NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F012090

Metagenome Family F012090

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012090
Family Type Metagenome
Number of Sequences 283
Average Sequence Length 48 residues
Representative Sequence VFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGY
Number of Associated Samples 25
Number of Associated Scaffolds 283

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.77 %
% of genes near scaffold ends (potentially truncated) 44.88 %
% of genes from short scaffolds (< 2000 bps) 53.71 %
Associated GOLD sequencing projects 25
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (79.152 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(69.258 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(88.339 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.87%    β-sheet: 0.00%    Coil/Unstructured: 55.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 283 Family Scaffolds
PF02992Transposase_21 27.56
PF13963Transpos_assoc 20.49
PF13960DUF4218 3.89
PF13952DUF4216 2.12
PF00078RVT_1 0.71
PF08284RVP_2 0.71
PF00311PEPcase 0.35
PF00494SQS_PSY 0.35
PF10250O-FucT 0.35
PF00443UCH 0.35
PF00931NB-ARC 0.35
PF07727RVT_2 0.35
PF01582TIR 0.35
PF03732Retrotrans_gag 0.35
PF10536PMD 0.35
PF00005ABC_tran 0.35
PF12143PPO1_KFDV 0.35
PF02701zf-Dof 0.35
PF04379DUF525 0.35
PF02892zf-BED 0.35
PF16312Oberon_cc 0.35
PF02358Trehalose_PPase 0.35

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 283 Family Scaffolds
COG1562Phytoene/squalene synthetaseLipid transport and metabolism [I] 0.35
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.35
COG2352Phosphoenolpyruvate carboxylaseEnergy production and conversion [C] 0.35
COG2967Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transportInorganic ion transport and metabolism [P] 0.35
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.35
COG5533Ubiquitin C-terminal hydrolasePosttranslational modification, protein turnover, chaperones [O] 0.35


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.92 %
UnclassifiedrootN/A19.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028786|Ga0307517_10005542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta18971Open in IMG/M
3300028786|Ga0307517_10011273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta12406Open in IMG/M
3300028786|Ga0307517_10016891Not Available9557Open in IMG/M
3300028786|Ga0307517_10031593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6156Open in IMG/M
3300028786|Ga0307517_10033677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5870Open in IMG/M
3300028786|Ga0307517_10034326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5782Open in IMG/M
3300028786|Ga0307517_10044037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4733Open in IMG/M
3300028786|Ga0307517_10068132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3246Open in IMG/M
3300028786|Ga0307517_10081072Not Available2771Open in IMG/M
3300028786|Ga0307517_10136569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1741Open in IMG/M
3300028786|Ga0307517_10139656All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1706Open in IMG/M
3300028786|Ga0307517_10188557Not Available1314Open in IMG/M
3300028786|Ga0307517_10209526All Organisms → Viruses → Predicted Viral1203Open in IMG/M
3300028786|Ga0307517_10221985All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300028786|Ga0307517_10241700Not Available1070Open in IMG/M
3300028786|Ga0307517_10328123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae842Open in IMG/M
3300028786|Ga0307517_10436607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa682Open in IMG/M
3300028786|Ga0307517_10442579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa675Open in IMG/M
3300028786|Ga0307517_10486151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta631Open in IMG/M
3300028786|Ga0307517_10548060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa579Open in IMG/M
3300028786|Ga0307517_10564869All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae566Open in IMG/M
3300028794|Ga0307515_10006187Not Available24036Open in IMG/M
3300028794|Ga0307515_10071945Not Available4676Open in IMG/M
3300028794|Ga0307515_10123319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2915Open in IMG/M
3300028794|Ga0307515_10158105All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2327Open in IMG/M
3300028794|Ga0307515_10201727Not Available1862Open in IMG/M
3300028794|Ga0307515_10282925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1363Open in IMG/M
3300028794|Ga0307515_10346137Not Available1136Open in IMG/M
3300028794|Ga0307515_10459497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa887Open in IMG/M
3300028794|Ga0307515_10527370All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa790Open in IMG/M
3300028794|Ga0307515_10548789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa765Open in IMG/M
3300028794|Ga0307515_10590640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa720Open in IMG/M
3300028794|Ga0307515_10835102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa546Open in IMG/M
3300030521|Ga0307511_10009065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9926Open in IMG/M
3300030521|Ga0307511_10065089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2733Open in IMG/M
3300030521|Ga0307511_10091199All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae2064Open in IMG/M
3300030521|Ga0307511_10091660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2055Open in IMG/M
3300030521|Ga0307511_10101840Not Available1880Open in IMG/M
3300030521|Ga0307511_10115377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1687Open in IMG/M
3300030521|Ga0307511_10177163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1157Open in IMG/M
3300030521|Ga0307511_10179450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1144Open in IMG/M
3300030521|Ga0307511_10212499Not Available985Open in IMG/M
3300030521|Ga0307511_10242124Not Available878Open in IMG/M
3300030521|Ga0307511_10245242Not Available868Open in IMG/M
3300030521|Ga0307511_10266937Not Available805Open in IMG/M
3300030521|Ga0307511_10283061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa765Open in IMG/M
3300030521|Ga0307511_10322202All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae682Open in IMG/M
3300030521|Ga0307511_10448281All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae511Open in IMG/M
3300030522|Ga0307512_10008662All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa9886Open in IMG/M
3300030522|Ga0307512_10073581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2516Open in IMG/M
3300030522|Ga0307512_10097335Not Available2013Open in IMG/M
3300030522|Ga0307512_10116258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera1738Open in IMG/M
3300030522|Ga0307512_10152147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1380Open in IMG/M
3300030522|Ga0307512_10179308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1194Open in IMG/M
3300030522|Ga0307512_10191339Not Available1128Open in IMG/M
3300030522|Ga0307512_10215154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1014Open in IMG/M
3300030522|Ga0307512_10257386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae861Open in IMG/M
3300030522|Ga0307512_10353789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa645Open in IMG/M
3300030522|Ga0307512_10456042All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta514Open in IMG/M
3300031456|Ga0307513_10004567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus18460Open in IMG/M
3300031456|Ga0307513_10019298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8119Open in IMG/M
3300031456|Ga0307513_10028174Not Available6426Open in IMG/M
3300031456|Ga0307513_10052223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4403Open in IMG/M
3300031456|Ga0307513_10053390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4344Open in IMG/M
3300031456|Ga0307513_10092068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3087Open in IMG/M
3300031456|Ga0307513_10104075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2853Open in IMG/M
3300031456|Ga0307513_10114338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2684Open in IMG/M
3300031456|Ga0307513_10116299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2654Open in IMG/M
3300031456|Ga0307513_10133141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2427Open in IMG/M
3300031456|Ga0307513_10148082Not Available2262Open in IMG/M
3300031456|Ga0307513_10159356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae2151Open in IMG/M
3300031456|Ga0307513_10161128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2136Open in IMG/M
3300031456|Ga0307513_10185179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera1940Open in IMG/M
3300031456|Ga0307513_10232084Not Available1657Open in IMG/M
3300031456|Ga0307513_10295740All Organisms → cellular organisms → Eukaryota1388Open in IMG/M
3300031456|Ga0307513_10374735Not Available1164Open in IMG/M
3300031456|Ga0307513_10495545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida939Open in IMG/M
3300031456|Ga0307513_10514034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta913Open in IMG/M
3300031456|Ga0307513_10597702Not Available813Open in IMG/M
3300031456|Ga0307513_10725256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa699Open in IMG/M
3300031456|Ga0307513_10867377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida609Open in IMG/M
3300031507|Ga0307509_10052890All Organisms → cellular organisms → Eukaryota4334Open in IMG/M
3300031507|Ga0307509_10063377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3892Open in IMG/M
3300031507|Ga0307509_10064970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3835Open in IMG/M
3300031507|Ga0307509_10115095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2682Open in IMG/M
3300031507|Ga0307509_10124864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2542Open in IMG/M
3300031507|Ga0307509_10141692All Organisms → Viruses → Predicted Viral2338Open in IMG/M
3300031507|Ga0307509_10184393Not Available1947Open in IMG/M
3300031507|Ga0307509_10251514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1550Open in IMG/M
3300031507|Ga0307509_10280622Not Available1427Open in IMG/M
3300031507|Ga0307509_10362915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1167Open in IMG/M
3300031507|Ga0307509_10373444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1141Open in IMG/M
3300031507|Ga0307509_10498705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa902Open in IMG/M
3300031507|Ga0307509_10507478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa889Open in IMG/M
3300031507|Ga0307509_10634414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa738Open in IMG/M
3300031507|Ga0307509_10743425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida646Open in IMG/M
3300031507|Ga0307509_10806438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica603Open in IMG/M
3300031507|Ga0307509_10815733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta597Open in IMG/M
3300031507|Ga0307509_10938828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa530Open in IMG/M
3300031507|Ga0307509_10958825Not Available521Open in IMG/M
3300031507|Ga0307509_10962730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta519Open in IMG/M
3300031616|Ga0307508_10062046All Organisms → Viruses → Predicted Viral3300Open in IMG/M
3300031616|Ga0307508_10076660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2921Open in IMG/M
3300031616|Ga0307508_10079257Not Available2865Open in IMG/M
3300031616|Ga0307508_10154926Not Available1895Open in IMG/M
3300031616|Ga0307508_10225699All Organisms → Viruses → Predicted Viral1472Open in IMG/M
3300031616|Ga0307508_10268733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1299Open in IMG/M
3300031616|Ga0307508_10313730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1160Open in IMG/M
3300031616|Ga0307508_10391572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa980Open in IMG/M
3300031616|Ga0307508_10524619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae781Open in IMG/M
3300031616|Ga0307508_10533616Not Available770Open in IMG/M
3300031616|Ga0307508_10606722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta696Open in IMG/M
3300031616|Ga0307508_10671553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta643Open in IMG/M
3300031616|Ga0307508_10685857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa632Open in IMG/M
3300031616|Ga0307508_10691517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa628Open in IMG/M
3300031616|Ga0307508_10712088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta614Open in IMG/M
3300031616|Ga0307508_10721946Not Available607Open in IMG/M
3300031649|Ga0307514_10018244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5756Open in IMG/M
3300031649|Ga0307514_10052110All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3166Open in IMG/M
3300031649|Ga0307514_10054268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae3088Open in IMG/M
3300031649|Ga0307514_10117140Not Available1869Open in IMG/M
3300031649|Ga0307514_10175392Not Available1391Open in IMG/M
3300031649|Ga0307514_10176992Not Available1382Open in IMG/M
3300031649|Ga0307514_10259593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1018Open in IMG/M
3300031649|Ga0307514_10281176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa952Open in IMG/M
3300031649|Ga0307514_10315746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa862Open in IMG/M
3300031649|Ga0307514_10323846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa843Open in IMG/M
3300031649|Ga0307514_10327232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa836Open in IMG/M
3300031649|Ga0307514_10389132Not Available719Open in IMG/M
3300031649|Ga0307514_10420012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa672Open in IMG/M
3300031649|Ga0307514_10420238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta672Open in IMG/M
3300031649|Ga0307514_10428116All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Apiales → Apiineae → Apiaceae → Apioideae → Scandiceae → Daucinae → Daucus → Daucus sect. Daucus → Daucus carota → Daucus carota subsp. sativus661Open in IMG/M
3300031649|Ga0307514_10441146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa644Open in IMG/M
3300031649|Ga0307514_10451711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa631Open in IMG/M
3300031649|Ga0307514_10469789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa610Open in IMG/M
3300031649|Ga0307514_10472702Not Available607Open in IMG/M
3300031730|Ga0307516_10058692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3744Open in IMG/M
3300031730|Ga0307516_10076486Not Available3199Open in IMG/M
3300031730|Ga0307516_10087217Not Available2955Open in IMG/M
3300031730|Ga0307516_10097848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2753Open in IMG/M
3300031730|Ga0307516_10103553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2659Open in IMG/M
3300031730|Ga0307516_10212229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1649Open in IMG/M
3300031730|Ga0307516_10241733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1503Open in IMG/M
3300031730|Ga0307516_10254849Not Available1447Open in IMG/M
3300031730|Ga0307516_10290201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1314Open in IMG/M
3300031730|Ga0307516_10327846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae1200Open in IMG/M
3300031730|Ga0307516_10410106Not Available1013Open in IMG/M
3300031730|Ga0307516_10419404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa996Open in IMG/M
3300031730|Ga0307516_10443822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae954Open in IMG/M
3300031730|Ga0307516_10534866All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta825Open in IMG/M
3300031730|Ga0307516_10597670All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta757Open in IMG/M
3300031730|Ga0307516_10859068Not Available571Open in IMG/M
3300031730|Ga0307516_10875105All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta563Open in IMG/M
3300031730|Ga0307516_10912996All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta545Open in IMG/M
3300031730|Ga0307516_11021713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa500Open in IMG/M
3300031838|Ga0307518_10006315All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida8491Open in IMG/M
3300031838|Ga0307518_10032152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3804Open in IMG/M
3300031838|Ga0307518_10055093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2889Open in IMG/M
3300031838|Ga0307518_10058720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae2794Open in IMG/M
3300031838|Ga0307518_10075737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2433Open in IMG/M
3300031838|Ga0307518_10094722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2144Open in IMG/M
3300031838|Ga0307518_10139879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1690Open in IMG/M
3300031838|Ga0307518_10144009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1657Open in IMG/M
3300031838|Ga0307518_10163029Not Available1529Open in IMG/M
3300031838|Ga0307518_10169147All Organisms → cellular organisms → Eukaryota1492Open in IMG/M
3300031838|Ga0307518_10222205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae1231Open in IMG/M
3300031838|Ga0307518_10268498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1067Open in IMG/M
3300031838|Ga0307518_10299207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa979Open in IMG/M
3300032354|Ga0325403_1000390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida29700Open in IMG/M
3300032354|Ga0325403_1000808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta24019Open in IMG/M
3300032354|Ga0325403_1004428Not Available13063Open in IMG/M
3300032354|Ga0325403_1005565All Organisms → cellular organisms → Eukaryota11898Open in IMG/M
3300032354|Ga0325403_1007306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10554Open in IMG/M
3300032354|Ga0325403_1009287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida9385Open in IMG/M
3300032354|Ga0325403_1017678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida6572Open in IMG/M
3300032354|Ga0325403_1018191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida6457Open in IMG/M
3300032354|Ga0325403_1036895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3873Open in IMG/M
3300032354|Ga0325403_1038144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3764Open in IMG/M
3300032354|Ga0325403_1043122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3379Open in IMG/M
3300032354|Ga0325403_1051113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2859Open in IMG/M
3300032354|Ga0325403_1052106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2801Open in IMG/M
3300032354|Ga0325403_1053579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2723Open in IMG/M
3300032354|Ga0325403_1060614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2374Open in IMG/M
3300032354|Ga0325403_1063496Not Available2252Open in IMG/M
3300032354|Ga0325403_1065280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae2179Open in IMG/M
3300032354|Ga0325403_1067584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2086Open in IMG/M
3300032354|Ga0325403_1081777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1613Open in IMG/M
3300032355|Ga0325401_1002199All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae17169Open in IMG/M
3300032355|Ga0325401_1003355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida14650Open in IMG/M
3300032355|Ga0325401_1005824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11870Open in IMG/M
3300032355|Ga0325401_1008622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida9923Open in IMG/M
3300032355|Ga0325401_1015280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta7314Open in IMG/M
3300032355|Ga0325401_1033854Not Available4385Open in IMG/M
3300032355|Ga0325401_1054707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2963Open in IMG/M
3300032355|Ga0325401_1072037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2270Open in IMG/M
3300032355|Ga0325401_1091256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1752Open in IMG/M
3300032355|Ga0325401_1152586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta919Open in IMG/M
3300032355|Ga0325401_1159474All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae871Open in IMG/M
3300032355|Ga0325401_1232814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae550Open in IMG/M
3300032374|Ga0325400_1093245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2020Open in IMG/M
3300032374|Ga0325400_1101968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera1850Open in IMG/M
3300032374|Ga0325400_1309719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae555Open in IMG/M
3300032389|Ga0325405_1000088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida82982Open in IMG/M
3300032389|Ga0325405_1000303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida46232Open in IMG/M
3300032389|Ga0325405_1001135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa26784Open in IMG/M
3300032389|Ga0325405_1003596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15910Open in IMG/M
3300032389|Ga0325405_1005019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus13462Open in IMG/M
3300032389|Ga0325405_1008358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10297Open in IMG/M
3300032389|Ga0325405_1013865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7555Open in IMG/M
3300032389|Ga0325405_1044405Not Available2890Open in IMG/M
3300032389|Ga0325405_1072964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1472Open in IMG/M
3300032389|Ga0325405_1079613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica1264Open in IMG/M
3300032389|Ga0325405_1086888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1080Open in IMG/M
3300032390|Ga0325404_1052211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2328Open in IMG/M
3300032390|Ga0325404_1054313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera2213Open in IMG/M
3300032390|Ga0325404_1091554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae912Open in IMG/M
3300032390|Ga0325404_1097237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa826Open in IMG/M
3300032735|Ga0325410_1001378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa26782Open in IMG/M
3300032740|Ga0325411_1000592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae38151Open in IMG/M
3300032740|Ga0325411_1001897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta23423Open in IMG/M
3300032741|Ga0325414_1000036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida67434Open in IMG/M
3300032741|Ga0325414_1048885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2855Open in IMG/M
3300032741|Ga0325414_1106003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa871Open in IMG/M
3300033160|Ga0325402_1071234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1914Open in IMG/M
3300033160|Ga0325402_1124843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae803Open in IMG/M
3300033179|Ga0307507_10046493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4253Open in IMG/M
3300033179|Ga0307507_10061740Not Available3487Open in IMG/M
3300033179|Ga0307507_10067787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3261Open in IMG/M
3300033179|Ga0307507_10076500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2984Open in IMG/M
3300033179|Ga0307507_10091681All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2599Open in IMG/M
3300033179|Ga0307507_10107302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2302Open in IMG/M
3300033179|Ga0307507_10109519Not Available2265Open in IMG/M
3300033179|Ga0307507_10174345Not Available1554Open in IMG/M
3300033179|Ga0307507_10174425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1553Open in IMG/M
3300033179|Ga0307507_10270699Not Available1073Open in IMG/M
3300033179|Ga0307507_10327061Not Available918Open in IMG/M
3300033179|Ga0307507_10354505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa860Open in IMG/M
3300033179|Ga0307507_10616088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica557Open in IMG/M
3300033179|Ga0307507_10638580Not Available542Open in IMG/M
3300033179|Ga0307507_10645402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica538Open in IMG/M
3300033180|Ga0307510_10010779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida10872Open in IMG/M
3300033180|Ga0307510_10024108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7036Open in IMG/M
3300033180|Ga0307510_10029734Not Available6211Open in IMG/M
3300033180|Ga0307510_10035099All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5605Open in IMG/M
3300033180|Ga0307510_10078116All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3240Open in IMG/M
3300033180|Ga0307510_10100552Not Available2684Open in IMG/M
3300033180|Ga0307510_10101004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2675Open in IMG/M
3300033180|Ga0307510_10161085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1840Open in IMG/M
3300033180|Ga0307510_10201846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1522Open in IMG/M
3300033180|Ga0307510_10209312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1474Open in IMG/M
3300033180|Ga0307510_10281705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1132Open in IMG/M
3300033180|Ga0307510_10306534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1048Open in IMG/M
3300033180|Ga0307510_10462082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa710Open in IMG/M
3300034389|Ga0325419_000321All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida50232Open in IMG/M
3300034389|Ga0325419_000852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae33274Open in IMG/M
3300034389|Ga0325419_002190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta22138Open in IMG/M
3300034389|Ga0325419_002408Not Available21241Open in IMG/M
3300034389|Ga0325419_004520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida15481Open in IMG/M
3300034389|Ga0325419_008011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11373Open in IMG/M
3300034389|Ga0325419_011990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8818Open in IMG/M
3300034389|Ga0325419_012219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae8716Open in IMG/M
3300034389|Ga0325419_039167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3281Open in IMG/M
3300034389|Ga0325419_041166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3094Open in IMG/M
3300034389|Ga0325419_053074All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae2251Open in IMG/M
3300034389|Ga0325419_053789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2213Open in IMG/M
3300034389|Ga0325419_059653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1899Open in IMG/M
3300034389|Ga0325419_120335Not Available628Open in IMG/M
3300034688|Ga0325420_001931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa19606Open in IMG/M
3300034688|Ga0325420_020511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5479Open in IMG/M
3300034688|Ga0325420_024125Not Available4875Open in IMG/M
3300034688|Ga0325420_025422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae4686Open in IMG/M
3300034688|Ga0325420_055467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2315Open in IMG/M
3300034688|Ga0325420_071929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1699Open in IMG/M
3300034688|Ga0325420_086282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1325Open in IMG/M
3300034688|Ga0325420_145921Not Available596Open in IMG/M
3300034688|Ga0325420_153563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica547Open in IMG/M
3300034688|Ga0325420_160176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta507Open in IMG/M
3300034689|Ga0325421_007569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10510Open in IMG/M
3300034689|Ga0325421_043024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica2859Open in IMG/M
3300034689|Ga0325421_090783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1072Open in IMG/M
3300034689|Ga0325421_123484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta691Open in IMG/M
3300034689|Ga0325421_128507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa646Open in IMG/M
3300034899|Ga0325407_063096All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1882Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza69.26%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem19.43%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf11.31%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307517_1000554263300028786EctomycorrhizaVFTIKSNYRLSEAGYDKIIEWARSILLEGNRLKENFYDVKSMMKPFSLGY
Ga0307517_1001127373300028786EctomycorrhizaVFTIKSNHRLSEAGYDKIIEWARSILLEGNRVKENFYAAKSMMKPLGLGY
Ga0307517_10016891103300028786EctomycorrhizaLSEAGYDKIVEWARSILPEGNRLKENFYPAKSMMKPLGLGYQKIDMSL
Ga0307517_1003159363300028786EctomycorrhizaLSEAGYDRIIEWARSILPKGNRLKENFYATKSMMKPLGLGYQKIDMCILHGK
Ga0307517_1003367723300028786EctomycorrhizaMTDYGLSEAGYDIIIEWTRSILPEENKLKENFYAAKSIMKPLSLGN
Ga0307517_1003432633300028786EctomycorrhizaLSEAGYDKIIEWARSILHEGNRLKENFYAAKSMMKPLGLGY
Ga0307517_1004403723300028786EctomycorrhizaLDYRLSEAGYDRIVEWARSILPEGNRLKENFYTTNFIMKPLGLEY
Ga0307517_1006813273300028786EctomycorrhizaLSEAEYDKIIEWARSILPEGNRLKENFYATKSMMKPLGLGY
Ga0307517_1008107273300028786EctomycorrhizaIVHVFTIKLDDGLCKVGYDKIIEXAXSILPKEDRLKENFYTAKSMMKPLDLG
Ga0307517_1013656913300028786EctomycorrhizaVFTIKSDYGMSEVGYDSIIEWEKSILPKENMLKENFYAAKSMMKSFGL
Ga0307517_1013965613300028786EctomycorrhizaSIIACMFTIKSNYGLSEAGYDRIIEWARSILLEGKRLKKNLYDVKYMMKNLSLGC
Ga0307517_1018855713300028786EctomycorrhizaVFTIKSNYRLSEAGYDKINEWAISILLEGNRLKENFYDVKSMMKPFSLGY
Ga0307517_1020952633300028786EctomycorrhizaLSEAGYDRIIEWARSILPEGNRLKENFYATKSMMKPLGLGYQKIDMCILHGK
Ga0307517_1022198533300028786EctomycorrhizaHGLSKADYEKIIEXARSILFEGNKLKENFYATKSMMKPLVLGY
Ga0307517_1024170013300028786EctomycorrhizaMFNIKSDHGLSEADYDRIVEWARSILPEGNRLKKNFYPAKSMMKPLGLGYQKIDM
Ga0307517_1032812323300028786EctomycorrhizaVFTIKSDHGLSEACYDKIVEWARSILPEGNRLKDNLYAVKSMMKPLGLGYQK
Ga0307517_1043660713300028786EctomycorrhizaMFTIKSDHGMSESGYDKIIEWARSILPEGNKLKENFYAAKFMMKPL
Ga0307517_1044257923300028786EctomycorrhizaLVVAQVFTIKSDHGLSEASYDKIIEWARSILPEGNKLKENFYVAKSMMKPLGLGD
Ga0307517_1048615113300028786EctomycorrhizaLNEAGYDRIIEWRRSILLEGKRLKKNLYDAKSMMKNLSL
Ga0307517_1054806023300028786EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWAKSILPEENRLKENFYAAKSMMKPLD
Ga0307517_1056486913300028786EctomycorrhizaHGLSEADYDKIIEWAISILPEGNRLKENFYAAKSMMKTFGL
Ga0307515_1000618733300028794EctomycorrhizaMKSDDGLSEAGYDRVIKCTISILPVGNRLKENFYAAKFMMKPIDL
Ga0307515_1007194513300028794EctomycorrhizaVFTIKSDHGLSEVDYDKIIKWARSILLEGNRLKENFYAAMSMIKPLGLGCH
Ga0307515_1012331943300028794EctomycorrhizaVFTIKSDYGLSEAGYDKIIEWARSILLEGNKLKENFYATKSMMKPLGLGY
Ga0307515_1015810533300028794EctomycorrhizaVFTIKSDHGLSEAGYYKIIEWARSILPEGNRLKKNFYIAKSMMKPLGLGY
Ga0307515_1020172733300028794EctomycorrhizaMKSDHELSEAGYDKKFECTRNILLEGNKLKENLYGVKSMMKPLGIGY
Ga0307515_1028292523300028794EctomycorrhizaVFTIKSDHGLSEDGYDKIIEWARSILPEGNRLKENLYAAKSMMKSLGLGY
Ga0307515_1034613713300028794EctomycorrhizaMFNIKSDHGLSEADYDRIVEWARSILPEGNRLKKNFYPAKSMMKPLGLGYQKIDMSL
Ga0307515_1045949713300028794EctomycorrhizaVFTIKSDYGLSEAGYEKIIEWARSILLEGNKLKENLYATKSMMKLLGLGY
Ga0307515_1052737013300028794EctomycorrhizaDHGLSEAGYDKIIEWARSILLEGNRMKENFYAAKSMMKPLGLGY
Ga0307515_1054878933300028794EctomycorrhizaLDYGLSETGYEKIIEWARSIPLEGNRLKENFYATKYMMKPLGLGY
Ga0307515_1059064013300028794EctomycorrhizaVFTIKSDHGLSKAGHDKIIEWARRILPEGNRLKENFYVAKSMMKPLSLGY
Ga0307515_1083510213300028794EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLG
Ga0307511_1000906563300030521EctomycorrhizaVLTIKSDYKLSKVGYYKIVEWAKSFLLEGNKLKENFYAAKSMMKPLSLGY
Ga0307511_1006508913300030521EctomycorrhizaNYRLSEAGYDRIVKCTKSILPERNRLKENLYDVKSMMKPLGLGY
Ga0307511_1009119913300030521EctomycorrhizaLSEAYYDRIIKWTRSILPERNKLKDNFYAAMSMMKHLDL
Ga0307511_1009166013300030521EctomycorrhizaVFTIKSDYRLSEVSYDRIIKWARNILFEGRRLKENFYAARSMMKPLGL
Ga0307511_1010184033300030521EctomycorrhizaMFNIKSDHGLSEADYDRIVEWARSILPEGNRLKENFYPAKSMMKPLGLGYQKIDMSL
Ga0307511_1011537713300030521EctomycorrhizaRYNKIIEWARSILLEGNRLKENFYATKSMMKPLGLGY
Ga0307511_1017716313300030521EctomycorrhizaLSDASYDKIIERMISILPEGNKLKKNFYIAKFMMKPF
Ga0307511_1017945013300030521EctomycorrhizaVFTIKSDHGLSEVGYDKIIKWTRSILPEGNRLKENFYIAKSMMKPLDLGYQKI
Ga0307511_1021249913300030521EctomycorrhizaVFTIKSDCGLSEAGYDKIIELARSILPKENRLKKNFYAAKSMMKPLG
Ga0307511_1024212423300030521EctomycorrhizaVFTIKSDHGLSKAGYDKIIEKARSILPEGNRLKENFYATKSMMKPLGL
Ga0307511_1024524213300030521EctomycorrhizaMFTIKSDHGLSEAGYDKIIEWTRRILAEGNRLKENFYADKSMMKPLGLRY
Ga0307511_1026693723300030521EctomycorrhizaVFTIKSDHRLSEIGYEKIIEWERSILLEENRLKEKFYTAKSMMKPLGLGY
Ga0307511_1028306113300030521EctomycorrhizaSYDKIMEXARSILPEGNKLKENFNAAKSLMKPLGLGY
Ga0307511_1032220213300030521EctomycorrhizaVFTIKSYHGLSEASYDKIIKWARSILPEGDRLKENFYVAKSMMKPFGLRYLK
Ga0307511_1044828113300030521EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGY
Ga0307512_1000866213300030522EctomycorrhizaVFTIKSDYGFNEFGYNSIIEWAKSMLPKRNRLKENFYAAKSITKPLGLGYQKN
Ga0307512_1007358143300030522EctomycorrhizaMTDYGLSEAGYDIIIKWTRSILPEENKLKENFYAAKSIMKPLSLGN
Ga0307512_1009733513300030522EctomycorrhizaNKANYNIIFEWEKNILHERNRLKENFYAAKSMMKPFSLRY
Ga0307512_1011625813300030522EctomycorrhizaSDHGLSEAGYDKIIEWARSILLKGNRLKENFYDVKSIMKPLGLGY
Ga0307512_1015214713300030522EctomycorrhizaSVVAQVFTIKSDHGLSEAGYDKIIEWVRSILPEGNRLKENFYAAKSMMKPLSLGY
Ga0307512_1017930823300030522EctomycorrhizaVFTIKSNHRLSEAGYDKIIEWARSILLEGNRVKENFYAAKSMMKPLGLEY
Ga0307512_1019133913300030522EctomycorrhizaVFTIKSDHELSEVGYDKIVEWTRSIISKGNRLKEKFYAAKSI
Ga0307512_1021515423300030522EctomycorrhizaLNEIGYDNIVKWARSILPEGNMLKEKFYATKSMMKPFGLGY
Ga0307512_1025738623300030522EctomycorrhizaVFTIKSDHGLSEVGYDKIIKWTRSILPEGNRLKENFYAAKSMMKPLGLGYQKI
Ga0307512_1035378923300030522EctomycorrhizaVFTIKSDHGLSKAGHDKIIEWARRILPEGNRLKENIYDAKSMMKPLG
Ga0307512_1045604213300030522EctomycorrhizaLSEAGYNKIVEWTRSILPEGNRLKENFYAAKSMMKPLGLGYQKID
Ga0307513_10004567103300031456EctomycorrhizaVFTIKSNCGLSEAGYDRIIKWARSILPEKNMLKENFYAAKSMMKPFDLGY
Ga0307513_1001929843300031456EctomycorrhizaVFTIKSDDELSEAGYEKIIEWARSVLPEGNKLKENFYVAKSMMKPLGLGYQ
Ga0307513_1002817433300031456EctomycorrhizaVFTIKSNHELSGAGYDKIIEXVRNILFEMNRLKENFYAAKSMMKPLSIGYQKIELTLV
Ga0307513_1005222373300031456EctomycorrhizaVFTIKSDHGLSEVGYDKIIEWTRSILPEGNRLKENFYVAKSMMKPLDLGY
Ga0307513_1005339043300031456EctomycorrhizaLSEAGYDKIIEWARSILLEGNRLKENFYDVKSMMKPFSLGY
Ga0307513_1009206863300031456EctomycorrhizaVFTIKLDQGLSEASYDKIMEWARSILPEGNKFKENFYAAKFMMKPLGLGY
Ga0307513_1010407523300031456EctomycorrhizaLSEVGYNRIVEWAISILHEGNEMKENFYADKSMMKPLGIRPEN
Ga0307513_1011433853300031456EctomycorrhizaVFTIKSDYGLSEADYEKIIEWARSILLEGNKLKENFYATKSMMKPLGLGY
Ga0307513_1011629933300031456EctomycorrhizaMTDYGLSEAGYDIIIEWTRSILPEENKLKENFYTAKSIMKPLSLGN
Ga0307513_1013314123300031456EctomycorrhizaVFTIKSDYGLSEAGYEKIIEWARSILLEGNKLKENFYATKSMMKLLGLGY
Ga0307513_1014808233300031456EctomycorrhizaMKSDHELSEAGYDKIFECTRNILLEGNKLKENLYGVKSMMKPLGIEY
Ga0307513_1015935633300031456EctomycorrhizaVFTIKSNHELSEAGYDKIIEWARSILPEGNRLKENFYVAKSMMKPLGLGYQKIDMC
Ga0307513_1016112843300031456EctomycorrhizaVFTIKSDHRLSEAGYEKIIEWARSILPEGNKLKENFYAAKSMMKPLGLGY
Ga0307513_1018517943300031456EctomycorrhizaVFTIKLDHRLSEAGYDKIIEWVRSILLEGNRLKENLYVAKSMMKPLGLGY
Ga0307513_1023208413300031456EctomycorrhizaHSKLSVVAQVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYDAKSMMKPLGLGY
Ga0307513_1029574013300031456EctomycorrhizaSDHGLSEAGYDKIIEWARSILLEGNRMKENFYAAKSMMKPLGLGY
Ga0307513_1037473513300031456EctomycorrhizaVFTIKSDYGFNEFGYNRIIEWAKSMLPKRNRLKENFYAAKSITKPLGLGYQKN
Ga0307513_1049554513300031456EctomycorrhizaGYDKIIEWTRSILTESNKLKENFYIVKSMMKPLSLGY
Ga0307513_1051403423300031456EctomycorrhizaVFTIKSDYGLSETGYEKIIEWARSILLEGNRLKENFYATKYMMKPLGLGY
Ga0307513_1059770223300031456EctomycorrhizaMLSEAGYDIIIEWTRSILPEGNMLKDNFYAAKSMMKPLDLGY
Ga0307513_1072525633300031456EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKS
Ga0307513_1086737713300031456EctomycorrhizaKLSVVAHVFIIKSDYRLSEAGYEKIIEWKRNILLEGNMLKDNFYAAKSIIKPLSLGY
Ga0307509_1005289093300031507EctomycorrhizaVFIITSDCGLSEADYDRIIEWARSILPEENRLKENFYAAKSIMKPLSLGN
Ga0307509_1006337743300031507EctomycorrhizaVFTIKSDHGLSEAGCDKIIEWARSILPKENRLKENFYAAKSMMKPLGLGY
Ga0307509_1006497013300031507EctomycorrhizaLVVALVFNITSDYELSEADYDKITKWARSILPEGNMLKESLYAAKSMM
Ga0307509_1011509513300031507EctomycorrhizaYDKIIEWAISILPEGNRLKENFYAAKSMMKPLGLGY
Ga0307509_1012486413300031507EctomycorrhizaAVAQVFTIKSDHGLSEAGYDKIIEWARSILLEGNRMKENFYAAKSMMKPLGLGY
Ga0307509_1014169233300031507EctomycorrhizaMFTIKSDHGLSEANYDRIIDWARSILPEENRLKENFYTAKSMMKPLDLGY
Ga0307509_1018439333300031507EctomycorrhizaMKSDHELSEAGYDKNFECTRNILLEGNKLKENLYGVKSMMKPLGIGY
Ga0307509_1025151433300031507EctomycorrhizaVFTIKSDHGLSEAEYDKIIEWARSILLKGNRLKENFYAAKSIMKPLGLGY
Ga0307509_1028062213300031507EctomycorrhizaLSEAGYDKINEWAISILLEGNRLKENFYDVKSMMKP
Ga0307509_1036291513300031507EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWTRSILLEGNRLKENFYAAKSMMKTLGLGY
Ga0307509_1037344423300031507EctomycorrhizaLSEAGYDKIIEWARSILPEGNRLKENFYATKSMMKPLGLGYQKIDMCILHGK
Ga0307509_1049870513300031507EctomycorrhizaFSEAGYDKIIEWARSILPEGNKLKENFYAAKSMMNPSV
Ga0307509_1050747813300031507EctomycorrhizaAVAQVFTIKSDHGLSEAGYDKIIEWARSILLEGNRMKENFYAVKSMMKPLGLGY
Ga0307509_1063441433300031507EctomycorrhizaVFTIKSDHGLSDAGYDKIIEWVRSILPEGNRLKENFYAAKS
Ga0307509_1074342513300031507EctomycorrhizaVVVHVFTFESDHRLNKANYNIIFEWEKSILHERNRLKENFYAVKSMMKPFSLRY
Ga0307509_1080643813300031507EctomycorrhizaVFTIKSDHGLSEAGYDKIIKWARSILLEGNRLKENFYAAKSMMKPLGLGYQKID
Ga0307509_1081573313300031507EctomycorrhizaAGYDKIIEWARSILLEGNKLKENYATKSMMKPLGLGY
Ga0307509_1093882833300031507EctomycorrhizaLSEAGYDKIIEWAISILLEGNRLKENFYAAKSMMK
Ga0307509_1095882523300031507EctomycorrhizaVFTIKLDYSLSEAGYEKIIEWARSILLEGNMLKENFYATKS
Ga0307509_1096273013300031507EctomycorrhizaLLIVAQIFTIKLDYGLTEASYEKIIEXARNILLEGNVLKYNFHAAKSMMKPLV
Ga0307508_1006204613300031616EctomycorrhizaEYGLSKTHYDNIIEWVKNILPKWKKVKKHFYATKSMMKPLGLGLKRK
Ga0307508_1007666013300031616EctomycorrhizaKSDHELSETSYDKIMEWARSILPEGNKLKENLYAAKSMMKPLGLGY
Ga0307508_1007925763300031616EctomycorrhizaVLIIKSNYGLSEAGYDKIIEWTRNILPERNRLKEKFYVAKSMMKIIGYDTRKLTCV
Ga0307508_1015492633300031616EctomycorrhizaMLSEAGYDIIIEWTRSILPEGNMLKDNFYAAKFMMKPLDLGY
Ga0307508_1022569913300031616EctomycorrhizaMFNIKSDHGLSEADYDRIVEWARSILPKGNRLKENFYPAKSMMKPLGLGY
Ga0307508_1026873323300031616EctomycorrhizaVFTIKLEHRLGEIGYDRIVECARNILPERNKLKENFYTTKSMMKPLGLGYQKISICPN
Ga0307508_1031373023300031616EctomycorrhizaTIKLDYRLTEAGYDKIIEWAKNILPERNKLKENFYTAKSMMKPLGLEY
Ga0307508_1039157223300031616EctomycorrhizaVFTIKSDHELSEVGYEKIIEWARSILPEGNRLKENFYTVKSMMKPLGL
Ga0307508_1052461923300031616EctomycorrhizaAQVFTIKSDHGLSEAGYDKIIEWAISILPEGNRLKENFYAAKSMMKPFGLGYQKIDMCPN
Ga0307508_1053361623300031616EctomycorrhizaLSEAGYDKIVEWTRSILPEGNRLKENFYPAKSMMKPLGLGYQKIDMSL
Ga0307508_1060672233300031616EctomycorrhizaLSEAGYDKIIEWVRSILPEGNRLKENFYAAKSMMKPLDLGYQKIDMCPNFCML
Ga0307508_1067155323300031616EctomycorrhizaKSNHGLSEASCDKIMECARSILLEGNKLKENFYAAKSMMKPLGHDLLP
Ga0307508_1068585713300031616EctomycorrhizaVFTIKLDYRISKAGYDKIIEWARNILPEGNKLKENFYAAKSMLKPPGPGYQKIN
Ga0307508_1069151713300031616EctomycorrhizaVFTIKLDQGLSEASYDKIMEWARSILPEGNKFKENFYAAKSMMKPLGLGY
Ga0307508_1071208823300031616EctomycorrhizaVFTIKSDHGLSKAGYDKIIEKARSILLEGNRLKENFYATKSMMKPLGLGYQKIDMCPN
Ga0307508_1072194613300031616EctomycorrhizaMFNIKSDHGLSEADYDRIVEWARNILPEGNRLKKNFYPAKSMMKPLGLGYQKIDMSL
Ga0307514_1001824463300031649EctomycorrhizaVLIIKSNYGLSEAGYDKIIEWTRNILPERNRLKENFYVAKSMMKIIGYDTRKLTCV
Ga0307514_1005211073300031649EctomycorrhizaTIKSDYGLSEAGYDKIIEWARSILLEGNKLKENFYATKSMMKPLGLGY
Ga0307514_1005426813300031649EctomycorrhizaMFTIKSDHGLSEAGYDKIIEWTRRILAEGNRLKENFYADKSVMKPLSLRY
Ga0307514_1011714013300031649EctomycorrhizaLTILQVFTIKSDHGLRKADYDKIDEXAKNTLPEANRLKENFYVAKSMMKSLG
Ga0307514_1017539223300031649EctomycorrhizaVFTIKSNYRLSEAGYDKIIEWARSILLEGNRLKENFYDVKSMIKPFSLGY
Ga0307514_1017699213300031649EctomycorrhizaVFTIKSDYGFNEFGYNSIIEWAKNMLPKRNRLKENFYAAKSITKPLGLGYQKN
Ga0307514_1025959313300031649EctomycorrhizaVVTIKSDHGLSEAGYEKIIEWARSILPERNRLKENFNIAKSMMKPLDLGYQKIDICTYVN
Ga0307514_1028117633300031649EctomycorrhizaLSEADYDRIIEWARSILPEENRLKENFYAAKSIMKPLSLGN
Ga0307514_1031574613300031649EctomycorrhizaVFTIKSDHGLSKAGHDKIIEWARRILPEENRLKENFYDAKSMM
Ga0307514_1032384613300031649EctomycorrhizaAYVFTIKSDYGLSEAGYDKIIEWARSILLEGNKLKENFYATKSMMKPLGLGY
Ga0307514_1032723213300031649EctomycorrhizaGLSEAGYDKIIEWARSILLKGNRLKENLYAAKSMMKPLGLGY
Ga0307514_1038913213300031649EctomycorrhizaIKLDDGLCKVGYDKIIEXAXSILPKEDRLKENFYTAKSMMKPLDLG
Ga0307514_1042001213300031649EctomycorrhizaVFNIKLDHKLNETGYDRIVKWARSILPEGNMLKEKFYATKSMMKPLGL
Ga0307514_1042023823300031649EctomycorrhizaVFTIKLDYGLSETGYEKIIEWARSIPLEGNRLKENFYATKYMMKPLG
Ga0307514_1042811623300031649EctomycorrhizaMTDYGLSEAGYDRIIEWTRSILPEENKLKENFYAAKSIMKPLSLGN
Ga0307514_1044114623300031649EctomycorrhizaLSEVGYDKIIEWARRILPERNRLKENFYAAKSMMKPLGLGY
Ga0307514_1045171123300031649EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWARSILLKGNMLKENFYDVKSIMKPLGLGY
Ga0307514_1046978913300031649EctomycorrhizaMFTIKSDHGLSEVGYDKIIEWARSILPRRNRLKENFYVAKSMMKPLGLGYQ
Ga0307514_1047270213300031649EctomycorrhizaVFTIKSDYGFNEFGYNSIIEWAKSMLPKRNRLKENFYAAKSITKPLGQGYQKN
Ga0307516_1005869263300031730EctomycorrhizaVFTIKLDQGLSEASYDKIMEWARSILPKGNKFKENFYAAKFMMKPLGLGY
Ga0307516_1007648643300031730EctomycorrhizaMFTIKSDLGLSEVSYDKIVEWMRSILPEGNRLKENFYVAKSMMKPLGLGY
Ga0307516_1008721743300031730EctomycorrhizaMNEADYDSIIKWEKSILLYGNKLKENFYVVKHMMKLLDLGYQKINM
Ga0307516_1009784843300031730EctomycorrhizaAQVFTIKSDHRLSEVGYDKIIKWARSILPKGNWLKENLYAAKSMMKPLDLGY
Ga0307516_1010355323300031730EctomycorrhizaTIKLDYRLSEAGYDRIVEWARSILPEGNRLKENFYTSNFIMKPLGLEY
Ga0307516_1021222933300031730EctomycorrhizaAQYEKIIEWARSILPEGNKLKENFYAAKSMMKPLGLGY
Ga0307516_1024173313300031730EctomycorrhizaGYDIIIEWTRSILPEENKLKENFYAAKSIMKPLSLGN
Ga0307516_1025484933300031730EctomycorrhizaVFTIKSHYSLSGADYDSIIERVKNMLLEGNRLKENFYAAKSIMKPL
Ga0307516_1029020113300031730EctomycorrhizaGLSEAGYEKIIEWARSILPEGNRLKENFYATKSMMKPLGLGY
Ga0307516_1032784623300031730EctomycorrhizaLSEAGYDKIIEWAKSILPEGNGLKENFYTAKSMMKPLGLGY
Ga0307516_1041010623300031730EctomycorrhizaLSEAGYDRIVEWARSILPEGNRLKENFYTTNFIMKPLGLEY
Ga0307516_1041940423300031730EctomycorrhizaLSEAGYDRIIEWARSILPEGNRLKKNFYATKSMMKPLGLGYQKIDMCILHGK
Ga0307516_1044382213300031730EctomycorrhizaVFTIKSDHGLSEAGYDKIIKWARSILLEGNRLKENFYAAKSMMKPLGLGYQKI
Ga0307516_1053486623300031730EctomycorrhizaVFTIKSDHGLSETGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGY
Ga0307516_1059767013300031730EctomycorrhizaDHGLSEAGYDKIIEWARSILPEGNRLKENFYATKSMMKPLGLGY
Ga0307516_1085906813300031730EctomycorrhizaVFTIKSDHRLNEVDYERIVEWTRNILPEGNKLKENFYTVKSMKKPIDLGY
Ga0307516_1087510523300031730EctomycorrhizaKLLVVAQVFTIKSDHGLSEASYDKIIEWARSILPEGNKLKENFYVAKSMMKPLSLGD
Ga0307516_1091299613300031730EctomycorrhizaVFTIKSDHGLSEVGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLSLRY
Ga0307516_1102171313300031730EctomycorrhizaVCTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMM
Ga0307518_1000631543300031838EctomycorrhizaLSEAGYDRIIEWARSILLEGKRLKKNLYNAKSMMKNLSLGC
Ga0307518_1003215253300031838EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWARSILLEGNRMKENFYAAKSMMKPLGLGY
Ga0307518_1005509333300031838EctomycorrhizaVFTIKSDHELNEVGYDKIIEWTRSILTESNKLKENFYIVKSMMKPLSLGY
Ga0307518_1005872013300031838EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGYQ
Ga0307518_1007573723300031838EctomycorrhizaEADYDKIIEWLRSILLKENRMKENFYTAKFMMKPLGLTY
Ga0307518_1009472213300031838EctomycorrhizaMFTIKSDHRLSEARYDKIIEWARSILLEGNRLKENFYVAKSMMKPLSLG
Ga0307518_1013987913300031838EctomycorrhizaMKSDHRLSEVGYNKIDECVNNILLEGNRLKENFYVVKSMMKPFSL
Ga0307518_1014400923300031838EctomycorrhizaLSETGYEKIIEWARSILLEGNRLKENFYATKYMMKPLGLGY
Ga0307518_1016302913300031838EctomycorrhizaVLIIKSDYGLSEAGYDIIIEWTRSILPEGNMLKENFYAAKSMMKPLDLGY
Ga0307518_1016914743300031838EctomycorrhizaHVFTIKSDHRLSEIGYEKIIEWERSILLEENRLKEKFYTAKSMMKPLGLGY
Ga0307518_1022220523300031838EctomycorrhizaQVFTIKSDHELSETSYDKIMEWARSILPEGNKLKENLYAAKSMMKPLGLGY
Ga0307518_1026849813300031838EctomycorrhizaMSEAGYDKIIEWARSILLEGNKLKENFYATKSMMKPLGLGY
Ga0307518_1029920713300031838EctomycorrhizaIKSDHGLSEAGYDKIIEWAKSILPEGNRLKENFYAAKSMMKPFGLGY
Ga0325403_100039013300032354XylemVFTIKSDHGLSEAGYDKIIEWAISILPEGNRLKENFYAAKSMMKPLGLGY
Ga0325403_1000808163300032354XylemVFTIKSDHGFSEVGYDKIIEWARSILPKGNRLKENFYAAKSMMKPLGLGY
Ga0325403_100442853300032354XylemMFTIKLDHRLSEAGYNILFEWAKSILSEGHRLKENFYVAKSIMKPLSLGY
Ga0325403_100556513300032354XylemMKLDYRLSEAGYDRIVEWEKSILPEENRLKENLYTTNFIMKPLGLGY
Ga0325403_100730623300032354XylemVFTIKSDHGLSEFGYDKIIESMISILPEGNRLKDNFYAAKSMMKPLGLGYQKIGMP
Ga0325403_1009287113300032354XylemVFTIKLDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLG
Ga0325403_101767833300032354XylemVFTIKSDHGLSEAGYDKIIEWARSNLPEGNRLKENFYAAKSMMKPLSLGY
Ga0325403_101819123300032354XylemVFTIKSDHELSKAGYDKIIEWVRSILPEGNRLKENFYAAKSMMKPFGLG
Ga0325403_103689523300032354XylemVFTIKLDYWLSEAGYDKIIEWARNILPEGNRMKENFYAAKSMMKPLGLGY
Ga0325403_103814433300032354XylemVFTIKSDHGLSEAGYDKIIEWARSILPEGNKLKENFYAAKSMMKPLGLGY
Ga0325403_104312253300032354XylemDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGYTTLKMLR
Ga0325403_105111333300032354XylemVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMK
Ga0325403_105210623300032354XylemVFTIKSDHGLNEAGYDKIMEWVRSILPEGNRLKENFYAAKSMIKPFGLG
Ga0325403_105357943300032354XylemVFTIKSNHGLSETGYDNIIEWARSILPEGNRLKENFYAAKSMIKPLGLGY
Ga0325403_106061413300032354XylemVFTIKSDHGLSEAGYDKIIEWARNILPEGNRLKENFYAAKSMMKPLDLGY
Ga0325403_106349613300032354XylemVFTIKLDHGLSEANYDRIVDWARNILLERNRLKENFYTAKSMMKPLGLRYQKIN
Ga0325403_106528013300032354XylemVFTIKSDYGMSEVGYNSIIEWEKSILPEENMLKENFYSVKSMMKSFGL
Ga0325403_106758423300032354XylemVFTIKSDHGLSEAEYDKIIEWARSILPEGNRMKENFYFAKSMMKPLGLGY
Ga0325403_108177733300032354XylemVFTIKSDHGLSEAGYDKIIEWTRSILPEENRLKENFYAAKSMMKPLGLGY
Ga0325401_100219973300032355XylemVFVIKLDYGLSEAGYDRIVGWVRSILPETNMLKENLYAAKSMMKPLNL
Ga0325401_1003355153300032355XylemVFTIKSDHGLSEAGYDKIIEWGRNILPEGNRLKENFYAAKSMMKPLDLGY
Ga0325401_1005824123300032355XylemSDYGLSATGYDRIVEWAKCILLKGNRLKRNFYVVTSMMKPLDLGH
Ga0325401_100862283300032355XylemLSEAGYDEIIEWARSILPEGKKLKENFYAAKSMMKPFGLGY
Ga0325401_101528023300032355XylemMFTIKLDHRLSEAEYDKIIEWAISILPKGNRLKENFYVAKSIVKPLGLGY
Ga0325401_103385413300032355XylemVFTIKSDHGLSEANYDRIVDWARNILLERNRLKENFYTAKSMMKPLGLRYQKIN
Ga0325401_105470713300032355XylemLSEAGYDRIIEWTRSILPEKNKLKENLYAAKSMMKPLGLGYQKIHMF
Ga0325401_107203723300032355XylemVFTIKSDHRLSEAGYDKIIKWARSILPEENRLKENLYAAKSMMKPLGLGY
Ga0325401_109125643300032355XylemGLSEAGYDKIIEWAISILPEGNRLKENFYAAKSMMKPLGLGY
Ga0325401_115258623300032355XylemDRIVEWTRSILPEGNRLKENFYVAKSMMKPLGLGYQKN
Ga0325401_115947443300032355XylemVFTIKSDHGLSKVGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGYQKIDIC
Ga0325401_123281413300032355XylemVFTIKSDHGLSEAGYDKIIEWARSILPKGNRLKENFYAAKSMMKPLGL
Ga0325400_109324543300032374XylemVFTIKSDHRLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGY
Ga0325400_110196833300032374XylemIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMNPSV
Ga0325400_130971913300032374XylemVFTIKSDHGLSEAGYDKIIEWARSILPKGNRLKENFYAAKSMMKPLGLGY
Ga0325405_1000088193300032389XylemMKLDYRLSEAGYDRIVEWEKSILPEENRLKENFYTTNFIMKPLGLGY
Ga0325405_1000303393300032389XylemVFTIKSDHGLSEVGYDKIIEWMISILPEGNRLKDNFYAAKSMMKPLGLGYQKIGMP
Ga0325405_1001135233300032389XylemLSEAGYEKIIEWMRSILPEGNKLKENFYAVKSMMKPLGLGY
Ga0325405_100359643300032389XylemVFTIKSDYGMSEVGYDSIIEWEKSILPEENMLKENFYTVKSMMKSFGL
Ga0325405_100501953300032389XylemVFTIKSDHGLSEAGYDKIIEWAISILHKGNRLKENFYAAKSMMKPLGLGY
Ga0325405_100835813300032389XylemVFTIKSYYRLSDASYDKIIEWARNILLEGNKLKENLYDVKSMMKPFSLGY
Ga0325405_101386553300032389XylemVFTIKLDHGLSKASYDKIIEWARSILPEGNKLKENFYATKSMMKPLGLGY
Ga0325405_104440533300032389XylemMLNEVGYDNIIEWTRSILTERSKLKENFYIIKSMMKPLSLGY
Ga0325405_107296423300032389XylemVFTIKLDHGLSEAGYDKIIEWERSILPEGNRLKENFYAAKSMMKTLSLGY
Ga0325405_107961333300032389XylemVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYTAKSMMKPLGL
Ga0325405_108688823300032389XylemVFTIKSDHGLSEAGYDKIIEWAISILPERNKLKENFYAAKSMMKPLGLGY
Ga0325404_105221113300032390XylemLSEAGYDKIIEWARSILPEGNRLKENFYTAKSMMKPLGL
Ga0325404_105431313300032390XylemGLSEAGYDKIIEWARSILPEGNKLKENFYAAKSMMKPLGLGY
Ga0325404_109155433300032390XylemVFTIKSDHGLSRAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLSLGYQKIDMC
Ga0325404_109723723300032390XylemVFTIKSDHGLSEARYDKIIEWERSILPEGNKLKENFYTAKSMMKPLGLGY
Ga0325410_100137883300032735XylemVFTIKSNHELSEAGYEKIIEWMRSILPEGNKLKENFYAVKSMMKPLGLGY
Ga0325411_1000592193300032740XylemLDYWLSEAGYDKIIEWARNILPEGNRMKENFYAAKSMMKPLGLGY
Ga0325411_100189793300032740XylemVLIIKSDYRLSEAGYEYIIEWARSILPEGNMLKENFYAAKSMMKPLGLGY
Ga0325414_1000036443300032741LeafMFTIKSDYRLSEAGYDRIVEWTRSILPKGNRLKENFYAAKFMMKPFSLGY
Ga0325414_104888513300032741LeafSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLSYTTLKMLR
Ga0325414_110600313300032741LeafLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMK
Ga0325402_107123423300033160XylemMFTIKSDLGLSEVSYDRIVEWTRSILPEGNRLKENFYVAKSMMKPLGLGYQKN
Ga0325402_112484323300033160XylemVFTIKSDHRLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLSLGY
Ga0307507_1004649333300033179EctomycorrhizaLVVALVFNITSNYELSEADYDKITKWARSILPEGNMLKESLYAAKSMM
Ga0307507_1006174013300033179EctomycorrhizaVFTIKSDHELSEADYDRAVEWVRNILLEVNRLKENFYVAKSMMKTLGHTS
Ga0307507_1006778743300033179EctomycorrhizaVFTIKSNHKLSEAGYDKIIEWARSILLEGNRVKENFYAAKSMMKPLGLGY
Ga0307507_1007650023300033179EctomycorrhizaMFTIKSDHGLSEAGYDKIIEWTRRILAEGNRLKENFYADKSVMKPLGLRY
Ga0307507_1009168153300033179EctomycorrhizaLSEAGYDRIIEWTRSILPKGNRLKENFYATKSMMKPLGLGYQKIDMCILHGK
Ga0307507_1010730213300033179EctomycorrhizaVLIIKSDYGLSEAGYDKIIEWTRNILPERNRLKENFYVAKSMMKIIGYD
Ga0307507_1010951913300033179EctomycorrhizaSDHELSEADYDRAVEWVRNILLEVNRLKENFYVAKSMMKTLGYTSICCTILKI
Ga0307507_1017434523300033179EctomycorrhizaMSDHELSEAGYDKIVELARSILHEGNMLKENFYAAKSMMKPVGLGY
Ga0307507_1017442523300033179EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKDNFYDAKSMMKPLGLGY
Ga0307507_1027069913300033179EctomycorrhizaVFTIKSNYRLSEAGYDKINEWAISILLEGNRLKENFYDVKSM
Ga0307507_1032706113300033179EctomycorrhizaVFTIKSNYRLSEAGYDKIIEWARSILLEWNRLKENFYDVKSMMKPFSLGY
Ga0307507_1035450523300033179EctomycorrhizaEAGYYKIIEWAISILPEGNRLKENFYAAKSMMKTFSL
Ga0307507_1061608813300033179EctomycorrhizaVFTIKSDHGLSKAGHDKIIEWARRILPEGNRLKENFYVAKSMMKPL
Ga0307507_1063858023300033179EctomycorrhizaDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPSV
Ga0307507_1064540213300033179EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWTRIILPEGNRLKENFYVAKSMMKPLGLGYQKIDICPNF
Ga0307510_10010779143300033180EctomycorrhizaMFTIKSYYKVNETSYDRIVEWTRSILPEENRQEENLHAVKSMMKPL
Ga0307510_1002410833300033180EctomycorrhizaMFTIKLHHGLSEAGYDIIIEWARTFLLERNRLKENFYDAKFMMKPFCLGY
Ga0307510_1002973443300033180EctomycorrhizaLSEAGYDKINEWAISILLEGNRLKENFYDVKSMMKPFSLGY
Ga0307510_1003509943300033180EctomycorrhizaMFTIKSDYRLIEAGYDKIIEWVRSILLEGNRLKENFYDAKSIMKPFSLGY
Ga0307510_1007811633300033180EctomycorrhizaMFTFKSHYRLSETGYDRIIEWTRSILLKGNKMKENFYVAKSRMKPLGLGY
Ga0307510_1010055263300033180EctomycorrhizaIKSDHRLSEASYDKIMEWARSILLEGNKLKENFYTAKSVMKPLDLGY
Ga0307510_1010100413300033180EctomycorrhizaGYDKIIEWARSILLEGNRMKENFYAAKSMMKPLGLGY
Ga0307510_1016108513300033180EctomycorrhizaLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGYQKI
Ga0307510_1020184643300033180EctomycorrhizaSEVGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGY
Ga0307510_1020931223300033180EctomycorrhizaVFTIKSDHRLSKAGYDKIIEWARSILPEGNRLKENFYATKSMMKPLGLGY
Ga0307510_1028170523300033180EctomycorrhizaVITIKSDHGLSEAGYDKIIEWARSILPEGNSLKENFYAAKSMMKPLGLGY
Ga0307510_1030653413300033180EctomycorrhizaVFTIKSDHGLSEAGYDKIIEWAISILPEGNRLKENFYAAKSMMKPLGLGYQKIDM
Ga0307510_1046208213300033180EctomycorrhizaVFTIKLDYRLSEASYDRIVEWAKSILHEENKLKENFYAAKSMLKSFGLRYQKID
Ga0325419_000321_22754_229063300034389LeafVFTIKSDYRLSEAGYDRIVEWTRSILPKGNRLKENFYAAKFMMKPFSLGY
Ga0325419_000852_11388_115403300034389LeafVFTIKSDCELSEASYDKIIEWARSILFEENKLKKNFYAVKSMMKPLDLGY
Ga0325419_002190_17903_180553300034389LeafMFTIKSDHGLSEAEYDKIIEWAISILPKGNRLKENFYVAKSMVKPLGLGY
Ga0325419_002408_1664_18163300034389LeafVFTIKSDHGLSEAGFDRILEWTRNILPEGNKLKENFYAAKSMMKPFSLGY
Ga0325419_004520_10471_106233300034389LeafMFTIKSDHRLSEVGYDIIIEWTRSILLEGKRLKENLYAVKSMMKNLSLGC
Ga0325419_008011_7857_80093300034389LeafVFTIKSDHELSDAGYDKIIEWAISILPEGNRLKENFYAAKSMMKPLGLGY
Ga0325419_011990_2729_28813300034389LeafVFAIKSDHGLSEVEYDKIIEWARSILPEGNRMKENFYFAKSMMKPLGLGY
Ga0325419_012219_1536_16793300034389LeafVFIIKSDYGLSEAGYDKIIEWTRSILPERNRLKENFYVAKSMMKIIG
Ga0325419_039167_1119_12593300034389LeafVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAANFCILEN
Ga0325419_041166_2240_23923300034389LeafVFTIKSDYWLSEAGYDKIIEWARIILLEGNRLKENFYATKSMMKPLGLGY
Ga0325419_053074_2084_22513300034389LeafMFTIKSDHGLSRAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLSLGYQKIDMC
Ga0325419_053789_2084_22093300034389LeafLSEAGYDKIIEWARSILPEGNKLKENFYAAKSMMKPLGLGY
Ga0325419_059653_1770_18953300034389LeafLSEAGYDKIIEWAISILPEGNRLKENFYAAKSMMKPLGLGY
Ga0325419_120335_447_5903300034389LeafVFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLV
Ga0325420_001931_2197_23673300034688LeafMFTIKSDHGLCVAGYEKIIKWVTSILPKENRLKENLYVAKSMMKSFGLGYKKIDMW
Ga0325420_020511_5226_53783300034688LeafVFTIKSDHGLSEVGYDKIIEWARSILPEGNRLKENFYAVKSIMKPLGLGY
Ga0325420_024125_187_3123300034688LeafMSKTDYEKIVAWARSILFEGNKLKENFYATKSMMKPLVLGY
Ga0325420_025422_860_10033300034688LeafVFIIKSDYGLSEAGYDKIIEWTRSILPERNRLKENFYVAKSMMKIIS
Ga0325420_055467_477_6293300034688LeafVFTIKLDHGLSKASYDKIIEWARSILLEGNKLKENFYATKSMMKPLGLGY
Ga0325420_071929_536_6883300034688LeafVFSIKSDHGLSEAGYDKIIEWTRSILPEENRLKENFYAAKSMMKPLGLGY
Ga0325420_086282_5_1303300034688LeafLSEAGYDKIIEWARSILPEGNRLKENFYAAKSMMKPLGLGY
Ga0325420_145921_449_5743300034688LeafLSEAGYDKIIEWAISILPEGNRLKENFYAAKSMMKSLGLGY
Ga0325420_153563_404_5473300034688LeafMFTIKSDHGLSEAGYDKIIEWARSILPEGNRLKENFYTAKSMMKPLGL
Ga0325420_160176_316_4593300034688LeafVFTIKSDHGLSEAEYDKIIEWARSILPEWNRLKENFYAVKSMMKPSV
Ga0325421_007569_4408_45543300034689LeafVFTIKSDHGLNEADYDRIFEWTRSISLEGNRLKENFYIAKSIMKPLDL
Ga0325421_043024_37_2043300034689LeafVFTIKSDHGLSEVRYDKIIKWARSILPEGNKVKENFYAAKSMMKLLSLGYQKIIT
Ga0325421_090783_885_10523300034689LeafVFTIKLDHRLSEAGYDKIIEWARGILPEGNRLKENLYAAKSMMKPLSLGYQKIDM
Ga0325421_123484_21_1883300034689LeafVFTIKLDHRLSEAGYDKIIEWARGILPEGNRLKENFYAAKSMMKPLSLGYQKIDM
Ga0325421_128507_479_6463300034689LeafMFTIKSDHGLSEAEYDKIIEWEKSILPEGNRLKENLYATKSMMKPLGLGYQKINMC
Ga0325407_063096_61_2133300034899XylemVFTIKSDHGLNEARYDKIIEWARSILLEGNRLKENFYATKSMMKPLGLGY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.