKNTPSRFRNPHTVPKLKKIQINRGLGL
Ga0209575_1017803033300027739FreshwaterMLNQHSLEEIGDIHRLLEDIKKEYEEGIKPVLVKNSPKLFRNPHSVPKLKKIQINRGLGLAAQNTN
Ga0208671_1033735713300027757EstuarineMRSQHSLEESAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKIKKIS
Ga0209175_1045606413300027781Wastewater EffluentMLNQHSLEEIAEIYNLLGDIKKEYKAGIKPILMQNSSQLFSNPHTIPKLKKIVVNRGLGVSAQNTN
Ga0209092_1044392913300027833MarineMTNQSSFEEIVEIHSLLENIKQEYTDGIRHVLQRNDSDLFKNVHNIPKLKKIQINRGLGLAAQNKNILKKS
(restricted) Ga0255041_1011260413300027837SeawaterMRSQNSLEEIAEIHLLLEDIKKEYETGIRTILRKNNPTMFANPHTIPKLQKIQINRGLGLAAQNTNIL
Ga0209503_1043176233300027859MarineMLNQHSLEEIGDIHNLLEDIKKEYNEGIKPILMQNSPSRFKNPHTVPKLKKI
Ga0209713_1084870633300027883MarineMRNQHSLEEIAEIHRLLEDVKGEYETGIRAVLQKNNPALFGNPHTIPRLEKIQINR
Ga0209536_10032834463300027917Marine SedimentMLNQHSVEEIAEIYNLLDDIKKEYENGIKPILIQNNPKLFHNPHTVPKLKKIIINRGLGLAAQNTNILKKNIEEFEKI
Ga0210366_1011969523300028420EstuarineMLNQHSLEEIADIYNLLGDIKKEYEKGIKPILIKKSPEFFKNPHTVPKLKKIQINRGLGNLAQNTNLLKKKY
(restricted) Ga0247831_111390753300028559FreshwaterMRSQHSLEEIAELYGLLENIKKEYQGGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGL
Ga0265309_1047933633300028599SedimentMLNQHSLEEIAEIHNLLSDIKKEYEDGIKPILIKNSPKLFKNPHTVPKLKKIIINRG
Ga0265309_1077737413300028599SedimentMLNQHSLEEIAEIYNLLGDIKKEYEKGIKPILLKNSPKLFSNPHTVPKLKKIQINRGLGLAAQNTNILK
Ga0265309_1120611013300028599SedimentMLNQHSVEEVAEIYNLLGDIKKEYENGIKPILIKNSPKLFRNPHTVPKLKK
Ga0265303_1110410613300028600SedimentMLNQHSLEEIADIYNLLGDLKKEYEEGIKPILIKTSPKFFKNPHTVPKLKKIQINRGLGL
Ga0265303_1121230633300028600SedimentMLNQHSLEEIAEIYNLLGDIKKEYEEGIKPILVKNSPKLFRNPHTVPKLKKIIVNRGLGLAAQNTNIL
Ga0302158_108539713300028645FenMLNQHSLEEIAEINRLVSDIKKEYEEGIKPILIKNSPTLFKNPHTVPKLKKIQINRCLGLAAQNTNILKKSIEE
Ga0302161_1002456713300028674FenMLNQHSLEEIAEINRLVSDIKKEYEEGIKPILVKNSPTLFKNPHTVPKLKKIQINRCLGLAAQNTNIL
Ga0302161_1012240013300028674FenMLNQHSLEEIAEINRLVSDIKKEYEEGIKPILIKNSPTLFKNPHTVPKLKKIQINR
Ga0308020_114922913300031175MarineMLNQHSLEEIGDIHNLLEDIKKEYKNGIKPILMKNSPSRFKNPHMVPKLKKIQIN
Ga0307955_101761613300031209Saline WaterMLNQHSFEEIADIYNLLDDIKQEYEEGIKPILIKNSPSRYRNPHTIPKLKKIIINR
Ga0311364_1151296513300031521FenMLNQHSLEEIAEIYNLLGDIKKEYEDGIKPILIKNSPKLFSNPHTVPKLKKIIVNRGLGLAAQNT
Ga0307492_1001408883300031523Sea-Ice BrineMLNQHSLEEIADIHNLLEDIKKEYEEGIKPILVKNSPSRFRNPHTVPKLKKIQINRGLGL
Ga0307993_102845713300031602MarineMRSQQSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTNILKK
Ga0315906_1064492833300032050FreshwaterMLNQHSLEEIADIHNLLGNIKKEYEEGIKAILIKNTPSRFRNPHTVPKLKKIQINRGLGLSASN
Ga0315315_1017675213300032073SeawaterMRSQHSLEEIAELYGLLENIKKEYENGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNSNILK
Ga0315315_1094743633300032073SeawaterMRSQHSLEEIAELYGLLENIKKEYETGIHSVLRKSNPELFSNPHTIPKLKKISINRGLGLAAQNTN
Ga0315315_1151766533300032073SeawaterMLNQHSLEEIADIHNLLGDIKKEYEEGIKPILIKNSSSRYRNPHTVPKLKKIII
Ga0315295_1117432733300032156SedimentMLNQHSLEEIAEIHRLIEDIKKEYEGGIKPVLMKNSPKLFKNPHTVPKLKKIQINRGLGLAAQNTN
Ga0316191_1086677423300032258Worm BurrowMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLNLLE
Ga0316192_1105795813300032260Worm BurrowMLNQHSLEEIADISNLLGDIKKEYEEGIKPTLIKNSPKLFKNPHTVPKLKKIQINRGLG
Ga0316189_1093563313300032272Worm BurrowMLNQHSLEEIAEIHNLLGDIKKEYEKGIKPILIKNSPKLFRNPHTVPKL
Ga0335025_0505385_1_1563300034096FreshwaterMRSQHSLEETAELYSLLENIKKEYQVGIHSVLRKSNPELFSNPHTIPKLKKI
Ga0335035_0310032_3_2153300034105FreshwaterMLNQHSLEEIADIHNLLGNIKKEYEEGIKPILIKNTPSRFKNPHSVPKLKKIQINRGLGLSASNTNILKKN
Ga0335054_0726721_352_5283300034119FreshwaterMRSQHSLEEIAELYGLLENIKKEYEDGIHSVLRKSNPELFSNPHTIPKLKKISINRGLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.